F441979

General Info

Members Datasets Scaffolds Average Seq Length
429 174 858 81

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0601445|Ga0495651_0601445_386_631
Length 81
Sequence VAIKDFLRNPFSFLTARSQKEDRMAEYVIREHHRGRSLSDILDDAHIRNNCTPQEIDRLLDRPEVVHAFGDDIASAQRSKV

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
92 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
118 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
141 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
158 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
167 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.1
Metatranscriptomes 4.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.59
Rhizosphere 93.71
Stem 0
Stem Tuber 0
Unclassified 18.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0601445 3300046462 Bacteria 694
2 Ga0070658_10089706 3300005327 Bacteria 2531
3 Ga0070658_10098767 3300005327 Bacteria 2412
4 Ga0070658_10265741 3300005327 Bacteria 1458
5 Ga0070683_100018974 3300005329 Bacteria 6102
6 Ga0070683_100193777 3300005329 Bacteria 1930
7 Ga0070683_100621097 3300005329 Archaea 1034
8 Ga0070680_100020497 3300005336 Bacteria 5247
9 Ga0070680_100020648 3300005336 Bacteria 5229
10 Ga0070680_100045776 3300005336 Bacteria 3558
11 Ga0070680_100648263 3300005336 Bacteria 908
12 Ga0070680_101042503 3300005336 Bacteria 707
13 Ga0070682_100103158 3300005337 Bacteria 1887
14 Ga0070682_100117490 3300005337 Bacteria 1780
15 Ga0070682_100124291 3300005337 Bacteria 1737
16 Ga0070682_101222783 3300005337 Bacteria 635
17 Ga0070660_100005650 3300005339 Bacteria 8666
18 Ga0070660_100040222 3300005339 Bacteria 3557
19 Ga0070660_100045995 3300005339 Bacteria 3344
20 Ga0070660_100046379 3300005339 Bacteria 3331
21 Ga0070660_100059769 3300005339 Bacteria 2956
22 Ga0070660_100065879 3300005339 Bacteria 2820
23 Ga0070660_100493260 3300005339 Bacteria 1019
24 Ga0070660_100497075 3300005339 Bacteria 1014
25 Ga0070660_101676810 3300005339 Bacteria 541
26 Ga0070691_10493097 3300005341 Bacteria 707
27 Ga0070661_100021648 3300005344 Bacteria 4595
28 Ga0070661_100024932 3300005344 Bacteria 4293
29 Ga0070661_100104955 3300005344 Bacteria 2106
30 Ga0070661_100141221 3300005344 Bacteria 1815
31 Ga0070661_100604105 3300005344 Bacteria 887
32 Ga0070659_100261249 3300005366 Bacteria 1437
33 Ga0070659_101068205 3300005366 Unclassified 711
34 Ga0070714_100237995 3300005435 Bacteria 1680
35 Ga0070713_100835423 3300005436 Bacteria 884
36 Ga0070710_10193277 3300005437 Unclassified 1281
37 Ga0070710_11306219 3300005437 Bacteria 540
38 Ga0070711_101024994 3300005439 Bacteria 709
39 Ga0070705_101384965 3300005440 Unclassified 586
40 Ga0070708_100026999 3300005445 Bacteria 4921
41 Ga0070708_101528488 3300005445 Unclassified 622
42 Ga0070663_100149169 3300005455 Bacteria 1792
43 Ga0070663_100312329 3300005455 Bacteria 1262
44 Ga0070663_100740163 3300005455 Unclassified 839
45 Ga0070663_101133207 3300005455 Unclassified 685
46 Ga0070681_10017064 3300005458 Bacteria 7256
47 Ga0070681_10048445 3300005458 Bacteria 4246
48 Ga0070681_10069520 3300005458 Bacteria 3487
49 Ga0070681_10078222 3300005458 Bacteria 3265
50 Ga0070681_10773197 3300005458 Bacteria 877
51 Ga0070706_100143892 3300005467 Bacteria 2226
52 Ga0070706_101286714 3300005467 Bacteria 671
53 Ga0070707_100200903 3300005468 Bacteria 1943
54 Ga0070699_100947257 3300005518 Bacteria 789
55 Ga0070679_100033283 3300005530 Bacteria 5104
56 Ga0070679_100041019 3300005530 Bacteria 4607
57 Ga0070679_100042436 3300005530 Bacteria 4529
58 Ga0070679_100081140 3300005530 Bacteria 3233
59 Ga0070679_100102426 3300005530 Bacteria 2849
60 Ga0070679_100107846 3300005530 Bacteria 2771
61 Ga0070679_100129449 3300005530 Bacteria 2506
62 Ga0070679_100188597 3300005530 Unclassified 2031
63 Ga0070679_100450569 3300005530 Bacteria 1232
64 Ga0070679_100723789 3300005530 Bacteria 938
65 Ga0070684_100063791 3300005535 Bacteria 3231
66 Ga0070684_100069285 3300005535 Bacteria 3102
67 Ga0070684_100107519 3300005535 Bacteria 2498
68 Ga0070684_100133131 3300005535 Bacteria 2244
69 Ga0070684_100212150 3300005535 Unclassified 1765
70 Ga0070684_100936730 3300005535 Bacteria 812
71 Ga0068853_100073261 3300005539 Unclassified 2986
72 Ga0068853_100489141 3300005539 Bacteria 1161
73 Ga0068853_101025372 3300005539 Bacteria 795
74 Ga0070696_100277058 3300005546 Unclassified 1277
75 Ga0070665_100064543 3300005548 Bacteria 3672
76 Ga0068855_100049101 3300005563 Bacteria 4978
77 Ga0068855_100074845 3300005563 Bacteria 3932
78 Ga0068855_100365400 3300005563 Bacteria 1587
79 Ga0068855_100426652 3300005563 Bacteria 1450
80 Ga0068855_100488475 3300005563 Bacteria 1339
81 Ga0068855_101098304 3300005563 Bacteria 832
82 Ga0070664_100915731 3300005564 Unclassified 822
83 Ga0070664_101038788 3300005564 Bacteria 771
84 Ga0068857_100275592 3300005577 Unclassified 1546
85 Ga0068857_100321918 3300005577 Bacteria 1428
86 Ga0068857_100438106 3300005577 Bacteria 1220
87 Ga0068854_100214907 3300005578 Bacteria 1519
88 Ga0068854_101019766 3300005578 Bacteria 734
89 Ga0068856_100129436 3300005614 Bacteria 2528
90 Ga0068856_101190382 3300005614 Bacteria 778
91 Ga0068856_101696628 3300005614 Bacteria 644
92 Ga0068852_100025736 3300005616 Bacteria 4772
93 Ga0068852_100026479 3300005616 Bacteria 4714
94 Ga0068851_10314597 3300005834 Bacteria 903
95 Ga0081455_10072857 3300005937 Bacteria 2842
96 Ga0070717_10392278 3300006028 Bacteria 1246
97 Ga0070712_100176668 3300006175 Unclassified 1661
98 Ga0070712_101988843 3300006175 Unclassified 509
99 Ga0075433_10734638 3300006852 Bacteria 864
100 Ga0075434_100007870 3300006871 Bacteria 9873
101 Ga0075435_100148471 3300007076 Bacteria 1970
102 Ga0105240_10073576 3300009093 Bacteria 4219
103 Ga0105240_10554281 3300009093 Unclassified 1271
104 Ga0105240_10576485 3300009093 Bacteria 1242
105 Ga0105240_10886072 3300009093 Bacteria 961
106 Ga0105240_10937583 3300009093 Unclassified 929
107 Ga0105240_11361207 3300009093 Unclassified 747
108 Ga0105245_10148445 3300009098 Unclassified 2214
109 Ga0105241_10237109 3300009174 Bacteria 1540
110 Ga0105241_10388525 3300009174 Bacteria 1221
111 Ga0105241_10923387 3300009174 Unclassified 812
112 Ga0105241_11524346 3300009174 Bacteria 644
113 Ga0105241_11738490 3300009174 Bacteria 607
114 Ga0105237_10066073 3300009545 Bacteria 3612
115 Ga0105237_10113275 3300009545 Bacteria 2705
116 Ga0105237_10139933 3300009545 Bacteria 2414
117 Ga0105238_10072011 3300009551 Bacteria 3453
118 Ga0105238_10100575 3300009551 Bacteria 2874
119 Ga0105238_12492012 3300009551 Bacteria 553
120 Ga0105249_11116111 3300009553 Bacteria 859
121 Ga0105239_10064567 3300010375 Bacteria 4019
122 Ga0105246_10543741 3300011119 Bacteria 994
123 Ga0105246_11416289 3300011119 Unclassified 649
124 Ga0157347_1011963 3300012502 Unclassified 930
125 Ga0157373_10063948 3300013100 Bacteria 2604
126 Ga0157373_10318754 3300013100 Bacteria 1106
127 Ga0157371_10907758 3300013102 Bacteria 668
128 Ga0157371_11222370 3300013102 Bacteria 579
129 Ga0157370_10041061 3300013104 Bacteria 4466
130 Ga0157370_10159771 3300013104 Bacteria 2097
131 Ga0157370_10199255 3300013104 Unclassified 1857
132 Ga0157370_10240221 3300013104 Bacteria 1676
133 Ga0157370_10348499 3300013104 Bacteria 1365
134 Ga0157370_10738404 3300013104 Bacteria 897
135 Ga0157369_10029083 3300013105 Bacteria 6109
136 Ga0157369_10091319 3300013105 Bacteria 3251
137 Ga0157369_10125860 3300013105 Bacteria 2717
138 Ga0157369_10169729 3300013105 Bacteria 2299
139 Ga0157369_10313936 3300013105 Bacteria 1630
140 Ga0157369_11096427 3300013105 Bacteria 814
141 Ga0157369_11522447 3300013105 Bacteria 680
142 Ga0157374_10040394 3300013296 Bacteria 4296
143 Ga0157374_10315664 3300013296 Bacteria 1548
144 Ga0157374_10730795 3300013296 Unclassified 1004
145 Ga0157374_11301723 3300013296 Bacteria 749
146 Ga0157374_11986928 3300013296 Bacteria 608
147 Ga0157372_10037160 3300013307 Bacteria 5369
148 Ga0157372_10045886 3300013307 Bacteria 4849
149 Ga0157372_10162926 3300013307 Bacteria 2578
150 Ga0157372_10192089 3300013307 Bacteria 2365
151 Ga0157372_10991458 3300013307 Unclassified 973
152 Ga0157372_11464573 3300013307 Unclassified 787
153 Ga0157372_12037978 3300013307 Unclassified 659
154 Ga0157372_12156736 3300013307 Bacteria 640
155 Ga0163163_11546615 3300014325 Bacteria 724
156 Ga0182008_10311223 3300014497 Unclassified 826
157 Ga0182008_10516208 3300014497 Unclassified 659
158 Ga0182007_10257456 3300015262 Bacteria 628
159 Ga0182007_10396615 3300015262 Unclassified 525
160 Ga0182005_1087871 3300015265 Bacteria 863
161 Ga0197907_10101945 3300020069 Bacteria 2719
162 Ga0197907_10134433 3300020069 Unclassified 788
163 Ga0206356_10270218 3300020070 Bacteria 3163
164 Ga0206356_10861119 3300020070 Bacteria 1688
165 Ga0206356_11527282 3300020070 Bacteria 1846
166 Ga0206356_11615971 3300020070 Unclassified 647
167 Ga0206354_10546566 3300020081 Unclassified 806
168 Ga0206354_11129187 3300020081 Archaea 533
169 Ga0206354_11285470 3300020081 Bacteria 1815
170 Ga0206353_10318968 3300020082 Bacteria 1975
171 Ga0206353_10465379 3300020082 Unclassified 1332
172 Ga0206353_10717944 3300020082 Bacteria 1139
173 Ga0206353_10987038 3300020082 Bacteria 1380
174 Ga0154015_1220743 3300020610 Unclassified 656
175 Ga0224712_10038636 3300022467 Bacteria 1784
176 Ga0224712_10061335 3300022467 Unclassified 1499
177 Ga0224712_10178748 3300022467 Unclassified 955
178 Ga0207692_10135013 3300025898 Bacteria 1398
179 Ga0207647_10179919 3300025904 Bacteria 1229
180 Ga0207699_10645776 3300025906 Bacteria 773
181 Ga0207705_10107140 3300025909 Bacteria 2062
182 Ga0207705_10816409 3300025909 Bacteria 723
183 Ga0207705_11036748 3300025909 Unclassified 633
184 Ga0207705_11076744 3300025909 Bacteria 620
185 Ga0207684_10660218 3300025910 Bacteria 890
186 Ga0207654_10250817 3300025911 Bacteria 1186
187 Ga0207654_10376034 3300025911 Bacteria 983
188 Ga0207654_10961993 3300025911 Bacteria 620
189 Ga0207707_10004608 3300025912 Bacteria 12110
190 Ga0207707_10119699 3300025912 Bacteria 2301
191 Ga0207707_10146971 3300025912 Bacteria 2061
192 Ga0207707_10159176 3300025912 Bacteria 1974
193 Ga0207707_10192673 3300025912 Bacteria 1778
194 Ga0207707_10194452 3300025912 Bacteria 1769
195 Ga0207707_10625475 3300025912 Unclassified 909
196 Ga0207707_10820064 3300025912 Unclassified 774
197 Ga0207695_10107717 3300025913 Bacteria 2772
198 Ga0207695_10531622 3300025913 Bacteria 1057
199 Ga0207695_10631558 3300025913 Unclassified 952
200 Ga0207695_11084030 3300025913 Bacteria 681
201 Ga0207695_11585526 3300025913 Unclassified 535
202 Ga0207671_10206169 3300025914 Bacteria 1537
203 Ga0207671_10387568 3300025914 Bacteria 1111
204 Ga0207671_10466925 3300025914 Unclassified 1006
205 Ga0207693_10108442 3300025915 Bacteria 2178
206 Ga0207663_10162698 3300025916 Bacteria 1577
207 Ga0207663_11321451 3300025916 Bacteria 581
208 Ga0207660_10009676 3300025917 Bacteria 6239
209 Ga0207660_10068156 3300025917 Bacteria 2580
210 Ga0207660_10103089 3300025917 Bacteria 2134
211 Ga0207660_10105375 3300025917 Bacteria 2113
212 Ga0207660_10231378 3300025917 Bacteria 1453
213 Ga0207660_10270777 3300025917 Unclassified 1345
214 Ga0207660_11038142 3300025917 Unclassified 668
215 Ga0207657_10000610 3300025919 Bacteria 37898
216 Ga0207657_10007328 3300025919 Bacteria 11317
217 Ga0207657_10020404 3300025919 Bacteria 6263
218 Ga0207657_10051502 3300025919 Bacteria 3578
219 Ga0207657_10074992 3300025919 Bacteria 2855
220 Ga0207649_10020935 3300025920 Bacteria 3756
221 Ga0207649_10030091 3300025920 Bacteria 3212
222 Ga0207649_10045623 3300025920 Bacteria 2688
223 Ga0207649_10486028 3300025920 Bacteria 937
224 Ga0207652_10042811 3300025921 Bacteria 3855
225 Ga0207652_10043006 3300025921 Bacteria 3846
226 Ga0207652_10049053 3300025921 Bacteria 3612
227 Ga0207652_10102052 3300025921 Bacteria 2535
228 Ga0207652_10229901 3300025921 Bacteria 1671
229 Ga0207652_10290770 3300025921 Unclassified 1474
230 Ga0207652_10372719 3300025921 Bacteria 1289
231 Ga0207652_11666420 3300025921 Bacteria 542
232 Ga0207694_10116299 3300025924 Bacteria 2131
233 Ga0207694_10852190 3300025924 Bacteria 770
234 Ga0207700_10254322 3300025928 Bacteria 1502
235 Ga0207700_10274205 3300025928 Bacteria 1449
236 Ga0207664_10070626 3300025929 Bacteria 2811
237 Ga0207664_11134688 3300025929 Unclassified 698
238 Ga0207661_10273353 3300025944 Bacteria 1508
239 Ga0207661_10298655 3300025944 Bacteria 1443
240 Ga0207661_10440028 3300025944 Bacteria 1186
241 Ga0207679_10029791 3300025945 Bacteria 3804
242 Ga0207679_10691690 3300025945 Unclassified 925
243 Ga0207679_10714416 3300025945 Unclassified 910
244 Ga0207667_10540279 3300025949 Bacteria 1179
245 Ga0207667_10699038 3300025949 Bacteria 1016
246 Ga0207640_10050959 3300025981 Bacteria 2688
247 Ga0207640_10505145 3300025981 Unclassified 1007
248 Ga0207639_10199737 3300026041 Bacteria 1714
249 Ga0207639_10293066 3300026041 Bacteria 1435
250 Ga0207678_10061643 3300026067 Bacteria 3226
251 Ga0207678_10438434 3300026067 Bacteria 1134
252 Ga0207678_11459036 3300026067 Bacteria 604
253 Ga0207702_10112955 3300026078 Bacteria 2418
254 Ga0207674_10020357 3300026116 Bacteria 7168
255 Ga0207674_10042724 3300026116 Bacteria 4679
256 Ga0207674_10052082 3300026116 Bacteria 4175
257 Ga0207674_10703975 3300026116 Bacteria 975
258 Ga0207698_10014358 3300026142 Bacteria 5262
259 Ga0207698_10069301 3300026142 Bacteria 2788
260 Ga0265318_10069973 3300028577 Bacteria 1301
261 Ga0265322_10020285 3300028654 Unclassified 1906
262 Ga0265338_10029160 3300028800 Bacteria 5479
263 Ga0265338_10127484 3300028800 Bacteria 2017
264 Ga0265328_10074743 3300031239 Bacteria 1247
265 Ga0265325_10028088 3300031241 Bacteria 3036
266 Ga0265329_10008810 3300031242 Bacteria 3803
267 Ga0265327_10034341 3300031251 Bacteria 2815
268 Ga0265316_10046610 3300031344 Bacteria 3433
269 Ga0265313_10014003 3300031595 Bacteria 4775
270 Ga0265314_10021866 3300031711 Bacteria 4906
271 Ga0265314_10205652 3300031711 Unclassified 1160
272 Ga0265342_10244341 3300031712 Bacteria 960
273 Ga0265342_10354120 3300031712 Bacteria 764
274 Ga0373926_0307013 3300035083 Unclassified 620
275 Ga0373956_0091771 3300035119 Bacteria 1402
276 Ga0373957_0438167 3300035120 Unclassified 565
277 Ga0373935_0875725 3300035692 Bacteria 665
278 Ga0395899_0542337 3300037312 Bacteria 749
279 Ga0395900_0013298 3300037418 Bacteria 8415
280 Ga0395900_0076444 3300037418 Bacteria 3441
281 Ga0395900_0299535 3300037418 Bacteria 1595
282 Ga0395900_0446521 3300037418 Unclassified 1250
283 Ga0395900_1586584 3300037418 Unclassified 566
284 Ga0395900_1900398 3300037418 Unclassified 506
285 Ga0395898_0009790 3300037466 Bacteria 10046
286 Ga0395898_0652545 3300037466 Bacteria 995
287 Ga0395905_0035276 3300037471 Bacteria 4697
288 Ga0395905_0067851 3300037471 Bacteria 3341
289 Ga0395905_1136286 3300037471 Bacteria 684
290 Ga0395905_1610278 3300037471 Unclassified 554
291 Ga0436364_0648447 3300037853 Unclassified 592
292 Ga0395901_0001077 3300038443 Bacteria 29182
293 Ga0395901_0307200 3300038443 Unclassified 1643
294 Ga0395901_0331342 3300038443 Bacteria 1574
295 Ga0395901_0648838 3300038443 Bacteria 1059
296 Ga0436365_1442381 3300039437 Bacteria 1084
297 Ga0436360_0729743 3300039438 Bacteria 771
298 Ga0436363_1597774 3300039450 Unclassified 2596
299 Ga0436362_0186330 3300039453 Unclassified 657
300 Ga0451800_0520624 3300041459 Bacteria 502
301 Ga0439448_0087691 3300042005 Unclassified 1049
302 Ga0439455_0044386 3300042012 Bacteria 1147
303 Ga0466965_0101573 3300044683 Bacteria 1471
304 Ga0466965_0562627 3300044683 Bacteria 645
305 Ga0466966_0076449 3300044684 Bacteria 2091
306 Ga0466961_0020347 3300044693 Bacteria 4269
307 Ga0466961_0030837 3300044693 Bacteria 3445
308 Ga0466961_0081812 3300044693 Bacteria 2043
309 Ga0466963_0003084 3300044694 Bacteria 9444
310 Ga0466963_0007320 3300044694 Bacteria 6579
311 Ga0466963_0041137 3300044694 Bacteria 3030
312 Ga0466963_0043211 3300044694 Bacteria 2962
313 Ga0466963_0044102 3300044694 Bacteria 2935
314 Ga0466963_0123728 3300044694 Bacteria 1782
315 Ga0466963_0173291 3300044694 Unclassified 1504
316 Ga0466963_0239608 3300044694 Bacteria 1272
317 Ga0466964_0006768 3300044706 Bacteria 4273
318 Ga0466964_0019936 3300044706 Bacteria 2580
319 Ga0466964_0157321 3300044706 Bacteria 1059
320 Ga0466964_0347484 3300044706 Bacteria 761
321 Ga0466971_0044328 3300044719 Bacteria 1997
322 Ga0466971_0099835 3300044719 Unclassified 1333
323 Ga0466971_0165068 3300044719 Bacteria 1037
324 Ga0466971_0588663 3300044719 Bacteria 554
325 Ga0466968_0076801 3300044735 Bacteria 1462
326 Ga0466968_0171625 3300044735 Bacteria 1005
327 Ga0466970_0123128 3300044765 Bacteria 1421
328 Ga0466970_0291432 3300044765 Bacteria 919
329 Ga0466957_0011480 3300044842 Bacteria 5112
330 Ga0466957_0178721 3300044842 Bacteria 1385
331 Ga0466957_0279016 3300044842 Bacteria 1118
332 Ga0466957_0308544 3300044842 Bacteria 1065
333 Ga0466960_0341768 3300044901 Bacteria 852
334 Ga0466959_0006422 3300045049 Bacteria 8139
335 Ga0466959_0007928 3300045049 Bacteria 7480
336 Ga0466959_0034131 3300045049 Bacteria 3765
337 Ga0466959_0157069 3300045049 Bacteria 1600
338 Ga0466959_0232063 3300045049 Bacteria 1277
339 Ga0466958_0005254 3300045836 Bacteria 6939
340 Ga0466958_0045871 3300045836 Bacteria 2637
341 Ga0466958_0055894 3300045836 Bacteria 2396
342 Ga0466958_0085743 3300045836 Archaea 1943
343 Ga0466958_0112934 3300045836 Bacteria 1697
344 Ga0466958_0172711 3300045836 Bacteria 1369
345 Ga0466958_0324181 3300045836 Unclassified 990
346 Ga0466967_0010954 3300045976 Bacteria 6835
347 Ga0466967_0011760 3300045976 Bacteria 6654
348 Ga0466967_0024048 3300045976 Bacteria 5002
349 Ga0466967_0024940 3300045976 Bacteria 4923
350 Ga0466967_0032789 3300045976 Bacteria 4390
351 Ga0466967_0034755 3300045976 Bacteria 4282
352 Ga0466967_0070542 3300045976 Bacteria 3126
353 Ga0466967_0090999 3300045976 Bacteria 2772
354 Ga0466967_0138376 3300045976 Bacteria 2266
355 Ga0466967_0173635 3300045976 Bacteria 2029
356 Ga0466967_0490107 3300045976 Bacteria 1205
357 Ga0466967_0618753 3300045976 Bacteria 1070
358 Ga0466967_0680591 3300045976 Bacteria 1018
359 Ga0466967_0711910 3300045976 Unclassified 995
360 Ga0466967_1801004 3300045976 Unclassified 609
361 Ga0495629_0110132 3300046459 Bacteria 1920
362 Ga0495641_0471384 3300046461 Bacteria 572
363 Ga0495653_0288645 3300046463 Bacteria 1074
364 Ga0495582_0313086 3300046473 Bacteria 903
365 Ga0495594_0393503 3300046499 Bacteria 789
366 Ga0495594_0537198 3300046499 Bacteria 664
367 Ga0495630_0312743 3300046517 Bacteria 1201
368 Ga0495652_0246487 3300046529 Unclassified 1326
369 Ga0495652_0603703 3300046529 Unclassified 748
370 Ga0495645_0814379 3300046543 Unclassified 559
371 Ga0495599_0097124 3300046678 Bacteria 1837
372 Ga0495647_0100375 3300046681 Bacteria 1198
373 Ga0495613_0444203 3300046689 Bacteria 879
374 Ga0495581_0592966 3300047315 Bacteria 642
375 Ga0495676_0382052 3300047321 Unclassified 937
376 Ga0496101_0139681 3300048904 Bacteria 1845
377 Ga0496101_0326979 3300048904 Bacteria 1203
378 Ga0496102_0047964 3300048905 Bacteria 3883
379 Ga0496102_0374546 3300048905 Bacteria 1340
380 Ga0496103_0024735 3300048906 Bacteria 3624
381 Ga0496103_0045382 3300048906 Bacteria 2712
382 Ga0496103_0260376 3300048906 Unclassified 1116
383 Ga0496103_0426425 3300048906 Unclassified 851
384 Ga0496104_1174549 3300048907 Bacteria 671
385 Ga0496106_0471667 3300048909 Unclassified 1008
386 Ga0496107_0115745 3300048910 Bacteria 1973
387 Ga0496108_1381003 3300048911 Unclassified 590
388 Ga0496109_0363174 3300048912 Unclassified 1368
389 Ga0496112_0002370 3300048915 Bacteria 15140
390 Ga0496112_0050759 3300048915 Bacteria 4068
391 Ga0496112_0063415 3300048915 Bacteria 3645
392 Ga0496112_0219121 3300048915 Bacteria 1859
393 Ga0496112_0606443 3300048915 Unclassified 1026
394 Ga0496112_1738372 3300048915 Bacteria 536
395 Ga0496113_0180156 3300048916 Bacteria 1675
396 Ga0496113_0981753 3300048916 Bacteria 666
397 Ga0496114_0135366 3300048917 Bacteria 2130
398 Ga0496115_1221281 3300048918 Bacteria 564
399 Ga0501067_0000154 3300049583 Bacteria 38151
400 Ga0501067_0032147 3300049583 Bacteria 2912
401 Ga0501068_0319351 3300049584 Bacteria 995
402 Ga0501069_0001465 3300049585 Bacteria 11614
403 Ga0501069_0044801 3300049585 Bacteria 2449
404 Ga0501069_0437388 3300049585 Bacteria 777
405 Ga0501069_0498337 3300049585 Bacteria 726
406 Ga0501070_0109291 3300049586 Bacteria 2285
407 Ga0501070_0272563 3300049586 Bacteria 1382
408 Ga0501072_0592073 3300049588 Bacteria 875
409 Ga0501074_0673125 3300049590 Bacteria 731
410 Ga0501079_0490194 3300049741 Bacteria 966
411 Ga0501079_0882437 3300049741 Bacteria 704
412 Ga0501080_0172059 3300049742 Bacteria 1997
413 Ga0501080_0661060 3300049742 Bacteria 924
414 nmdc:mga0n895_1164623_c1 3300050512 Bacteria 746
415 nmdc:mga0n895_14634_c2 3300050512 Bacteria 5905
416 nmdc:mga0a205_21088_c1 3300050515 Bacteria 4471
417 Ga0495601_0511876 3300053077 Bacteria 774
418 Ga0501084_0593018 3300054114 Unclassified 936
419 Ga0587073_0296009 3300059492 Unclassified 525
420 Ga0587077_251660 3300059493 Bacteria 511
421 Ga0587101_150800 3300059623 Bacteria 503
422 Ga0587128_013202 3300059630 Unclassified 1162
423 Ga0466962_0001750 3300061719 Bacteria 10213
424 Ga0466962_0024612 3300061719 Bacteria 2891
425 Ga0466962_0087924 3300061719 Bacteria 1488
426 Ga0466962_0159756 3300061719 Unclassified 1095
427 Ga0530510_0075135 3300061734 Bacteria 2454
428 Ga0530510_0318574 3300061734 Bacteria 1165
429 Ga0530510_0732047 3300061734 Bacteria 754
430 Ga0495651_0601445
431 Ga0070658_10089706
432 Ga0070658_10098767
433 Ga0070658_10265741
434 Ga0070683_100018974
435 Ga0070683_100193777
436 Ga0070683_100621097
437 Ga0070680_100020497
438 Ga0070680_100020648
439 Ga0070680_100045776
440 Ga0070680_100648263
441 Ga0070680_101042503
442 Ga0070682_100103158
443 Ga0070682_100117490
444 Ga0070682_100124291
445 Ga0070682_101222783
446 Ga0070660_100005650
447 Ga0070660_100040222
448 Ga0070660_100045995
449 Ga0070660_100046379
450 Ga0070660_100059769
451 Ga0070660_100065879
452 Ga0070660_100493260
453 Ga0070660_100497075
454 Ga0070660_101676810
455 Ga0070691_10493097
456 Ga0070661_100021648
457 Ga0070661_100024932
458 Ga0070661_100104955
459 Ga0070661_100141221
460 Ga0070661_100604105
461 Ga0070659_100261249
462 Ga0070659_101068205
463 Ga0070714_100237995
464 Ga0070713_100835423
465 Ga0070710_10193277
466 Ga0070710_11306219
467 Ga0070711_101024994
468 Ga0070705_101384965
469 Ga0070708_100026999
470 Ga0070708_101528488
471 Ga0070663_100149169
472 Ga0070663_100312329
473 Ga0070663_100740163
474 Ga0070663_101133207
475 Ga0070681_10017064
476 Ga0070681_10048445
477 Ga0070681_10069520
478 Ga0070681_10078222
479 Ga0070681_10773197
480 Ga0070706_100143892
481 Ga0070706_101286714
482 Ga0070707_100200903
483 Ga0070699_100947257
484 Ga0070679_100033283
485 Ga0070679_100041019
486 Ga0070679_100042436
487 Ga0070679_100081140
488 Ga0070679_100102426
489 Ga0070679_100107846
490 Ga0070679_100129449
491 Ga0070679_100188597
492 Ga0070679_100450569
493 Ga0070679_100723789
494 Ga0070684_100063791
495 Ga0070684_100069285
496 Ga0070684_100107519
497 Ga0070684_100133131
498 Ga0070684_100212150
499 Ga0070684_100936730
500 Ga0068853_100073261
501 Ga0068853_100489141
502 Ga0068853_101025372
503 Ga0070696_100277058
504 Ga0070665_100064543
505 Ga0068855_100049101
506 Ga0068855_100074845
507 Ga0068855_100365400
508 Ga0068855_100426652
509 Ga0068855_100488475
510 Ga0068855_101098304
511 Ga0070664_100915731
512 Ga0070664_101038788
513 Ga0068857_100275592
514 Ga0068857_100321918
515 Ga0068857_100438106
516 Ga0068854_100214907
517 Ga0068854_101019766
518 Ga0068856_100129436
519 Ga0068856_101190382
520 Ga0068856_101696628
521 Ga0068852_100025736
522 Ga0068852_100026479
523 Ga0068851_10314597
524 Ga0081455_10072857
525 Ga0070717_10392278
526 Ga0070712_100176668
527 Ga0070712_101988843
528 Ga0075433_10734638
529 Ga0075434_100007870
530 Ga0075435_100148471
531 Ga0105240_10073576
532 Ga0105240_10554281
533 Ga0105240_10576485
534 Ga0105240_10886072
535 Ga0105240_10937583
536 Ga0105240_11361207
537 Ga0105245_10148445
538 Ga0105241_10237109
539 Ga0105241_10388525
540 Ga0105241_10923387
541 Ga0105241_11524346
542 Ga0105241_11738490
543 Ga0105237_10066073
544 Ga0105237_10113275
545 Ga0105237_10139933
546 Ga0105238_10072011
547 Ga0105238_10100575
548 Ga0105238_12492012
549 Ga0105249_11116111
550 Ga0105239_10064567
551 Ga0105246_10543741
552 Ga0105246_11416289
553 Ga0157347_1011963
554 Ga0157373_10063948
555 Ga0157373_10318754
556 Ga0157371_10907758
557 Ga0157371_11222370
558 Ga0157370_10041061
559 Ga0157370_10159771
560 Ga0157370_10199255
561 Ga0157370_10240221
562 Ga0157370_10348499
563 Ga0157370_10738404
564 Ga0157369_10029083
565 Ga0157369_10091319
566 Ga0157369_10125860
567 Ga0157369_10169729
568 Ga0157369_10313936
569 Ga0157369_11096427
570 Ga0157369_11522447
571 Ga0157374_10040394
572 Ga0157374_10315664
573 Ga0157374_10730795
574 Ga0157374_11301723
575 Ga0157374_11986928
576 Ga0157372_10037160
577 Ga0157372_10045886
578 Ga0157372_10162926
579 Ga0157372_10192089
580 Ga0157372_10991458
581 Ga0157372_11464573
582 Ga0157372_12037978
583 Ga0157372_12156736
584 Ga0163163_11546615
585 Ga0182008_10311223
586 Ga0182008_10516208
587 Ga0182007_10257456
588 Ga0182007_10396615
589 Ga0182005_1087871
590 Ga0197907_10101945
591 Ga0197907_10134433
592 Ga0206356_10270218
593 Ga0206356_10861119
594 Ga0206356_11527282
595 Ga0206356_11615971
596 Ga0206354_10546566
597 Ga0206354_11129187
598 Ga0206354_11285470
599 Ga0206353_10318968
600 Ga0206353_10465379
601 Ga0206353_10717944
602 Ga0206353_10987038
603 Ga0154015_1220743
604 Ga0224712_10038636
605 Ga0224712_10061335
606 Ga0224712_10178748
607 Ga0207692_10135013
608 Ga0207647_10179919
609 Ga0207699_10645776
610 Ga0207705_10107140
611 Ga0207705_10816409
612 Ga0207705_11036748
613 Ga0207705_11076744
614 Ga0207684_10660218
615 Ga0207654_10250817
616 Ga0207654_10376034
617 Ga0207654_10961993
618 Ga0207707_10004608
619 Ga0207707_10119699
620 Ga0207707_10146971
621 Ga0207707_10159176
622 Ga0207707_10192673
623 Ga0207707_10194452
624 Ga0207707_10625475
625 Ga0207707_10820064
626 Ga0207695_10107717
627 Ga0207695_10531622
628 Ga0207695_10631558
629 Ga0207695_11084030
630 Ga0207695_11585526
631 Ga0207671_10206169
632 Ga0207671_10387568
633 Ga0207671_10466925
634 Ga0207693_10108442
635 Ga0207663_10162698
636 Ga0207663_11321451
637 Ga0207660_10009676
638 Ga0207660_10068156
639 Ga0207660_10103089
640 Ga0207660_10105375
641 Ga0207660_10231378
642 Ga0207660_10270777
643 Ga0207660_11038142
644 Ga0207657_10000610
645 Ga0207657_10007328
646 Ga0207657_10020404
647 Ga0207657_10051502
648 Ga0207657_10074992
649 Ga0207649_10020935
650 Ga0207649_10030091
651 Ga0207649_10045623
652 Ga0207649_10486028
653 Ga0207652_10042811
654 Ga0207652_10043006
655 Ga0207652_10049053
656 Ga0207652_10102052
657 Ga0207652_10229901
658 Ga0207652_10290770
659 Ga0207652_10372719
660 Ga0207652_11666420
661 Ga0207694_10116299
662 Ga0207694_10852190
663 Ga0207700_10254322
664 Ga0207700_10274205
665 Ga0207664_10070626
666 Ga0207664_11134688
667 Ga0207661_10273353
668 Ga0207661_10298655
669 Ga0207661_10440028
670 Ga0207679_10029791
671 Ga0207679_10691690
672 Ga0207679_10714416
673 Ga0207667_10540279
674 Ga0207667_10699038
675 Ga0207640_10050959
676 Ga0207640_10505145
677 Ga0207639_10199737
678 Ga0207639_10293066
679 Ga0207678_10061643
680 Ga0207678_10438434
681 Ga0207678_11459036
682 Ga0207702_10112955
683 Ga0207674_10020357
684 Ga0207674_10042724
685 Ga0207674_10052082
686 Ga0207674_10703975
687 Ga0207698_10014358
688 Ga0207698_10069301
689 Ga0265318_10069973
690 Ga0265322_10020285
691 Ga0265338_10029160
692 Ga0265338_10127484
693 Ga0265328_10074743
694 Ga0265325_10028088
695 Ga0265329_10008810
696 Ga0265327_10034341
697 Ga0265316_10046610
698 Ga0265313_10014003
699 Ga0265314_10021866
700 Ga0265314_10205652
701 Ga0265342_10244341
702 Ga0265342_10354120
703 Ga0373926_0307013
704 Ga0373956_0091771
705 Ga0373957_0438167
706 Ga0373935_0875725
707 Ga0395899_0542337
708 Ga0395900_0013298
709 Ga0395900_0076444
710 Ga0395900_0299535
711 Ga0395900_0446521
712 Ga0395900_1586584
713 Ga0395900_1900398
714 Ga0395898_0009790
715 Ga0395898_0652545
716 Ga0395905_0035276
717 Ga0395905_0067851
718 Ga0395905_1136286
719 Ga0395905_1610278
720 Ga0436364_0648447
721 Ga0395901_0001077
722 Ga0395901_0307200
723 Ga0395901_0331342
724 Ga0395901_0648838
725 Ga0436365_1442381
726 Ga0436360_0729743
727 Ga0436363_1597774
728 Ga0436362_0186330
729 Ga0451800_0520624
730 Ga0439448_0087691
731 Ga0439455_0044386
732 Ga0466965_0101573
733 Ga0466965_0562627
734 Ga0466966_0076449
735 Ga0466961_0020347
736 Ga0466961_0030837
737 Ga0466961_0081812
738 Ga0466963_0003084
739 Ga0466963_0007320
740 Ga0466963_0041137
741 Ga0466963_0043211
742 Ga0466963_0044102
743 Ga0466963_0123728
744 Ga0466963_0173291
745 Ga0466963_0239608
746 Ga0466964_0006768
747 Ga0466964_0019936
748 Ga0466964_0157321
749 Ga0466964_0347484
750 Ga0466971_0044328
751 Ga0466971_0099835
752 Ga0466971_0165068
753 Ga0466971_0588663
754 Ga0466968_0076801
755 Ga0466968_0171625
756 Ga0466970_0123128
757 Ga0466970_0291432
758 Ga0466957_0011480
759 Ga0466957_0178721
760 Ga0466957_0279016
761 Ga0466957_0308544
762 Ga0466960_0341768
763 Ga0466959_0006422
764 Ga0466959_0007928
765 Ga0466959_0034131
766 Ga0466959_0157069
767 Ga0466959_0232063
768 Ga0466958_0005254
769 Ga0466958_0045871
770 Ga0466958_0055894
771 Ga0466958_0085743
772 Ga0466958_0112934
773 Ga0466958_0172711
774 Ga0466958_0324181
775 Ga0466967_0010954
776 Ga0466967_0011760
777 Ga0466967_0024048
778 Ga0466967_0024940
779 Ga0466967_0032789
780 Ga0466967_0034755
781 Ga0466967_0070542
782 Ga0466967_0090999
783 Ga0466967_0138376
784 Ga0466967_0173635
785 Ga0466967_0490107
786 Ga0466967_0618753
787 Ga0466967_0680591
788 Ga0466967_0711910
789 Ga0466967_1801004
790 Ga0495629_0110132
791 Ga0495641_0471384
792 Ga0495653_0288645
793 Ga0495582_0313086
794 Ga0495594_0393503
795 Ga0495594_0537198
796 Ga0495630_0312743
797 Ga0495652_0246487
798 Ga0495652_0603703
799 Ga0495645_0814379
800 Ga0495599_0097124
801 Ga0495647_0100375
802 Ga0495613_0444203
803 Ga0495581_0592966
804 Ga0495676_0382052
805 Ga0496101_0139681
806 Ga0496101_0326979
807 Ga0496102_0047964
808 Ga0496102_0374546
809 Ga0496103_0024735
810 Ga0496103_0045382
811 Ga0496103_0260376
812 Ga0496103_0426425
813 Ga0496104_1174549
814 Ga0496106_0471667
815 Ga0496107_0115745
816 Ga0496108_1381003
817 Ga0496109_0363174
818 Ga0496112_0002370
819 Ga0496112_0050759
820 Ga0496112_0063415
821 Ga0496112_0219121
822 Ga0496112_0606443
823 Ga0496112_1738372
824 Ga0496113_0180156
825 Ga0496113_0981753
826 Ga0496114_0135366
827 Ga0496115_1221281
828 Ga0501067_0000154
829 Ga0501067_0032147
830 Ga0501068_0319351
831 Ga0501069_0001465
832 Ga0501069_0044801
833 Ga0501069_0437388
834 Ga0501069_0498337
835 Ga0501070_0109291
836 Ga0501070_0272563
837 Ga0501072_0592073
838 Ga0501074_0673125
839 Ga0501079_0490194
840 Ga0501079_0882437
841 Ga0501080_0172059
842 Ga0501080_0661060
843 nmdc:mga0n895_1164623_c1
844 nmdc:mga0n895_14634_c2
845 nmdc:mga0a205_21088_c1
846 Ga0495601_0511876
847 Ga0501084_0593018
848 Ga0587073_0296009
849 Ga0587077_251660
850 Ga0587101_150800
851 Ga0587128_013202
852 Ga0466962_0001750
853 Ga0466962_0024612
854 Ga0466962_0087924
855 Ga0466962_0159756
856 Ga0530510_0075135
857 Ga0530510_0318574
858 Ga0530510_0732047

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qiz-assembly1.cif.gz_k specific features and methylation sites of a plant 80s ribosome 0.3851 4 61
8btr-assembly1.cif.gz_Lj giardia ribosome in pre-t hybrid state (d2) 0.3822 5 79
6zu5-assembly1.cif.gz_LII structure of the paranosema locustae ribosome in complex with lso2 0.3528 2 79
8eup-assembly1.cif.gz_i ytm1 associated 60s nascent ribosome state 1a 0.3242 1 80
8btr-assembly1.cif.gz_Lj giardia ribosome in pre-t hybrid state (d2) 0.3007 5 79
ID Description Score Start End Superfamily
af_E7F2D8_26_102_1.20.1160.20 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat); 0.4808 18 75 1.20.1160.20
af_Q1PEF6_1_85_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.4763 2 80 3.30.710.10
af_Q1PEF6_1_85_3.30.710.10 Alpha Beta;2-Layer Sandwich;Potassium Channel Kv1.1; Chain A;Potassium Channel Kv1.1; Chain A 0.4638 2 80 3.30.710.10
af_Q54M77_962_1046_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.4227 9 70 1.10.10.10
4yl6A00 Mainly Alpha;Up-down Bundle;Paired amphipathic helix 2 (pah2 repeat); 0.3993 2 77 1.20.1160.20
ID Description Score Start End GO Terms
AF-A0A7M2Z0C1-F1-model_v4 Universal stress protein family 0.8783 17 80
AF-A0A7M2YV21-F1-model_v4 Uncharacterized protein 0.8674 6 80
AF-A0A538E0X5-F1-model_v4 Uncharacterized protein 0.8407 5 80
AF-A0A7C6Q197-F1-model_v4 Uncharacterized protein 0.8053 22 81
AF-A0A7M2YV21-F1-model_v4 Uncharacterized protein 0.8051 6 80

Map