F441973

General Info

Members Datasets Scaffolds Average Seq Length
429 220 858 164

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0092632|Ga0466967_0092632_1524_2045
Length 173
Sequence LSSLAEAASQAAALAEAGDERALATLRARWDDELEAAARAGDFRERAAAFRAIGQFRFRQKTELLRRGLDDDSPAVRGSALLSLELLSRDHPGVVNDVRPLLHELVAHDGNEAVRRLAVVALRNGSPRPDTIQILASLADDDEAPRELRDAAGKVAQQLRRSATAATAARRAR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
124 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
196 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
220 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.27
Metatranscriptomes 3.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.96
Rhizosphere 87.88
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0092632 3300045976 Bacteria 2748
2 Ga0070683_100009312 3300005329 Bacteria 8391
3 Ga0070683_100246647 3300005329 Bacteria 1699
4 Ga0070683_100395530 3300005329 Bacteria 1318
5 Ga0070670_100006736 3300005331 Bacteria 9740
6 Ga0070680_100213263 3300005336 Bacteria 1629
7 Ga0070682_100859432 3300005337 Bacteria 742
8 Ga0070660_100004599 3300005339 Bacteria 9544
9 Ga0070687_100310495 3300005343 Bacteria 1004
10 Ga0070661_100024564 3300005344 Bacteria 4322
11 Ga0070661_100340641 3300005344 Bacteria 1174
12 Ga0070671_100211962 3300005355 Bacteria 1643
13 Ga0070673_100026965 3300005364 Bacteria 4253
14 Ga0070673_100571067 3300005364 Unclassified 1029
15 Ga0070659_100127420 3300005366 Bacteria 2066
16 Ga0070714_100030070 3300005435 Bacteria 4519
17 Ga0070714_100248547 3300005435 Bacteria 1644
18 Ga0070714_100602927 3300005435 Bacteria 1055
19 Ga0070714_101083395 3300005435 Bacteria 781
20 Ga0070713_100515990 3300005436 Bacteria 1129
21 Ga0070713_100531699 3300005436 Bacteria 1112
22 Ga0070708_100056904 3300005445 Bacteria 3479
23 Ga0070678_100528409 3300005456 Bacteria 1045
24 Ga0070681_10012047 3300005458 Bacteria 8576
25 Ga0070681_10077881 3300005458 Bacteria 3272
26 Ga0070681_10223110 3300005458 Bacteria 1800
27 Ga0070681_10232124 3300005458 Bacteria 1759
28 Ga0070707_100634601 3300005468 Bacteria 1031
29 Ga0070707_100676081 3300005468 Bacteria 995
30 Ga0070698_100295406 3300005471 Bacteria 1551
31 Ga0070699_100748009 3300005518 Bacteria 894
32 Ga0070679_100034522 3300005530 Bacteria 5013
33 Ga0070679_100080740 3300005530 Bacteria 3242
34 Ga0070679_100189447 3300005530 Bacteria 2026
35 Ga0070679_100220035 3300005530 Bacteria 1860
36 Ga0070679_100478237 3300005530 Bacteria 1190
37 Ga0070679_100514767 3300005530 Bacteria 1140
38 Ga0070684_100088602 3300005535 Bacteria 2750
39 Ga0070684_100089088 3300005535 Bacteria 2742
40 Ga0070684_100107666 3300005535 Bacteria 2497
41 Ga0070684_100359212 3300005535 Bacteria 1340
42 Ga0070695_100809728 3300005545 Bacteria 751
43 Ga0070696_100247765 3300005546 Bacteria 1346
44 Ga0070693_100037639 3300005547 Bacteria 2699
45 Ga0070693_100376301 3300005547 Unclassified 978
46 Ga0070665_100436893 3300005548 Bacteria 1318
47 Ga0068855_100027560 3300005563 Bacteria 6795
48 Ga0068855_100035309 3300005563 Bacteria 5955
49 Ga0068855_100105948 3300005563 Bacteria 3232
50 Ga0068855_100107510 3300005563 Bacteria 3205
51 Ga0068855_100196779 3300005563 Bacteria 2271
52 Ga0068855_100326137 3300005563 Bacteria 1696
53 Ga0068855_100359039 3300005563 Bacteria 1603
54 Ga0070664_100133456 3300005564 Bacteria 2182
55 Ga0068857_100064407 3300005577 Bacteria 3259
56 Ga0068856_101731201 3300005614 Bacteria 637
57 Ga0068852_100027044 3300005616 Bacteria 4670
58 Ga0068852_100218263 3300005616 Bacteria 1812
59 Ga0068870_10018043 3300005840 Bacteria 3401
60 Ga0068858_100147105 3300005842 Bacteria 2213
61 Ga0070717_10205406 3300006028 Bacteria 1727
62 Ga0070717_10945329 3300006028 Bacteria 785
63 Ga0070712_100508575 3300006175 Bacteria 1010
64 Ga0068871_100463122 3300006358 Bacteria 1138
65 Ga0075428_100682162 3300006844 Bacteria 1095
66 Ga0068865_101661971 3300006881 Bacteria 575
67 Ga0105240_10118331 3300009093 Bacteria 3193
68 Ga0114129_10849125 3300009147 Bacteria 1161
69 Ga0105242_10879269 3300009176 Unclassified 894
70 Ga0105248_11789464 3300009177 Unclassified 697
71 Ga0105237_10047070 3300009545 Bacteria 4336
72 Ga0105238_10057323 3300009551 Bacteria 3906
73 Ga0105239_10219741 3300010375 Bacteria 2131
74 Ga0105246_10108331 3300011119 Bacteria 2036
75 Ga0157370_10066547 3300013104 Bacteria 3407
76 Ga0157369_10003375 3300013105 Bacteria 18973
77 Ga0157369_10011628 3300013105 Bacteria 9996
78 Ga0157369_10045131 3300013105 Bacteria 4795
79 Ga0157374_10586609 3300013296 Bacteria 1124
80 Ga0157374_11368468 3300013296 Bacteria 730
81 Ga0157374_11438741 3300013296 Unclassified 712
82 Ga0157372_10376845 3300013307 Bacteria 1653
83 Ga0157372_10548387 3300013307 Bacteria 1348
84 Ga0157375_10045711 3300013308 Bacteria 4263
85 Ga0157375_10687547 3300013308 Bacteria 1177
86 Ga0163163_11567308 3300014325 Bacteria 720
87 Ga0163163_11982973 3300014325 Bacteria 642
88 Ga0182008_10027470 3300014497 Bacteria 2882
89 Ga0157377_10728061 3300014745 Bacteria 723
90 Ga0157376_11602858 3300014969 Unclassified 685
91 Ga0197907_10098605 3300020069 Bacteria 1499
92 Ga0197907_11244332 3300020069 Bacteria 1070
93 Ga0206356_10291319 3300020070 Bacteria 2210
94 Ga0206356_10937194 3300020070 Bacteria 1105
95 Ga0206356_11477761 3300020070 Bacteria 3465
96 Ga0206350_11216675 3300020080 Bacteria 1054
97 Ga0206354_10038417 3300020081 Bacteria 1311
98 Ga0206353_10221391 3300020082 Bacteria 2891
99 Ga0206353_10225393 3300020082 Bacteria 3201
100 Ga0206353_10545868 3300020082 Bacteria 2465
101 Ga0206353_10679077 3300020082 Bacteria 6637
102 Ga0206353_10983504 3300020082 Bacteria 1830
103 Ga0213876_10064038 3300021384 Bacteria 1941
104 Ga0213871_10035256 3300021441 Bacteria 1323
105 Ga0224712_10019852 3300022467 Bacteria 2273
106 Ga0224712_10126068 3300022467 Unclassified 1113
107 Ga0224712_10143670 3300022467 Bacteria 1052
108 Ga0224712_10205922 3300022467 Bacteria 896
109 Ga0207685_10165916 3300025905 Bacteria 1012
110 Ga0207699_10997822 3300025906 Unclassified 619
111 Ga0207643_10022597 3300025908 Bacteria 3464
112 Ga0207684_10720867 3300025910 Bacteria 846
113 Ga0207707_10203154 3300025912 Bacteria 1727
114 Ga0207707_10224211 3300025912 Bacteria 1636
115 Ga0207707_10365607 3300025912 Bacteria 1242
116 Ga0207695_10042425 3300025913 Bacteria 4859
117 Ga0207671_10442480 3300025914 Bacteria 1035
118 Ga0207693_10314668 3300025915 Bacteria 1226
119 Ga0207693_10346566 3300025915 Bacteria 1162
120 Ga0207660_10419123 3300025917 Bacteria 1080
121 Ga0207657_10001143 3300025919 Bacteria 28211
122 Ga0207657_10074584 3300025919 Bacteria 2864
123 Ga0207649_10057748 3300025920 Bacteria 2427
124 Ga0207652_10070289 3300025921 Bacteria 3040
125 Ga0207652_10090059 3300025921 Bacteria 2695
126 Ga0207646_10186745 3300025922 Bacteria 1872
127 Ga0207646_10465359 3300025922 Bacteria 1140
128 Ga0207694_10257042 3300025924 Bacteria 1430
129 Ga0207650_10004269 3300025925 Bacteria 9752
130 Ga0207650_10008929 3300025925 Bacteria 6849
131 Ga0207687_10244762 3300025927 Bacteria 1423
132 Ga0207687_10461527 3300025927 Bacteria 1055
133 Ga0207700_10334879 3300025928 Bacteria 1314
134 Ga0207700_10766090 3300025928 Bacteria 863
135 Ga0207664_10313353 3300025929 Bacteria 1383
136 Ga0207664_11000407 3300025929 Bacteria 749
137 Ga0207664_11003905 3300025929 Bacteria 748
138 Ga0207644_10131393 3300025931 Bacteria 1917
139 Ga0207709_10740113 3300025935 Bacteria 790
140 Ga0207711_11234865 3300025941 Unclassified 689
141 Ga0207689_10139509 3300025942 Bacteria 1997
142 Ga0207661_10409243 3300025944 Bacteria 1231
143 Ga0207667_10100203 3300025949 Bacteria 2988
144 Ga0207667_10188723 3300025949 Bacteria 2115
145 Ga0207667_10380130 3300025949 Bacteria 1439
146 Ga0207667_10593358 3300025949 Bacteria 1117
147 Ga0207667_10722035 3300025949 Bacteria 997
148 Ga0207651_10351854 3300025960 Unclassified 1241
149 Ga0207658_10005052 3300025986 Bacteria 9079
150 Ga0207677_10351081 3300026023 Bacteria 1236
151 Ga0207677_10760507 3300026023 Bacteria 864
152 Ga0207703_10077129 3300026035 Bacteria 2766
153 Ga0207639_10555255 3300026041 Bacteria 1055
154 Ga0207678_10095908 3300026067 Bacteria 2535
155 Ga0207678_10106833 3300026067 Bacteria 2388
156 Ga0207702_10530900 3300026078 Bacteria 1149
157 Ga0207702_10579967 3300026078 Bacteria 1099
158 Ga0207702_11295379 3300026078 Bacteria 723
159 Ga0207674_10018225 3300026116 Bacteria 7639
160 Ga0207683_10157582 3300026121 Bacteria 2051
161 Ga0207698_10014381 3300026142 Bacteria 5259
162 Ga0207698_10174011 3300026142 Bacteria 1899
163 Ga0207698_11004387 3300026142 Bacteria 845
164 Ga0207698_11295252 3300026142 Bacteria 743
165 Ga0268266_10511551 3300028379 Bacteria 1147
166 Ga0265334_10026627 3300028573 Bacteria 2334
167 Ga0265338_10044289 3300028800 Bacteria 4111
168 Ga0265330_10065229 3300031235 Bacteria 1581
169 Ga0265332_10042028 3300031238 Bacteria 1977
170 Ga0265328_10038618 3300031239 Bacteria 1762
171 Ga0265325_10016928 3300031241 Bacteria 4064
172 Ga0265340_10164772 3300031247 Bacteria 1006
173 Ga0265339_10046503 3300031249 Bacteria 2385
174 Ga0265331_10122643 3300031250 Bacteria 1188
175 Ga0265327_10052457 3300031251 Bacteria 2123
176 Ga0265316_10161118 3300031344 Bacteria 1677
177 Ga0265316_10319750 3300031344 Unclassified 1127
178 Ga0265313_10008617 3300031595 Bacteria 6746
179 Ga0265314_10013433 3300031711 Bacteria 6614
180 Ga0265342_10055912 3300031712 Bacteria 2341
181 Ga0373923_0066012 3300035111 Bacteria 1546
182 Ga0373937_0559178 3300036401 Bacteria 1087
183 Ga0395899_0216183 3300037312 Bacteria 1329
184 Ga0395900_0022982 3300037418 Bacteria 6381
185 Ga0395900_0031662 3300037418 Bacteria 5436
186 Ga0395900_0085760 3300037418 Bacteria 3236
187 Ga0395900_0089754 3300037418 Bacteria 3159
188 Ga0395900_0098639 3300037418 Bacteria 3002
189 Ga0395900_0256549 3300037418 Bacteria 1748
190 Ga0395900_0552085 3300037418 Bacteria 1096
191 Ga0395900_1230872 3300037418 Bacteria 664
192 Ga0395898_0002446 3300037466 Bacteria 21955
193 Ga0395898_0006849 3300037466 Bacteria 12117
194 Ga0395898_0034848 3300037466 Bacteria 5010
195 Ga0395898_0099467 3300037466 Bacteria 2793
196 Ga0395898_0178249 3300037466 Bacteria 2031
197 Ga0395898_0420140 3300037466 Bacteria 1274
198 Ga0395898_0553978 3300037466 Bacteria 1092
199 Ga0395898_0836052 3300037466 Bacteria 860
200 Ga0395898_0903396 3300037466 Bacteria 821
201 Ga0395898_1114365 3300037466 Bacteria 722
202 Ga0395905_0037119 3300037471 Bacteria 4576
203 Ga0395905_0136618 3300037471 Bacteria 2307
204 Ga0395905_0144924 3300037471 Bacteria 2235
205 Ga0395905_0188788 3300037471 Bacteria 1934
206 Ga0395905_0830963 3300037471 Bacteria 827
207 Ga0436364_1268764 3300037853 Bacteria 603
208 Ga0395901_0003113 3300038443 Bacteria 16671
209 Ga0395901_0012761 3300038443 Bacteria 8523
210 Ga0395901_0015184 3300038443 Bacteria 7833
211 Ga0395901_0020152 3300038443 Bacteria 6825
212 Ga0395901_0023022 3300038443 Bacteria 6385
213 Ga0395901_0039146 3300038443 Bacteria 4906
214 Ga0395901_0048020 3300038443 Bacteria 4433
215 Ga0395901_0108696 3300038443 Bacteria 2911
216 Ga0395901_0171944 3300038443 Bacteria 2273
217 Ga0395901_0482116 3300038443 Bacteria 1265
218 Ga0395901_0709198 3300038443 Bacteria 1003
219 Ga0395901_1226043 3300038443 Bacteria 715
220 Ga0395901_1725887 3300038443 Unclassified 577
221 Ga0436365_0018324 3300039437 Bacteria 1399
222 Ga0436365_0884304 3300039437 Bacteria 2288
223 Ga0436360_0627846 3300039438 Bacteria 1032
224 Ga0436360_1231797 3300039438 Bacteria 4065
225 Ga0451853_2982772 3300041512 Unclassified 620
226 Ga0466965_0586182 3300044683 Bacteria 632
227 Ga0466966_0025482 3300044684 Bacteria 3862
228 Ga0466966_0051757 3300044684 Bacteria 2610
229 Ga0466966_0284146 3300044684 Bacteria 995
230 Ga0466961_0510243 3300044693 Bacteria 726
231 Ga0466963_0003443 3300044694 Bacteria 9059
232 Ga0466963_0052912 3300044694 Bacteria 2695
233 Ga0466963_1179951 3300044694 Bacteria 538
234 Ga0466964_0010486 3300044706 Bacteria 3496
235 Ga0466968_0295901 3300044735 Bacteria 777
236 Ga0466957_0020668 3300044842 Bacteria 3875
237 Ga0466957_0170393 3300044842 Bacteria 1418
238 Ga0466957_0292170 3300044842 Bacteria 1093
239 Ga0466957_0311691 3300044842 Bacteria 1060
240 Ga0466957_0433370 3300044842 Bacteria 903
241 Ga0466960_0130887 3300044901 Bacteria 1324
242 Ga0466959_0062910 3300045049 Bacteria 2696
243 Ga0466959_0092815 3300045049 Bacteria 2167
244 Ga0451576_0217707 3300045051 Bacteria 1994
245 Ga0466958_0010423 3300045836 Bacteria 5205
246 Ga0466958_0066267 3300045836 Bacteria 2205
247 Ga0466958_0090649 3300045836 Bacteria 1892
248 Ga0466967_0011546 3300045976 Bacteria 6701
249 Ga0466967_0030207 3300045976 Bacteria 4545
250 Ga0466967_0033530 3300045976 Bacteria 4347
251 Ga0466967_0036917 3300045976 Bacteria 4176
252 Ga0466967_0060200 3300045976 Bacteria 3364
253 Ga0466967_0069607 3300045976 Bacteria 3145
254 Ga0466967_0083523 3300045976 Bacteria 2888
255 Ga0466967_0233311 3300045976 Bacteria 1753
256 Ga0466967_0366326 3300045976 Bacteria 1397
257 Ga0466967_0629635 3300045976 Bacteria 1060
258 Ga0466967_0922984 3300045976 Bacteria 868
259 Ga0466967_1407457 3300045976 Bacteria 694
260 Ga0495592_0182855 3300046454 Bacteria 1426
261 Ga0495592_0348476 3300046454 Bacteria 950
262 Ga0495641_0021519 3300046461 Bacteria 3244
263 Ga0495641_0141469 3300046461 Bacteria 1075
264 Ga0495651_0005371 3300046462 Bacteria 9780
265 Ga0495653_0016432 3300046463 Bacteria 6027
266 Ga0495582_0640532 3300046473 Unclassified 615
267 Ga0495664_0118282 3300046477 Bacteria 1602
268 Ga0495608_0067245 3300046511 Bacteria 2344
269 Ga0495618_0037407 3300046514 Bacteria 3048
270 Ga0495618_0280971 3300046514 Bacteria 1038
271 Ga0495628_0049544 3300046516 Bacteria 3326
272 Ga0495630_0010439 3300046517 Bacteria 6706
273 Ga0495630_0047380 3300046517 Bacteria 3215
274 Ga0495630_0259429 3300046517 Bacteria 1328
275 Ga0495666_0178122 3300046526 Bacteria 982
276 Ga0495652_0006777 3300046529 Bacteria 10621
277 Ga0495652_0086186 3300046529 Bacteria 2579
278 Ga0495640_0004613 3300046533 Bacteria 10991
279 Ga0495640_0147864 3300046533 Bacteria 1511
280 Ga0495587_0197733 3300046536 Bacteria 1137
281 Ga0495667_0007768 3300046559 Bacteria 7266
282 Ga0495667_0010127 3300046559 Bacteria 6382
283 Ga0495634_0013942 3300046642 Bacteria 5809
284 Ga0495588_0279681 3300046674 Unclassified 879
285 Ga0495657_0051861 3300046675 Bacteria 2753
286 Ga0495657_0065245 3300046675 Bacteria 2395
287 Ga0495599_0101545 3300046678 Bacteria 1792
288 Ga0495623_0026525 3300046679 Bacteria 3728
289 Ga0495658_0635624 3300046683 Bacteria 684
290 Ga0495613_0023069 3300046689 Bacteria 4638
291 Ga0495600_0090266 3300046809 Bacteria 1998
292 Ga0495604_0093575 3300047317 Bacteria 2223
293 Ga0495604_0096526 3300047317 Bacteria 2181
294 Ga0495674_0001270 3300047319 Bacteria 24502
295 Ga0495674_0113741 3300047319 Bacteria 2292
296 Ga0495676_0295005 3300047321 Bacteria 1095
297 Ga0495680_0001378 3300047322 Bacteria 26269
298 Ga0495680_0012189 3300047322 Bacteria 7581
299 Ga0495675_0295922 3300047444 Bacteria 962
300 Ga0495684_0025828 3300047471 Bacteria 4514
301 Ga0495602_0069076 3300048088 Bacteria 3031
302 Ga0495602_0241949 3300048088 Bacteria 1349
303 Ga0495602_0559271 3300048088 Bacteria 792
304 Ga0496100_0018271 3300048903 Bacteria 4155
305 Ga0496100_0052004 3300048903 Bacteria 2662
306 Ga0496100_0110147 3300048903 Bacteria 1911
307 Ga0496101_0008490 3300048904 Bacteria 6712
308 Ga0496101_0111442 3300048904 Bacteria 2060
309 Ga0496101_0195238 3300048904 Bacteria 1563
310 Ga0496101_0320768 3300048904 Bacteria 1215
311 Ga0496102_0028156 3300048905 Bacteria 5020
312 Ga0496102_0070449 3300048905 Bacteria 3211
313 Ga0496102_0149066 3300048905 Bacteria 2197
314 Ga0496102_0937036 3300048905 Bacteria 787
315 Ga0496102_1755607 3300048905 Unclassified 538
316 Ga0496103_0096318 3300048906 Bacteria 1870
317 Ga0496104_0102374 3300048907 Bacteria 2743
318 Ga0496104_0179496 3300048907 Bacteria 2027
319 Ga0496105_0048861 3300048908 Bacteria 3492
320 Ga0496105_0083742 3300048908 Bacteria 2634
321 Ga0496106_0004862 3300048909 Bacteria 9944
322 Ga0496106_0081183 3300048909 Bacteria 2491
323 Ga0496107_0037353 3300048910 Bacteria 3485
324 Ga0496107_0222468 3300048910 Bacteria 1404
325 Ga0496108_0000183 3300048911 Bacteria 58046
326 Ga0496108_0320568 3300048911 Bacteria 1351
327 Ga0496109_0008794 3300048912 Bacteria 8598
328 Ga0496109_0042091 3300048912 Bacteria 4137
329 Ga0496109_0476905 3300048912 Bacteria 1178
330 Ga0496110_0000162 3300048913 Bacteria 40324
331 Ga0496110_0240894 3300048913 Bacteria 1646
332 Ga0496111_0000301 3300048914 Bacteria 24161
333 Ga0496111_0063634 3300048914 Bacteria 2675
334 Ga0496111_0264453 3300048914 Bacteria 1276
335 Ga0496111_0460710 3300048914 Unclassified 938
336 Ga0496112_0041268 3300048915 Bacteria 4514
337 Ga0496112_0046610 3300048915 Bacteria 4252
338 Ga0496112_0429383 3300048915 Bacteria 1260
339 Ga0496112_0829245 3300048915 Bacteria 849
340 Ga0496112_1048489 3300048915 Unclassified 734
341 Ga0496113_0000570 3300048916 Bacteria 18358
342 Ga0496114_0028485 3300048917 Bacteria 4584
343 Ga0496114_0061705 3300048917 Bacteria 3136
344 Ga0496114_0072779 3300048917 Bacteria 2891
345 Ga0496114_0222486 3300048917 Bacteria 1657
346 Ga0496114_0532884 3300048917 Bacteria 1038
347 Ga0496115_0007108 3300048918 Bacteria 8219
348 Ga0496115_0134347 3300048918 Bacteria 2040
349 Ga0496115_0272858 3300048918 Bacteria 1389
350 Ga0496115_0509920 3300048918 Unclassified 966
351 Ga0501031_0029946 3300049568 Bacteria 3550
352 Ga0501031_0682350 3300049568 Bacteria 660
353 Ga0501031_0691443 3300049568 Bacteria 655
354 Ga0501032_0229023 3300049569 Bacteria 1208
355 Ga0501033_0065168 3300049570 Bacteria 2680
356 Ga0501034_0025023 3300049571 Bacteria 6074
357 Ga0501034_0112061 3300049571 Bacteria 2719
358 Ga0501036_0431368 3300049572 Bacteria 1098
359 Ga0501037_0042357 3300049573 Bacteria 3346
360 Ga0501038_0176075 3300049574 Bacteria 1729
361 Ga0501039_0038297 3300049575 Bacteria 3703
362 Ga0501040_0004276 3300049576 Bacteria 9287
363 Ga0501041_0008641 3300049577 Bacteria 5999
364 Ga0501042_0023203 3300049578 Bacteria 4339
365 Ga0501042_0594537 3300049578 Bacteria 804
366 Ga0501043_0044464 3300049579 Bacteria 3492
367 Ga0501046_0008341 3300049580 Bacteria 9038
368 Ga0501046_0169312 3300049580 Bacteria 1640
369 Ga0501047_0231666 3300049581 Unclassified 1700
370 Ga0501047_0256019 3300049581 Bacteria 1599
371 Ga0501048_0000542 3300049582 Bacteria 26560
372 Ga0501067_0002427 3300049583 Bacteria 10298
373 Ga0501067_0027656 3300049583 Bacteria 3143
374 Ga0501067_0032432 3300049583 Bacteria 2900
375 Ga0501067_0071281 3300049583 Bacteria 1924
376 Ga0501068_0002699 3300049584 Bacteria 9406
377 Ga0501069_0008714 3300049585 Bacteria 5342
378 Ga0501069_0009194 3300049585 Bacteria 5215
379 Ga0501069_0044997 3300049585 Bacteria 2444
380 Ga0501069_0107994 3300049585 Bacteria 1583
381 Ga0501069_0501761 3300049585 Bacteria 724
382 Ga0501070_0012890 3300049586 Bacteria 7044
383 Ga0501070_0034179 3300049586 Bacteria 4252
384 Ga0501070_0049064 3300049586 Bacteria 3506
385 Ga0501070_0051679 3300049586 Bacteria 3411
386 Ga0501070_0193384 3300049586 Bacteria 1672
387 Ga0501070_0226553 3300049586 Bacteria 1532
388 Ga0501071_0010442 3300049587 Bacteria 6223
389 Ga0501072_0005843 3300049588 Bacteria 9375
390 Ga0501073_0036087 3300049589 Bacteria 3513
391 Ga0501073_0164036 3300049589 Bacteria 1539
392 Ga0501073_0291493 3300049589 Bacteria 1126
393 Ga0501074_0009351 3300049590 Bacteria 7119
394 Ga0501074_0113832 3300049590 Bacteria 1935
395 Ga0501074_0396141 3300049590 Bacteria 979
396 Ga0501075_0001084 3300049591 Bacteria 17508
397 Ga0501076_0040838 3300049592 Bacteria 3646
398 Ga0501076_0554760 3300049592 Bacteria 947
399 Ga0501077_0015196 3300049593 Bacteria 4842
400 Ga0501077_0015923 3300049593 Bacteria 4737
401 Ga0501079_0002076 3300049741 Bacteria 14363
402 Ga0501079_0097654 3300049741 Bacteria 2277
403 Ga0501080_0140236 3300049742 Bacteria 2235
404 Ga0501080_0408831 3300049742 Bacteria 1220
405 Ga0501080_0435956 3300049742 Bacteria 1176
406 Ga0501081_0001572 3300049743 Bacteria 14056
407 Ga0501081_0034560 3300049743 Bacteria 3440
408 Ga0501081_0164016 3300049743 Bacteria 1602
409 Ga0501083_0046740 3300049744 Bacteria 2926
410 Ga0501035_0029897 3300049822 Bacteria 4968
411 Ga0501035_0210229 3300049822 Bacteria 1665
412 Ga0501044_0407562 3300049823 Bacteria 1271
413 Ga0501044_0928175 3300049823 Bacteria 744
414 Ga0501045_0014885 3300049824 Bacteria 5517
415 Ga0501045_0288859 3300049824 Bacteria 1220
416 nmdc:mga06r32_1111199_c1 3300050510 Bacteria 739
417 nmdc:mga08x19_84784_c1 3300050514 Bacteria 2084
418 Ga0495601_0388936 3300053077 Bacteria 905
419 Ga0495619_0017696 3300053085 Bacteria 4515
420 Ga0495619_0020269 3300053085 Bacteria 4233
421 Ga0501084_0046674 3300054114 Bacteria 3628
422 Ga0501084_0110146 3300054114 Bacteria 2314
423 Ga0501082_0022040 3300060353 Bacteria 5492
424 Ga0466962_0021437 3300061719 Bacteria 3102
425 Ga0466962_0122847 3300061719 Bacteria 1253
426 Ga0530510_0014672 3300061734 Bacteria 5531
427 Ga0530510_0302845 3300061734 Bacteria 1196
428 Ga0530510_0386477 3300061734 Bacteria 1054
429 Ga0530510_0903942 3300061734 Bacteria 675
430 Ga0466967_0092632
431 Ga0070683_100009312
432 Ga0070683_100246647
433 Ga0070683_100395530
434 Ga0070670_100006736
435 Ga0070680_100213263
436 Ga0070682_100859432
437 Ga0070660_100004599
438 Ga0070687_100310495
439 Ga0070661_100024564
440 Ga0070661_100340641
441 Ga0070671_100211962
442 Ga0070673_100026965
443 Ga0070673_100571067
444 Ga0070659_100127420
445 Ga0070714_100030070
446 Ga0070714_100248547
447 Ga0070714_100602927
448 Ga0070714_101083395
449 Ga0070713_100515990
450 Ga0070713_100531699
451 Ga0070708_100056904
452 Ga0070678_100528409
453 Ga0070681_10012047
454 Ga0070681_10077881
455 Ga0070681_10223110
456 Ga0070681_10232124
457 Ga0070707_100634601
458 Ga0070707_100676081
459 Ga0070698_100295406
460 Ga0070699_100748009
461 Ga0070679_100034522
462 Ga0070679_100080740
463 Ga0070679_100189447
464 Ga0070679_100220035
465 Ga0070679_100478237
466 Ga0070679_100514767
467 Ga0070684_100088602
468 Ga0070684_100089088
469 Ga0070684_100107666
470 Ga0070684_100359212
471 Ga0070695_100809728
472 Ga0070696_100247765
473 Ga0070693_100037639
474 Ga0070693_100376301
475 Ga0070665_100436893
476 Ga0068855_100027560
477 Ga0068855_100035309
478 Ga0068855_100105948
479 Ga0068855_100107510
480 Ga0068855_100196779
481 Ga0068855_100326137
482 Ga0068855_100359039
483 Ga0070664_100133456
484 Ga0068857_100064407
485 Ga0068856_101731201
486 Ga0068852_100027044
487 Ga0068852_100218263
488 Ga0068870_10018043
489 Ga0068858_100147105
490 Ga0070717_10205406
491 Ga0070717_10945329
492 Ga0070712_100508575
493 Ga0068871_100463122
494 Ga0075428_100682162
495 Ga0068865_101661971
496 Ga0105240_10118331
497 Ga0114129_10849125
498 Ga0105242_10879269
499 Ga0105248_11789464
500 Ga0105237_10047070
501 Ga0105238_10057323
502 Ga0105239_10219741
503 Ga0105246_10108331
504 Ga0157370_10066547
505 Ga0157369_10003375
506 Ga0157369_10011628
507 Ga0157369_10045131
508 Ga0157374_10586609
509 Ga0157374_11368468
510 Ga0157374_11438741
511 Ga0157372_10376845
512 Ga0157372_10548387
513 Ga0157375_10045711
514 Ga0157375_10687547
515 Ga0163163_11567308
516 Ga0163163_11982973
517 Ga0182008_10027470
518 Ga0157377_10728061
519 Ga0157376_11602858
520 Ga0197907_10098605
521 Ga0197907_11244332
522 Ga0206356_10291319
523 Ga0206356_10937194
524 Ga0206356_11477761
525 Ga0206350_11216675
526 Ga0206354_10038417
527 Ga0206353_10221391
528 Ga0206353_10225393
529 Ga0206353_10545868
530 Ga0206353_10679077
531 Ga0206353_10983504
532 Ga0213876_10064038
533 Ga0213871_10035256
534 Ga0224712_10019852
535 Ga0224712_10126068
536 Ga0224712_10143670
537 Ga0224712_10205922
538 Ga0207685_10165916
539 Ga0207699_10997822
540 Ga0207643_10022597
541 Ga0207684_10720867
542 Ga0207707_10203154
543 Ga0207707_10224211
544 Ga0207707_10365607
545 Ga0207695_10042425
546 Ga0207671_10442480
547 Ga0207693_10314668
548 Ga0207693_10346566
549 Ga0207660_10419123
550 Ga0207657_10001143
551 Ga0207657_10074584
552 Ga0207649_10057748
553 Ga0207652_10070289
554 Ga0207652_10090059
555 Ga0207646_10186745
556 Ga0207646_10465359
557 Ga0207694_10257042
558 Ga0207650_10004269
559 Ga0207650_10008929
560 Ga0207687_10244762
561 Ga0207687_10461527
562 Ga0207700_10334879
563 Ga0207700_10766090
564 Ga0207664_10313353
565 Ga0207664_11000407
566 Ga0207664_11003905
567 Ga0207644_10131393
568 Ga0207709_10740113
569 Ga0207711_11234865
570 Ga0207689_10139509
571 Ga0207661_10409243
572 Ga0207667_10100203
573 Ga0207667_10188723
574 Ga0207667_10380130
575 Ga0207667_10593358
576 Ga0207667_10722035
577 Ga0207651_10351854
578 Ga0207658_10005052
579 Ga0207677_10351081
580 Ga0207677_10760507
581 Ga0207703_10077129
582 Ga0207639_10555255
583 Ga0207678_10095908
584 Ga0207678_10106833
585 Ga0207702_10530900
586 Ga0207702_10579967
587 Ga0207702_11295379
588 Ga0207674_10018225
589 Ga0207683_10157582
590 Ga0207698_10014381
591 Ga0207698_10174011
592 Ga0207698_11004387
593 Ga0207698_11295252
594 Ga0268266_10511551
595 Ga0265334_10026627
596 Ga0265338_10044289
597 Ga0265330_10065229
598 Ga0265332_10042028
599 Ga0265328_10038618
600 Ga0265325_10016928
601 Ga0265340_10164772
602 Ga0265339_10046503
603 Ga0265331_10122643
604 Ga0265327_10052457
605 Ga0265316_10161118
606 Ga0265316_10319750
607 Ga0265313_10008617
608 Ga0265314_10013433
609 Ga0265342_10055912
610 Ga0373923_0066012
611 Ga0373937_0559178
612 Ga0395899_0216183
613 Ga0395900_0022982
614 Ga0395900_0031662
615 Ga0395900_0085760
616 Ga0395900_0089754
617 Ga0395900_0098639
618 Ga0395900_0256549
619 Ga0395900_0552085
620 Ga0395900_1230872
621 Ga0395898_0002446
622 Ga0395898_0006849
623 Ga0395898_0034848
624 Ga0395898_0099467
625 Ga0395898_0178249
626 Ga0395898_0420140
627 Ga0395898_0553978
628 Ga0395898_0836052
629 Ga0395898_0903396
630 Ga0395898_1114365
631 Ga0395905_0037119
632 Ga0395905_0136618
633 Ga0395905_0144924
634 Ga0395905_0188788
635 Ga0395905_0830963
636 Ga0436364_1268764
637 Ga0395901_0003113
638 Ga0395901_0012761
639 Ga0395901_0015184
640 Ga0395901_0020152
641 Ga0395901_0023022
642 Ga0395901_0039146
643 Ga0395901_0048020
644 Ga0395901_0108696
645 Ga0395901_0171944
646 Ga0395901_0482116
647 Ga0395901_0709198
648 Ga0395901_1226043
649 Ga0395901_1725887
650 Ga0436365_0018324
651 Ga0436365_0884304
652 Ga0436360_0627846
653 Ga0436360_1231797
654 Ga0451853_2982772
655 Ga0466965_0586182
656 Ga0466966_0025482
657 Ga0466966_0051757
658 Ga0466966_0284146
659 Ga0466961_0510243
660 Ga0466963_0003443
661 Ga0466963_0052912
662 Ga0466963_1179951
663 Ga0466964_0010486
664 Ga0466968_0295901
665 Ga0466957_0020668
666 Ga0466957_0170393
667 Ga0466957_0292170
668 Ga0466957_0311691
669 Ga0466957_0433370
670 Ga0466960_0130887
671 Ga0466959_0062910
672 Ga0466959_0092815
673 Ga0451576_0217707
674 Ga0466958_0010423
675 Ga0466958_0066267
676 Ga0466958_0090649
677 Ga0466967_0011546
678 Ga0466967_0030207
679 Ga0466967_0033530
680 Ga0466967_0036917
681 Ga0466967_0060200
682 Ga0466967_0069607
683 Ga0466967_0083523
684 Ga0466967_0233311
685 Ga0466967_0366326
686 Ga0466967_0629635
687 Ga0466967_0922984
688 Ga0466967_1407457
689 Ga0495592_0182855
690 Ga0495592_0348476
691 Ga0495641_0021519
692 Ga0495641_0141469
693 Ga0495651_0005371
694 Ga0495653_0016432
695 Ga0495582_0640532
696 Ga0495664_0118282
697 Ga0495608_0067245
698 Ga0495618_0037407
699 Ga0495618_0280971
700 Ga0495628_0049544
701 Ga0495630_0010439
702 Ga0495630_0047380
703 Ga0495630_0259429
704 Ga0495666_0178122
705 Ga0495652_0006777
706 Ga0495652_0086186
707 Ga0495640_0004613
708 Ga0495640_0147864
709 Ga0495587_0197733
710 Ga0495667_0007768
711 Ga0495667_0010127
712 Ga0495634_0013942
713 Ga0495588_0279681
714 Ga0495657_0051861
715 Ga0495657_0065245
716 Ga0495599_0101545
717 Ga0495623_0026525
718 Ga0495658_0635624
719 Ga0495613_0023069
720 Ga0495600_0090266
721 Ga0495604_0093575
722 Ga0495604_0096526
723 Ga0495674_0001270
724 Ga0495674_0113741
725 Ga0495676_0295005
726 Ga0495680_0001378
727 Ga0495680_0012189
728 Ga0495675_0295922
729 Ga0495684_0025828
730 Ga0495602_0069076
731 Ga0495602_0241949
732 Ga0495602_0559271
733 Ga0496100_0018271
734 Ga0496100_0052004
735 Ga0496100_0110147
736 Ga0496101_0008490
737 Ga0496101_0111442
738 Ga0496101_0195238
739 Ga0496101_0320768
740 Ga0496102_0028156
741 Ga0496102_0070449
742 Ga0496102_0149066
743 Ga0496102_0937036
744 Ga0496102_1755607
745 Ga0496103_0096318
746 Ga0496104_0102374
747 Ga0496104_0179496
748 Ga0496105_0048861
749 Ga0496105_0083742
750 Ga0496106_0004862
751 Ga0496106_0081183
752 Ga0496107_0037353
753 Ga0496107_0222468
754 Ga0496108_0000183
755 Ga0496108_0320568
756 Ga0496109_0008794
757 Ga0496109_0042091
758 Ga0496109_0476905
759 Ga0496110_0000162
760 Ga0496110_0240894
761 Ga0496111_0000301
762 Ga0496111_0063634
763 Ga0496111_0264453
764 Ga0496111_0460710
765 Ga0496112_0041268
766 Ga0496112_0046610
767 Ga0496112_0429383
768 Ga0496112_0829245
769 Ga0496112_1048489
770 Ga0496113_0000570
771 Ga0496114_0028485
772 Ga0496114_0061705
773 Ga0496114_0072779
774 Ga0496114_0222486
775 Ga0496114_0532884
776 Ga0496115_0007108
777 Ga0496115_0134347
778 Ga0496115_0272858
779 Ga0496115_0509920
780 Ga0501031_0029946
781 Ga0501031_0682350
782 Ga0501031_0691443
783 Ga0501032_0229023
784 Ga0501033_0065168
785 Ga0501034_0025023
786 Ga0501034_0112061
787 Ga0501036_0431368
788 Ga0501037_0042357
789 Ga0501038_0176075
790 Ga0501039_0038297
791 Ga0501040_0004276
792 Ga0501041_0008641
793 Ga0501042_0023203
794 Ga0501042_0594537
795 Ga0501043_0044464
796 Ga0501046_0008341
797 Ga0501046_0169312
798 Ga0501047_0231666
799 Ga0501047_0256019
800 Ga0501048_0000542
801 Ga0501067_0002427
802 Ga0501067_0027656
803 Ga0501067_0032432
804 Ga0501067_0071281
805 Ga0501068_0002699
806 Ga0501069_0008714
807 Ga0501069_0009194
808 Ga0501069_0044997
809 Ga0501069_0107994
810 Ga0501069_0501761
811 Ga0501070_0012890
812 Ga0501070_0034179
813 Ga0501070_0049064
814 Ga0501070_0051679
815 Ga0501070_0193384
816 Ga0501070_0226553
817 Ga0501071_0010442
818 Ga0501072_0005843
819 Ga0501073_0036087
820 Ga0501073_0164036
821 Ga0501073_0291493
822 Ga0501074_0009351
823 Ga0501074_0113832
824 Ga0501074_0396141
825 Ga0501075_0001084
826 Ga0501076_0040838
827 Ga0501076_0554760
828 Ga0501077_0015196
829 Ga0501077_0015923
830 Ga0501079_0002076
831 Ga0501079_0097654
832 Ga0501080_0140236
833 Ga0501080_0408831
834 Ga0501080_0435956
835 Ga0501081_0001572
836 Ga0501081_0034560
837 Ga0501081_0164016
838 Ga0501083_0046740
839 Ga0501035_0029897
840 Ga0501035_0210229
841 Ga0501044_0407562
842 Ga0501044_0928175
843 Ga0501045_0014885
844 Ga0501045_0288859
845 nmdc:mga06r32_1111199_c1
846 nmdc:mga08x19_84784_c1
847 Ga0495601_0388936
848 Ga0495619_0017696
849 Ga0495619_0020269
850 Ga0501084_0046674
851 Ga0501084_0110146
852 Ga0501082_0022040
853 Ga0466962_0021437
854 Ga0466962_0122847
855 Ga0530510_0014672
856 Ga0530510_0302845
857 Ga0530510_0386477
858 Ga0530510_0903942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv6-assembly1.cif.gz_A crystal structure of the artificial alpharep-7 octarellinv.1 complex 0.8824 28 158
4jw2-assembly1.cif.gz_A selection of specific protein binders for pre-defined targets from an optimized library of artificial helicoidal repeat proteins (alpharep) 0.8779 59 123
3w3u-assembly1.cif.gz_A crystal structure of kap121p mutant r349a/q350a/d353a/e396a/n430k/d438a/n477a 0.8593 25 158
4jw3-assembly2.cif.gz_D selection of specific protein binders for pre-defined targets from an optimized library of artificial helicoidal repeat proteins (alpharep) 0.851 31 125
8aw4-assembly1.cif.gz_B structure of a complex of biosynthetic proteins bb-e3 and bgfpd-yy 0.8433 28 143
ID Description Score Start End Superfamily
4jw2A00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8779 59 123 1.25.10.10
af_Q08951_18_624_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.874 24 159 1.25.10.10
3w3uA01 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8593 25 158 1.25.10.10
af_Q2FYK3_220_373_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8542 28 161 1.25.10.10
4jw3D00 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.851 31 125 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A538GMT7-F1-model_v4 Uncharacterized protein 0.9948 1 163
AF-A0A538H747-F1-model_v4 HEAT repeat domain-containing protein 0.9906 1 164
AF-A0A538FVX6-F1-model_v4 HEAT repeat domain-containing protein 0.9875 1 162
AF-A0A538H747-F1-model_v4 HEAT repeat domain-containing protein 0.9846 1 164
AF-A0A538GMT7-F1-model_v4 Uncharacterized protein 0.9828 1 163

Map