F441772

General Info

Members Datasets Scaffolds Average Seq Length
428 210 428 183

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0643508|Ga0501047_0643508_211_822
Length 203
Sequence MGGADGARLSAPDIPDRKIMNAELSPPAGKLDLGREFIPVRVAVLTVSDTRDEESDTSGRVLADRVARDGHVLAKRDWVKDDVVQLRERVQSWCAASDIDVVISTGGTGLTGRDVTPEALRPVFEKEIEGFQTVWHTVSYGSVGLSTLQSRACAGLLRGTFVFCLPGSNGACKDGWDKIIRWQLDNRYRPCNLVELMPRLMER

Samples

Sample ID Description Type Environment
1 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
75 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
136 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
137 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
200 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
204 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
208 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.67
Nodule 0
Rhizoplane 0
Rhizosphere 93.93
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000013 3300003214 Bacteria 402100
2 JGI25153J46596_10000293 3300003215 Bacteria 37385
3 Ga0055542_1000046 3300003762 Bacteria 201922
4 Ga0055529_1000007 3300003763 Bacteria 403604
5 Ga0070658_10104826 3300005327 Bacteria 2339
6 Ga0070658_10773033 3300005327 Bacteria 834
7 Ga0070683_100076133 3300005329 Bacteria 3136
8 Ga0070683_100116591 3300005329 Bacteria 2522
9 Ga0070670_100839370 3300005331 Bacteria 831
10 Ga0070670_101241259 3300005331 Bacteria 682
11 Ga0068869_100174300 3300005334 Bacteria 1682
12 Ga0068869_100468525 3300005334 Bacteria 1047
13 Ga0070666_10003719 3300005335 Bacteria 9242
14 Ga0070666_10173412 3300005335 Bacteria 1511
15 Ga0070666_10220401 3300005335 Bacteria 1338
16 Ga0070680_100040150 3300005336 Bacteria 3788
17 Ga0070682_100372021 3300005337 Bacteria 1072
18 Ga0068868_100146527 3300005338 Bacteria 1942
19 Ga0068868_100390424 3300005338 Bacteria 1199
20 Ga0070660_100022435 3300005339 Bacteria 4668
21 Ga0070660_100029869 3300005339 Bacteria 4086
22 Ga0070660_100402675 3300005339 Bacteria 1132
23 Ga0070661_100000009 3300005344 Bacteria 181351
24 Ga0070661_100408389 3300005344 Bacteria 1075
25 Ga0070661_101016538 3300005344 Bacteria 688
26 Ga0070675_100887490 3300005354 Bacteria 817
27 Ga0070671_100352582 3300005355 Bacteria 1256
28 Ga0070674_101103524 3300005356 Bacteria 701
29 Ga0070688_100162049 3300005365 Bacteria 1537
30 Ga0070688_100545167 3300005365 Bacteria 881
31 Ga0070659_100083704 3300005366 Bacteria 2550
32 Ga0070659_100499409 3300005366 Bacteria 1037
33 Ga0070667_100013558 3300005367 Bacteria 6734
34 Ga0070667_100086160 3300005367 Bacteria 2695
35 Ga0070714_100224337 3300005435 Bacteria 1728
36 Ga0070713_100175084 3300005436 Bacteria 1925
37 Ga0070713_100726401 3300005436 Bacteria 949
38 Ga0070705_100945019 3300005440 Bacteria 696
39 Ga0070700_100496000 3300005441 Bacteria 938
40 Ga0070678_100013834 3300005456 Bacteria 5072
41 Ga0070681_10124626 3300005458 Bacteria 2509
42 Ga0070681_10130024 3300005458 Bacteria 2450
43 Ga0070681_10154433 3300005458 Bacteria 2221
44 Ga0070681_10574848 3300005458 Bacteria 1041
45 Ga0068867_100001750 3300005459 Bacteria 15119
46 Ga0070679_100015301 3300005530 Bacteria 7371
47 Ga0070679_100097620 3300005530 Bacteria 2926
48 Ga0070684_100300677 3300005535 Bacteria 1472
49 Ga0070684_100575597 3300005535 Bacteria 1046
50 Ga0070684_100687117 3300005535 Bacteria 954
51 Ga0068853_100241138 3300005539 Bacteria 1657
52 Ga0068853_100671787 3300005539 Bacteria 987
53 Ga0070672_100590065 3300005543 Bacteria 967
54 Ga0070686_100244079 3300005544 Bacteria 1309
55 Ga0070695_101171139 3300005545 Bacteria 631
56 Ga0070693_100167143 3300005547 Bacteria 1406
57 Ga0070693_100367171 3300005547 Unclassified 989
58 Ga0070665_100000328 3300005548 Bacteria 73231
59 Ga0070665_100014095 3300005548 Bacteria 8036
60 Ga0070665_100027734 3300005548 Bacteria 5701
61 Ga0070665_100044535 3300005548 Bacteria 4456
62 Ga0070665_100095824 3300005548 Bacteria 2972
63 Ga0070665_100130366 3300005548 Bacteria 2516
64 Ga0070665_100192015 3300005548 Bacteria 2043
65 Ga0070704_100608521 3300005549 Bacteria 961
66 Ga0068855_100051412 3300005563 Bacteria 4854
67 Ga0068855_100071141 3300005563 Bacteria 4046
68 Ga0068855_100762641 3300005563 Bacteria 1031
69 Ga0068855_100818891 3300005563 Bacteria 988
70 Ga0068855_100875036 3300005563 Bacteria 950
71 Ga0068857_100621682 3300005577 Bacteria 1022
72 Ga0068856_100025196 3300005614 Bacteria 5796
73 Ga0068856_100075833 3300005614 Bacteria 3331
74 Ga0068852_100322914 3300005616 Bacteria 1500
75 Ga0068859_100726574 3300005617 Bacteria 1083
76 Ga0068859_101648645 3300005617 Bacteria 708
77 Ga0068864_100199175 3300005618 Bacteria 1839
78 Ga0068861_101574251 3300005719 Bacteria 647
79 Ga0068863_100294740 3300005841 Bacteria 1573
80 Ga0068858_100119044 3300005842 Bacteria 2469
81 Ga0068860_100148694 3300005843 Bacteria 2255
82 Ga0068860_100160498 3300005843 Bacteria 2167
83 Ga0068860_100571172 3300005843 Bacteria 1134
84 Ga0068862_100625311 3300005844 Bacteria 1036
85 Ga0068862_100988158 3300005844 Bacteria 832
86 Ga0097621_100000046 3300006237 Bacteria 64086
87 Ga0097621_100035769 3300006237 Bacteria 3970
88 Ga0097621_100063425 3300006237 Bacteria 3037
89 Ga0097621_100100251 3300006237 Bacteria 2436
90 Ga0097621_100315279 3300006237 Bacteria 1384
91 Ga0097621_100434689 3300006237 Bacteria 1180
92 Ga0068871_100000004 3300006358 Bacteria 123358
93 Ga0068871_100055578 3300006358 Bacteria 3214
94 Ga0068871_100107860 3300006358 Bacteria 2340
95 Ga0068871_100200825 3300006358 Bacteria 1721
96 Ga0068871_100390930 3300006358 Bacteria 1237
97 Ga0068871_100514803 3300006358 Bacteria 1080
98 Ga0075428_100220739 3300006844 Bacteria 2047
99 Ga0068865_100144897 3300006881 Bacteria 1795
100 Ga0097620_100726453 3300006931 Bacteria 1083
101 Ga0097620_101648078 3300006931 Bacteria 708
102 Ga0105240_10149248 3300009093 Bacteria 2786
103 Ga0105240_10150964 3300009093 Bacteria 2767
104 Ga0105240_10346765 3300009093 Bacteria 1685
105 Ga0105240_10392435 3300009093 Bacteria 1565
106 Ga0105240_10516053 3300009093 Bacteria 1327
107 Ga0105240_10607300 3300009093 Bacteria 1204
108 Ga0105240_10947229 3300009093 Bacteria 924
109 Ga0105245_10000203 3300009098 Bacteria 56667
110 Ga0105245_10290779 3300009098 Bacteria 1600
111 Ga0105245_10505675 3300009098 Bacteria 1225
112 Ga0105245_10936825 3300009098 Unclassified 909
113 Ga0105241_10212141 3300009174 Bacteria 1623
114 Ga0105241_10679041 3300009174 Bacteria 938
115 Ga0105241_10816422 3300009174 Bacteria 860
116 Ga0105242_10170116 3300009176 Bacteria 1914
117 Ga0105242_10210308 3300009176 Bacteria 1733
118 Ga0105242_10883859 3300009176 Bacteria 892
119 Ga0105248_10015941 3300009177 Bacteria 8277
120 Ga0105248_10549423 3300009177 Bacteria 1303
121 Ga0105237_10054465 3300009545 Bacteria 4008
122 Ga0105237_10098430 3300009545 Bacteria 2916
123 Ga0105237_10259852 3300009545 Bacteria 1739
124 Ga0105237_10921733 3300009545 Bacteria 881
125 Ga0105237_11028899 3300009545 Bacteria 830
126 Ga0105238_10034382 3300009551 Bacteria 5157
127 Ga0105238_10035871 3300009551 Bacteria 5041
128 Ga0105238_10096473 3300009551 Bacteria 2943
129 Ga0105238_10167382 3300009551 Bacteria 2174
130 Ga0105238_10551172 3300009551 Bacteria 1157
131 Ga0105238_11734675 3300009551 Bacteria 656
132 Ga0105249_10053552 3300009553 Bacteria 3688
133 Ga0105239_10031290 3300010375 Bacteria 5852
134 Ga0105239_10102347 3300010375 Bacteria 3170
135 Ga0105239_10208061 3300010375 Bacteria 2192
136 Ga0105239_10732096 3300010375 Bacteria 1132
137 Ga0105239_10917458 3300010375 Bacteria 1005
138 Ga0105239_11107419 3300010375 Bacteria 912
139 Ga0105246_10037750 3300011119 Bacteria 3243
140 Ga0157373_10840605 3300013100 Bacteria 679
141 Ga0157370_10044085 3300013104 Bacteria 4290
142 Ga0157370_10459845 3300013104 Bacteria 1170
143 Ga0157369_11650399 3300013105 Bacteria 652
144 Ga0157374_10177442 3300013296 Bacteria 2079
145 Ga0157378_10012780 3300013297 Bacteria 7349
146 Ga0157378_10066447 3300013297 Bacteria 3230
147 Ga0157378_10090146 3300013297 Bacteria 2786
148 Ga0157378_10224898 3300013297 Bacteria 1785
149 Ga0163162_10003970 3300013306 Bacteria 14184
150 Ga0163162_10481034 3300013306 Bacteria 1373
151 Ga0163162_11040825 3300013306 Bacteria 926
152 Ga0157372_10024209 3300013307 Bacteria 6591
153 Ga0157372_11235764 3300013307 Bacteria 863
154 Ga0157375_10011357 3300013308 Bacteria 7862
155 Ga0157375_10229850 3300013308 Bacteria 2014
156 Ga0163163_10000006 3300014325 Bacteria 320401
157 Ga0163163_10014059 3300014325 Bacteria 7348
158 Ga0157379_10000605 3300014968 Bacteria 28967
159 Ga0157379_10518075 3300014968 Bacteria 1107
160 Ga0157376_10145202 3300014969 Unclassified 2133
161 Ga0157376_10343402 3300014969 Bacteria 1426
162 Ga0157376_10425855 3300014969 Bacteria 1289
163 Ga0182005_1070232 3300015265 Unclassified 961
164 Ga0209148_1000026 3300025254 Bacteria 629213
165 Ga0209233_1000013 3300025261 Bacteria 1013785
166 Ga0209233_1007476 3300025261 Bacteria 3458
167 Ga0209455_1000005 3300025272 Bacteria 1416756
168 Ga0209758_1000013 3300025297 Bacteria 873003
169 Ga0207680_10042591 3300025903 Bacteria 2657
170 Ga0207645_10027200 3300025907 Bacteria 3695
171 Ga0207643_10092806 3300025908 Bacteria 1762
172 Ga0207705_10642245 3300025909 Bacteria 825
173 Ga0207654_10009595 3300025911 Bacteria 4920
174 Ga0207654_10135877 3300025911 Bacteria 1562
175 Ga0207707_10115820 3300025912 Bacteria 2342
176 Ga0207707_10154383 3300025912 Bacteria 2007
177 Ga0207707_10208772 3300025912 Bacteria 1702
178 Ga0207707_10584124 3300025912 Bacteria 947
179 Ga0207707_11156746 3300025912 Bacteria 628
180 Ga0207695_10024152 3300025913 Bacteria 6847
181 Ga0207695_10068651 3300025913 Bacteria 3631
182 Ga0207695_10108011 3300025913 Bacteria 2767
183 Ga0207695_10157075 3300025913 Bacteria 2208
184 Ga0207695_10246639 3300025913 Bacteria 1686
185 Ga0207695_10278056 3300025913 Bacteria 1568
186 Ga0207695_10797478 3300025913 Bacteria 824
187 Ga0207695_10871491 3300025913 Bacteria 780
188 Ga0207671_10111432 3300025914 Bacteria 2082
189 Ga0207671_10302441 3300025914 Bacteria 1264
190 Ga0207660_10068902 3300025917 Bacteria 2567
191 Ga0207660_10544744 3300025917 Bacteria 943
192 Ga0207657_10008929 3300025919 Bacteria 10128
193 Ga0207657_10019317 3300025919 Bacteria 6475
194 Ga0207649_10000035 3300025920 Bacteria 134650
195 Ga0207649_10065522 3300025920 Bacteria 2300
196 Ga0207652_10012053 3300025921 Bacteria 6978
197 Ga0207652_10024220 3300025921 Bacteria 5035
198 Ga0207694_10212792 3300025924 Bacteria 1575
199 Ga0207694_10300903 3300025924 Bacteria 1321
200 Ga0207694_10464523 3300025924 Bacteria 1058
201 Ga0207694_10780812 3300025924 Bacteria 807
202 Ga0207650_10619428 3300025925 Bacteria 911
203 Ga0207687_10519913 3300025927 Bacteria 995
204 Ga0207687_10699270 3300025927 Bacteria 860
205 Ga0207700_10642641 3300025928 Bacteria 946
206 Ga0207664_10475352 3300025929 Unclassified 1117
207 Ga0207644_10618321 3300025931 Bacteria 900
208 Ga0207690_10193300 3300025932 Bacteria 1540
209 Ga0207706_10215006 3300025933 Bacteria 1684
210 Ga0207686_10057250 3300025934 Bacteria 2453
211 Ga0207686_10135484 3300025934 Bacteria 1695
212 Ga0207686_10171414 3300025934 Bacteria 1531
213 Ga0207686_10232093 3300025934 Bacteria 1338
214 Ga0207709_10203795 3300025935 Bacteria 1415
215 Ga0207669_11013744 3300025937 Bacteria 698
216 Ga0207704_10163412 3300025938 Bacteria 1587
217 Ga0207691_10239737 3300025940 Bacteria 1568
218 Ga0207711_10014304 3300025941 Bacteria 6590
219 Ga0207689_10097246 3300025942 Bacteria 2418
220 Ga0207689_10528464 3300025942 Bacteria 990
221 Ga0207689_10573035 3300025942 Bacteria 949
222 Ga0207661_10306757 3300025944 Bacteria 1424
223 Ga0207667_10066953 3300025949 Bacteria 3742
224 Ga0207667_10669967 3300025949 Bacteria 1042
225 Ga0207651_10175355 3300025960 Bacteria 1695
226 Ga0207712_10088236 3300025961 Bacteria 2277
227 Ga0207712_10283291 3300025961 Bacteria 1353
228 Ga0207712_11255860 3300025961 Bacteria 661
229 Ga0207640_10568384 3300025981 Bacteria 955
230 Ga0207640_11476620 3300025981 Bacteria 610
231 Ga0207658_10024071 3300025986 Bacteria 4255
232 Ga0207658_10066504 3300025986 Bacteria 2711
233 Ga0207677_10293830 3300026023 Bacteria 1340
234 Ga0207703_10046062 3300026035 Bacteria 3511
235 Ga0207703_10125427 3300026035 Bacteria 2210
236 Ga0207703_10470602 3300026035 Bacteria 1176
237 Ga0207639_10262667 3300026041 Bacteria 1511
238 Ga0207639_10400712 3300026041 Bacteria 1236
239 Ga0207639_11005079 3300026041 Bacteria 781
240 Ga0207641_10063110 3300026088 Bacteria 3164
241 Ga0207648_10019524 3300026089 Bacteria 6117
242 Ga0207648_10022437 3300026089 Bacteria 5666
243 Ga0207648_10561464 3300026089 Bacteria 1049
244 Ga0207676_10440062 3300026095 Bacteria 1227
245 Ga0207674_10342123 3300026116 Bacteria 1446
246 Ga0207674_10443039 3300026116 Bacteria 1255
247 Ga0207675_100112676 3300026118 Bacteria 2568
248 Ga0207683_10008775 3300026121 Bacteria 8632
249 Ga0207683_10074021 3300026121 Bacteria 3013
250 Ga0207683_10666275 3300026121 Bacteria 964
251 Ga0207683_11446001 3300026121 Bacteria 635
252 Ga0207698_11006727 3300026142 Bacteria 844
253 Ga0268266_10000975 3300028379 Bacteria 36323
254 Ga0268266_10010732 3300028379 Bacteria 7983
255 Ga0268266_10014103 3300028379 Bacteria 6880
256 Ga0268266_10026894 3300028379 Bacteria 4895
257 Ga0268266_10051777 3300028379 Bacteria 3525
258 Ga0268266_10145813 3300028379 Bacteria 2128
259 Ga0268265_10300745 3300028380 Bacteria 1445
260 Ga0268265_10650153 3300028380 Bacteria 1013
261 Ga0268264_10054695 3300028381 Bacteria 3333
262 Ga0268264_10102962 3300028381 Bacteria 2485
263 Ga0268264_10230999 3300028381 Bacteria 1708
264 Ga0265334_10001662 3300028573 Bacteria 10644
265 Ga0265318_10000568 3300028577 Bacteria 26046
266 Ga0265338_10005898 3300028800 Bacteria 15796
267 Ga0265338_10019557 3300028800 Bacteria 7176
268 Ga0265330_10019335 3300031235 Bacteria 3123
269 Ga0265332_10010681 3300031238 Bacteria 4085
270 Ga0265332_10054006 3300031238 Bacteria 1724
271 Ga0265328_10126075 3300031239 Bacteria 957
272 Ga0265320_10045471 3300031240 Bacteria 2157
273 Ga0265331_10018706 3300031250 Bacteria 3586
274 Ga0265331_10105893 3300031250 Bacteria 1292
275 Ga0265316_10126199 3300031344 Bacteria 1929
276 Ga0265316_10196472 3300031344 Bacteria 1497
277 Ga0265313_10002805 3300031595 Bacteria 14705
278 Ga0265313_10103789 3300031595 Bacteria 1258
279 Ga0265314_10005911 3300031711 Bacteria 10941
280 Ga0265314_10027015 3300031711 Bacteria 4304
281 Ga0265314_10106455 3300031711 Bacteria 1791
282 Ga0265314_10147613 3300031711 Bacteria 1446
283 Ga0265314_10349732 3300031711 Bacteria 814
284 Ga0265342_10094736 3300031712 Bacteria 1708
285 Ga0307516_10055871 3300031730 Bacteria 3852
286 Ga0307414_10258362 3300032004 Bacteria 1452
287 Ga0373940_0133352 3300035088 Bacteria 780
288 Ga0373923_0007024 3300035111 Bacteria 3933
289 Ga0373932_0029589 3300035112 Bacteria 1513
290 Ga0373956_0018325 3300035119 Bacteria 2963
291 Ga0373955_0001047 3300035172 Bacteria 11763
292 Ga0373962_0005533 3300035242 Bacteria 3055
293 Ga0373931_0048042 3300035691 Bacteria 2261
294 Ga0373933_0056321 3300035724 Bacteria 2360
295 Ga0373937_0068899 3300036401 Bacteria 3261
296 Ga0316582_0263948 3300036647 Bacteria 1181
297 Ga0395899_0201250 3300037312 Bacteria 1388
298 Ga0395900_0201363 3300037418 Bacteria 2014
299 Ga0395898_0013029 3300037466 Bacteria 8569
300 Ga0395898_0156027 3300037466 Bacteria 2183
301 Ga0395898_0204778 3300037466 Bacteria 1883
302 Ga0395905_0040846 3300037471 Bacteria 4352
303 Ga0395905_0206573 3300037471 Bacteria 1840
304 Ga0395901_0024715 3300038443 Bacteria 6168
305 Ga0395901_0927592 3300038443 Bacteria 851
306 Ga0400483_098019 3300039062 Bacteria 1089
307 Ga0400483_150870 3300039062 Bacteria 1157
308 Ga0466967_0092802 3300045976 Bacteria 2746
309 Ga0466967_0786934 3300045976 Bacteria 944
310 Ga0495650_0228514 3300046471 Bacteria 639
311 Ga0495582_0303808 3300046473 Bacteria 917
312 Ga0495586_0061473 3300046535 Bacteria 2044
313 Ga0495586_0463730 3300046535 Bacteria 730
314 Ga0495587_0241172 3300046536 Bacteria 1017
315 Ga0495609_0029878 3300046538 Bacteria 2480
316 Ga0495622_0047541 3300046557 Bacteria 1993
317 Ga0495656_0082445 3300046615 Bacteria 1454
318 Ga0495611_0094673 3300046648 Bacteria 1382
319 Ga0495625_0340055 3300046660 Bacteria 951
320 Ga0495657_0069724 3300046675 Bacteria 2300
321 Ga0495671_0343249 3300046692 Bacteria 716
322 Ga0495589_0108283 3300046794 Bacteria 1342
323 Ga0495581_0109670 3300047315 Bacteria 1605
324 Ga0495636_0031726 3300047318 Bacteria 2167
325 Ga0495672_0050165 3300047320 Bacteria 2466
326 Ga0496121_0000572 3300048924 Bacteria 69364
327 Ga0496121_0003884 3300048924 Bacteria 20773
328 Ga0496126_0209457 3300048929 Bacteria 1642
329 Ga0501031_0002923 3300049568 Bacteria 10931
330 Ga0501032_0074448 3300049569 Bacteria 2263
331 Ga0501033_0003655 3300049570 Bacteria 12540
332 Ga0501033_0006469 3300049570 Bacteria 9168
333 Ga0501033_0054298 3300049570 Bacteria 2965
334 Ga0501033_0056715 3300049570 Bacteria 2895
335 Ga0501033_0115615 3300049570 Unclassified 1949
336 Ga0501033_0163145 3300049570 Bacteria 1603
337 Ga0501034_0134076 3300049571 Bacteria 2458
338 Ga0501034_0315685 3300049571 Bacteria 1496
339 Ga0501034_0377079 3300049571 Bacteria 1344
340 Ga0501036_0004570 3300049572 Bacteria 11178
341 Ga0501036_0327220 3300049572 Bacteria 1280
342 Ga0501037_0059676 3300049573 Bacteria 2782
343 Ga0501037_0371871 3300049573 Unclassified 983
344 Ga0501038_0105327 3300049574 Bacteria 2343
345 Ga0501038_0138362 3300049574 Bacteria 1994
346 Ga0501038_0202549 3300049574 Unclassified 1592
347 Ga0501038_0285053 3300049574 Unclassified 1299
348 Ga0501039_0012070 3300049575 Bacteria 6587
349 Ga0501039_1179092 3300049575 Bacteria 593
350 Ga0501042_0005927 3300049578 Bacteria 7905
351 Ga0501043_0049084 3300049579 Bacteria 3317
352 Ga0501043_0165348 3300049579 Bacteria 1728
353 Ga0501046_0001636 3300049580 Bacteria 21447
354 Ga0501046_0005593 3300049580 Bacteria 11220
355 Ga0501047_0000954 3300049581 Bacteria 29310
356 Ga0501047_0004000 3300049581 Bacteria 13852
357 Ga0501047_0005965 3300049581 Bacteria 11450
358 Ga0501047_0019746 3300049581 Bacteria 6468
359 Ga0501047_0030936 3300049581 Bacteria 5161
360 Ga0501047_0065983 3300049581 Bacteria 3488
361 Ga0501047_0083244 3300049581 Bacteria 3075
362 Ga0501047_0259302 3300049581 Bacteria 1586
363 Ga0501047_0285944 3300049581 Unclassified 1493
364 Ga0501047_0417838 3300049581 Bacteria 1173
365 Ga0501047_0553089 3300049581 Bacteria 975
366 Ga0501047_0643508 3300049581 Bacteria 880
367 Ga0501048_0004393 3300049582 Bacteria 10738
368 Ga0501048_0773456 3300049582 Bacteria 690
369 Ga0501067_0001919 3300049583 Bacteria 11420
370 Ga0501070_0004446 3300049586 Bacteria 12038
371 Ga0501072_0003693 3300049588 Bacteria 11542
372 Ga0501072_0937236 3300049588 Bacteria 676
373 Ga0501073_0026156 3300049589 Bacteria 4182
374 Ga0501073_0127358 3300049589 Bacteria 1765
375 Ga0501073_0227864 3300049589 Bacteria 1287
376 Ga0501073_0293396 3300049589 Bacteria 1122
377 Ga0501073_0378996 3300049589 Bacteria 977
378 Ga0501073_0820820 3300049589 Bacteria 641
379 Ga0501074_0001155 3300049590 Bacteria 17276
380 Ga0501074_0100241 3300049590 Bacteria 2073
381 Ga0501079_0003788 3300049741 Bacteria 11169
382 Ga0501079_0543903 3300049741 Bacteria 913
383 Ga0501080_0013915 3300049742 Bacteria 7406
384 Ga0501080_0034658 3300049742 Bacteria 4714
385 Ga0501080_0035973 3300049742 Bacteria 4622
386 Ga0501080_0392113 3300049742 Unclassified 1250
387 Ga0501080_0574789 3300049742 Bacteria 1002
388 Ga0501083_0004091 3300049744 Bacteria 10268
389 Ga0501083_0011929 3300049744 Bacteria 6088
390 Ga0501083_0012198 3300049744 Bacteria 6013
391 Ga0501083_0031695 3300049744 Bacteria 3628
392 Ga0501035_0001608 3300049822 Bacteria 22853
393 Ga0501035_0009408 3300049822 Bacteria 9085
394 Ga0501035_0026973 3300049822 Bacteria 5253
395 Ga0501035_0062341 3300049822 Unclassified 3318
396 Ga0501035_0092620 3300049822 Bacteria 2659
397 Ga0501035_0229609 3300049822 Unclassified 1582
398 Ga0501044_0006311 3300049823 Bacteria 13108
399 Ga0501044_0009508 3300049823 Bacteria 10584
400 Ga0501044_0043283 3300049823 Bacteria 4679
401 Ga0501044_0047113 3300049823 Bacteria 4460
402 Ga0501044_0058585 3300049823 Bacteria 3949
403 Ga0501044_0307712 3300049823 Bacteria 1512
404 Ga0501044_0484517 3300049823 Bacteria 1139
405 Ga0501044_0597434 3300049823 Bacteria 997
406 Ga0501044_0870741 3300049823 Unclassified 777
407 Ga0501045_0016862 3300049824 Bacteria 5188
408 nmdc:mga05p37_480057_c1 3300050507 Bacteria 1432
409 nmdc:mga06r32_1305838_c1 3300050510 Bacteria 669
410 Ga0500635_0055027 3300053080 Bacteria 1373
411 Ga0500643_000021 3300053087 Bacteria 284326
412 Ga0500583_0126371 3300053092 Bacteria 1267
413 Ga0500555_048956 3300053103 Bacteria 1160
414 Ga0500555_074112 3300053103 Bacteria 894
415 Ga0500595_020812 3300053119 Bacteria 2352
416 Ga0500617_029518 3300053124 Bacteria 2449
417 Ga0500642_0197042 3300053130 Bacteria 938
418 Ga0500568_0028081 3300053139 Bacteria 2348
419 Ga0500573_0000012 3300053140 Bacteria 208486
420 Ga0500588_0004574 3300053146 Bacteria 3008
421 Ga0501084_0009877 3300054114 Bacteria 7887
422 Ga0501084_0100429 3300054114 Bacteria 2429
423 Ga0501082_0000908 3300060353 Bacteria 26064
424 Ga0501082_0005896 3300060353 Bacteria 10629
425 Ga0501082_0007125 3300060353 Bacteria 9641
426 Ga0501082_0010330 3300060353 Bacteria 8036
427 Ga0501082_0013584 3300060353 Bacteria 6997
428 Ga0501082_0062504 3300060353 Bacteria 3205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0553089 Ga0501047_0553089_182_676 164
2 3300050507 nmdc:mga05p37_480057_c1 nmdc:mga05p37_480057_c1_21_527 164
3 3300005344 Ga0070661_100000009 Ga0070661_100000009138 167
4 3300005435 Ga0070714_100224337 Ga0070714_1002243372 167
5 3300005458 Ga0070681_10130024 Ga0070681_101300243 167
6 3300025912 Ga0207707_11156746 Ga0207707_111567461 167
7 3300025920 Ga0207649_10000035 Ga0207649_1000003539 167
8 3300025929 Ga0207664_10475352 Ga0207664_104753522 167
9 3300035111 Ga0373923_0007024 Ga0373923_0007024_2919_3431 167
10 3300035119 Ga0373956_0018325 Ga0373956_0018325_708_1220 167
11 3300035172 Ga0373955_0001047 Ga0373955_0001047_5500_6012 167
12 3300035724 Ga0373933_0056321 Ga0373933_0056321_1329_1841 167
13 3300036401 Ga0373937_0068899 Ga0373937_0068899_2053_2565 167
14 3300037312 Ga0395899_0201250 Ga0395899_0201250_192_704 167
15 3300037466 Ga0395898_0156027 Ga0395898_0156027_535_1047 167
16 3300037466 Ga0395898_0204778 Ga0395898_0204778_431_937 167
17 3300037471 Ga0395905_0040846 Ga0395905_0040846_1665_2171 167
18 3300037471 Ga0395905_0206573 Ga0395905_0206573_922_1434 167
19 3300038443 Ga0395901_0927592 Ga0395901_0927592_203_715 167
20 3300046615 Ga0495656_0082445 Ga0495656_0082445_811_1320 169
21 3300047318 Ga0495636_0031726 Ga0495636_0031726_630_1139 169
22 3300006358 Ga0068871_100390930 Ga0068871_1003909302 170
23 3300009098 Ga0105245_10000203 Ga0105245_1000020321 171
24 3300013308 Ga0157375_10011357 Ga0157375_100113574 171
25 3300031711 Ga0265314_10349732 Ga0265314_103497322 171
26 3300005456 Ga0070678_100013834 Ga0070678_1000138346 172
27 3300006237 Ga0097621_100100251 Ga0097621_1001002513 172
28 3300006881 Ga0068865_100144897 Ga0068865_1001448973 172
29 3300025938 Ga0207704_10163412 Ga0207704_101634122 172
30 3300026121 Ga0207683_10008775 Ga0207683_100087757 172
31 3300032004 Ga0307414_10258362 Ga0307414_102583622 172
32 3300005548 Ga0070665_100014095 Ga0070665_1000140954 173
33 3300006844 Ga0075428_100220739 Ga0075428_1002207392 173
34 3300026121 Ga0207683_11446001 Ga0207683_114460011 173
35 3300046660 Ga0495625_0340055 Ga0495625_0340055_44_565 173
36 3300049571 Ga0501034_0377079 Ga0501034_0377079_544_1065 173
37 3300049589 Ga0501073_0293396 Ga0501073_0293396_260_781 173
38 3300049744 Ga0501083_0031695 Ga0501083_0031695_3044_3565 173
39 3300050510 nmdc:mga06r32_1305838_c1 nmdc:mga06r32_1305838_c1_83_622 173
40 3300053087 Ga0500643_000021 Ga0500643_000021_171898_172419 173
41 3300053103 Ga0500555_074112 Ga0500555_074112_268_789 173
42 3300053139 Ga0500568_0028081 Ga0500568_0028081_1610_2131 173
43 3300060353 Ga0501082_0013584 Ga0501082_0013584_5101_5622 173
44 3300005365 Ga0070688_100545167 Ga0070688_1005451672 174
45 3300005535 Ga0070684_100687117 Ga0070684_1006871172 174
46 3300005547 Ga0070693_100167143 Ga0070693_1001671432 174
47 3300005563 Ga0068855_100071141 Ga0068855_1000711413 174
48 3300025912 Ga0207707_10208772 Ga0207707_102087722 174
49 3300025921 Ga0207652_10024220 Ga0207652_100242204 174
50 3300035088 Ga0373940_0133352 Ga0373940_0133352_229_768 174
51 3300035112 Ga0373932_0029589 Ga0373932_0029589_376_915 174
52 3300046473 Ga0495582_0303808 Ga0495582_0303808_192_731 174
53 3300046535 Ga0495586_0061473 Ga0495586_0061473_288_827 174
54 3300047315 Ga0495581_0109670 Ga0495581_0109670_328_867 174
55 3300003762 Ga0055542_1000046 Ga0055542_100004624 175
56 3300003763 Ga0055529_1000007 Ga0055529_1000007205 175
57 3300005339 Ga0070660_100402675 Ga0070660_1004026752 175
58 3300009093 Ga0105240_10947229 Ga0105240_109472291 175
59 3300009174 Ga0105241_10212141 Ga0105241_102121413 175
60 3300009545 Ga0105237_10098430 Ga0105237_100984305 175
61 3300009551 Ga0105238_10034382 Ga0105238_100343825 175
62 3300025254 Ga0209148_1000026 Ga0209148_1000026180 175
63 3300025272 Ga0209455_1000005 Ga0209455_1000005927 175
64 3300025913 Ga0207695_10157075 Ga0207695_101570755 175
65 3300028573 Ga0265334_10001662 Ga0265334_1000166210 175
66 3300028800 Ga0265338_10019557 Ga0265338_100195575 175
67 3300031250 Ga0265331_10105893 Ga0265331_101058932 175
68 3300031344 Ga0265316_10196472 Ga0265316_101964722 175
69 3300031595 Ga0265313_10103789 Ga0265313_101037891 175
70 3300031711 Ga0265314_10106455 Ga0265314_101064551 175
71 3300053140 Ga0500573_0000012 Ga0500573_0000012_80822_81385 175
72 3300036647 Ga0316582_0263948 Ga0316582_0263948_152_694 176
73 3300039062 Ga0400483_098019 Ga0400483_098019_148_690 176
74 3300039062 Ga0400483_150870 Ga0400483_150870_319_861 176
75 3300053124 Ga0500617_029518 Ga0500617_029518_1826_2362 178
76 3300053146 Ga0500588_0004574 Ga0500588_0004574_200_736 178
77 3300049570 Ga0501033_0056715 Ga0501033_0056715_568_1110 180
78 3300049581 Ga0501047_0030936 Ga0501047_0030936_3729_4271 180
79 3300049822 Ga0501035_0092620 Ga0501035_0092620_1540_2082 180
80 3300049823 Ga0501044_0597434 Ga0501044_0597434_65_607 180
81 3300009176 Ga0105242_10883859 Ga0105242_108838591 181
82 3300028800 Ga0265338_10005898 Ga0265338_100058984 181
83 3300031235 Ga0265330_10019335 Ga0265330_100193354 181
84 3300031238 Ga0265332_10010681 Ga0265332_100106814 181
85 3300031344 Ga0265316_10126199 Ga0265316_101261992 181
86 3300031711 Ga0265314_10027015 Ga0265314_100270152 181
87 3300031712 Ga0265342_10094736 Ga0265342_100947362 181
88 3300049581 Ga0501047_0000954 Ga0501047_0000954_11032_11580 181
89 3300049589 Ga0501073_0378996 Ga0501073_0378996_250_798 181
90 3300049742 Ga0501080_0013915 Ga0501080_0013915_2238_2786 181
91 3300060353 Ga0501082_0005896 Ga0501082_0005896_9970_10518 181
92 3300005440 Ga0070705_100945019 Ga0070705_1009450191 182
93 3300005545 Ga0070695_101171139 Ga0070695_1011711391 182
94 3300005549 Ga0070704_100608521 Ga0070704_1006085212 182
95 3300005617 Ga0068859_101648645 Ga0068859_1016486452 182
96 3300005843 Ga0068860_100571172 Ga0068860_1005711722 182
97 3300005844 Ga0068862_100625311 Ga0068862_1006253112 182
98 3300006931 Ga0097620_101648078 Ga0097620_1016480782 182
99 3300025927 Ga0207687_10699270 Ga0207687_106992702 182
100 3300025961 Ga0207712_10283291 Ga0207712_102832913 182
101 3300028380 Ga0268265_10650153 Ga0268265_106501532 182
102 3300028381 Ga0268264_10230999 Ga0268264_102309992 182
103 3300049570 Ga0501033_0006469 Ga0501033_0006469_6910_7458 182
104 3300049570 Ga0501033_0054298 Ga0501033_0054298_1527_2084 182
105 3300049570 Ga0501033_0115615 Ga0501033_0115615_296_853 182
106 3300049570 Ga0501033_0163145 Ga0501033_0163145_599_1153 182
107 3300049572 Ga0501036_0327220 Ga0501036_0327220_485_1033 182
108 3300049573 Ga0501037_0059676 Ga0501037_0059676_89_643 182
109 3300049573 Ga0501037_0371871 Ga0501037_0371871_332_880 182
110 3300049574 Ga0501038_0105327 Ga0501038_0105327_1515_2072 182
111 3300049574 Ga0501038_0138362 Ga0501038_0138362_770_1318 182
112 3300049574 Ga0501038_0202549 Ga0501038_0202549_82_639 182
113 3300049575 Ga0501039_1179092 Ga0501039_1179092_22_570 182
114 3300049579 Ga0501043_0165348 Ga0501043_0165348_943_1500 182
115 3300049581 Ga0501047_0004000 Ga0501047_0004000_13217_13765 182
116 3300049581 Ga0501047_0083244 Ga0501047_0083244_284_841 182
117 3300049581 Ga0501047_0259302 Ga0501047_0259302_386_940 182
118 3300049581 Ga0501047_0285944 Ga0501047_0285944_797_1354 182
119 3300049582 Ga0501048_0773456 Ga0501048_0773456_116_670 182
120 3300049589 Ga0501073_0820820 Ga0501073_0820820_39_596 182
121 3300049742 Ga0501080_0392113 Ga0501080_0392113_483_1040 182
122 3300049822 Ga0501035_0001608 Ga0501035_0001608_15523_16077 182
123 3300049822 Ga0501035_0009408 Ga0501035_0009408_3989_4537 182
124 3300049822 Ga0501035_0062341 Ga0501035_0062341_652_1209 182
125 3300049822 Ga0501035_0229609 Ga0501035_0229609_931_1488 182
126 3300049823 Ga0501044_0009508 Ga0501044_0009508_9594_10148 182
127 3300049823 Ga0501044_0043283 Ga0501044_0043283_1343_1891 182
128 3300049823 Ga0501044_0047113 Ga0501044_0047113_1874_2422 182
129 3300049823 Ga0501044_0307712 Ga0501044_0307712_725_1282 182
130 3300049823 Ga0501044_0484517 Ga0501044_0484517_469_1026 182
131 3300049823 Ga0501044_0870741 Ga0501044_0870741_121_678 182
132 3300005331 Ga0070670_100839370 Ga0070670_1008393701 183
133 3300005331 Ga0070670_101241259 Ga0070670_1012412591 183
134 3300005334 Ga0068869_100174300 Ga0068869_1001743002 183
135 3300005335 Ga0070666_10220401 Ga0070666_102204013 183
136 3300005338 Ga0068868_100390424 Ga0068868_1003904242 183
137 3300005344 Ga0070661_101016538 Ga0070661_1010165381 183
138 3300005356 Ga0070674_101103524 Ga0070674_1011035241 183
139 3300005548 Ga0070665_100027734 Ga0070665_1000277344 183
140 3300005548 Ga0070665_100192015 Ga0070665_1001920153 183
141 3300005719 Ga0068861_101574251 Ga0068861_1015742511 183
142 3300005841 Ga0068863_100294740 Ga0068863_1002947403 183
143 3300005844 Ga0068862_100988158 Ga0068862_1009881582 183
144 3300006237 Ga0097621_100000046 Ga0097621_10000004638 183
145 3300006237 Ga0097621_100035769 Ga0097621_1000357692 183
146 3300006237 Ga0097621_100063425 Ga0097621_1000634252 183
147 3300006237 Ga0097621_100315279 Ga0097621_1003152793 183
148 3300006358 Ga0068871_100000004 Ga0068871_10000000452 183
149 3300006358 Ga0068871_100055578 Ga0068871_1000555785 183
150 3300006358 Ga0068871_100107860 Ga0068871_1001078604 183
151 3300006358 Ga0068871_100200825 Ga0068871_1002008252 183
152 3300006358 Ga0068871_100514803 Ga0068871_1005148032 183
153 3300009093 Ga0105240_10516053 Ga0105240_105160532 183
154 3300009093 Ga0105240_10607300 Ga0105240_106073002 183
155 3300009098 Ga0105245_10505675 Ga0105245_105056753 183
156 3300009098 Ga0105245_10936825 Ga0105245_109368252 183
157 3300009174 Ga0105241_10816422 Ga0105241_108164222 183
158 3300009176 Ga0105242_10170116 Ga0105242_101701162 183
159 3300009176 Ga0105242_10210308 Ga0105242_102103083 183
160 3300009177 Ga0105248_10015941 Ga0105248_100159417 183
161 3300009545 Ga0105237_10921733 Ga0105237_109217332 183
162 3300009551 Ga0105238_10096473 Ga0105238_100964733 183
163 3300009551 Ga0105238_11734675 Ga0105238_117346751 183
164 3300009553 Ga0105249_10053552 Ga0105249_100535525 183
165 3300010375 Ga0105239_10031290 Ga0105239_100312906 183
166 3300010375 Ga0105239_10208061 Ga0105239_102080612 183
167 3300010375 Ga0105239_10732096 Ga0105239_107320962 183
168 3300013100 Ga0157373_10840605 Ga0157373_108406052 183
169 3300013297 Ga0157378_10066447 Ga0157378_100664473 183
170 3300013297 Ga0157378_10090146 Ga0157378_100901463 183
171 3300013297 Ga0157378_10224898 Ga0157378_102248983 183
172 3300013307 Ga0157372_10024209 Ga0157372_100242097 183
173 3300014968 Ga0157379_10518075 Ga0157379_105180752 183
174 3300015265 Ga0182005_1070232 Ga0182005_10702321 183
175 3300025911 Ga0207654_10135877 Ga0207654_101358772 183
176 3300025913 Ga0207695_10246639 Ga0207695_102466392 183
177 3300025913 Ga0207695_10797478 Ga0207695_107974782 183
178 3300025914 Ga0207671_10111432 Ga0207671_101114322 183
179 3300025924 Ga0207694_10780812 Ga0207694_107808122 183
180 3300025925 Ga0207650_10619428 Ga0207650_106194282 183
181 3300025927 Ga0207687_10519913 Ga0207687_105199132 183
182 3300025934 Ga0207686_10135484 Ga0207686_101354843 183
183 3300025934 Ga0207686_10171414 Ga0207686_101714142 183
184 3300025937 Ga0207669_11013744 Ga0207669_110137442 183
185 3300025941 Ga0207711_10014304 Ga0207711_100143047 183
186 3300025942 Ga0207689_10528464 Ga0207689_105284642 183
187 3300025960 Ga0207651_10175355 Ga0207651_101753553 183
188 3300025961 Ga0207712_10088236 Ga0207712_100882363 183
189 3300025981 Ga0207640_10568384 Ga0207640_105683841 183
190 3300026023 Ga0207677_10293830 Ga0207677_102938303 183
191 3300026035 Ga0207703_10470602 Ga0207703_104706022 183
192 3300026088 Ga0207641_10063110 Ga0207641_100631103 183
193 3300026089 Ga0207648_10561464 Ga0207648_105614642 183
194 3300026095 Ga0207676_10440062 Ga0207676_104400622 183
195 3300026116 Ga0207674_10342123 Ga0207674_103421233 183
196 3300026121 Ga0207683_10074021 Ga0207683_100740215 183
197 3300026142 Ga0207698_11006727 Ga0207698_110067272 183
198 3300028379 Ga0268266_10010732 Ga0268266_100107326 183
199 3300028379 Ga0268266_10026894 Ga0268266_100268944 183
200 3300028379 Ga0268266_10145813 Ga0268266_101458132 183
201 3300035242 Ga0373962_0005533 Ga0373962_0005533_1592_2143 183
202 3300035691 Ga0373931_0048042 Ga0373931_0048042_1512_2066 183
203 3300046471 Ga0495650_0228514 Ga0495650_0228514_56_610 183
204 3300046538 Ga0495609_0029878 Ga0495609_0029878_1431_1988 183
205 3300046557 Ga0495622_0047541 Ga0495622_0047541_792_1343 183
206 3300046648 Ga0495611_0094673 Ga0495611_0094673_228_779 183
207 3300046675 Ga0495657_0069724 Ga0495657_0069724_1681_2232 183
208 3300046794 Ga0495589_0108283 Ga0495589_0108283_254_811 183
209 3300047320 Ga0495672_0050165 Ga0495672_0050165_222_773 183
210 3300049581 Ga0501047_0643508 Ga0501047_0643508_211_822 183
211 3300049742 Ga0501080_0035973 Ga0501080_0035973_218_772 183
212 3300049744 Ga0501083_0012198 Ga0501083_0012198_2499_3053 183
213 3300053092 Ga0500583_0126371 Ga0500583_0126371_580_1131 183
214 3300053119 Ga0500595_020812 Ga0500595_020812_260_811 183
215 3300053130 Ga0500642_0197042 Ga0500642_0197042_289_840 183
216 3300060353 Ga0501082_0000908 Ga0501082_0000908_11496_12050 183
217 3300060353 Ga0501082_0010330 Ga0501082_0010330_3337_3891 183
218 3300049588 Ga0501072_0003693 Ga0501072_0003693_3521_4084 184
219 3300049589 Ga0501073_0026156 Ga0501073_0026156_2231_2794 184
220 3300049590 Ga0501074_0100241 Ga0501074_0100241_183_746 184
221 3300049742 Ga0501080_0034658 Ga0501080_0034658_4110_4673 184
222 3300049744 Ga0501083_0011929 Ga0501083_0011929_3562_4125 184
223 3300054114 Ga0501084_0100429 Ga0501084_0100429_1262_1825 184
224 3300060353 Ga0501082_0062504 Ga0501082_0062504_1556_2119 184
225 3300003214 JGI25165J46597_1000013 JGI25165J46597_1000013263 185
226 3300003215 JGI25153J46596_10000293 JGI25153J46596_1000029323 185
227 3300005327 Ga0070658_10104826 Ga0070658_101048262 185
228 3300005327 Ga0070658_10773033 Ga0070658_107730331 185
229 3300005329 Ga0070683_100076133 Ga0070683_1000761334 185
230 3300005329 Ga0070683_100116591 Ga0070683_1001165914 185
231 3300005334 Ga0068869_100468525 Ga0068869_1004685252 185
232 3300005335 Ga0070666_10003719 Ga0070666_100037195 185
233 3300005335 Ga0070666_10173412 Ga0070666_101734123 185
234 3300005336 Ga0070680_100040150 Ga0070680_1000401504 185
235 3300005337 Ga0070682_100372021 Ga0070682_1003720212 185
236 3300005338 Ga0068868_100146527 Ga0068868_1001465273 185
237 3300005339 Ga0070660_100022435 Ga0070660_1000224352 185
238 3300005339 Ga0070660_100029869 Ga0070660_1000298694 185
239 3300005344 Ga0070661_100408389 Ga0070661_1004083891 185
240 3300005354 Ga0070675_100887490 Ga0070675_1008874902 185
241 3300005355 Ga0070671_100352582 Ga0070671_1003525822 185
242 3300005365 Ga0070688_100162049 Ga0070688_1001620492 185
243 3300005366 Ga0070659_100083704 Ga0070659_1000837041 185
244 3300005366 Ga0070659_100499409 Ga0070659_1004994092 185
245 3300005367 Ga0070667_100013558 Ga0070667_1000135584 185
246 3300005367 Ga0070667_100086160 Ga0070667_1000861602 185
247 3300005436 Ga0070713_100175084 Ga0070713_1001750842 185
248 3300005436 Ga0070713_100726401 Ga0070713_1007264011 185
249 3300005441 Ga0070700_100496000 Ga0070700_1004960002 185
250 3300005458 Ga0070681_10124626 Ga0070681_101246263 185
251 3300005458 Ga0070681_10154433 Ga0070681_101544333 185
252 3300005458 Ga0070681_10574848 Ga0070681_105748482 185
253 3300005459 Ga0068867_100001750 Ga0068867_10000175010 185
254 3300005530 Ga0070679_100015301 Ga0070679_1000153019 185
255 3300005530 Ga0070679_100097620 Ga0070679_1000976203 185
256 3300005535 Ga0070684_100300677 Ga0070684_1003006773 185
257 3300005535 Ga0070684_100575597 Ga0070684_1005755971 185
258 3300005539 Ga0068853_100241138 Ga0068853_1002411382 185
259 3300005539 Ga0068853_100671787 Ga0068853_1006717872 185
260 3300005543 Ga0070672_100590065 Ga0070672_1005900652 185
261 3300005544 Ga0070686_100244079 Ga0070686_1002440792 185
262 3300005547 Ga0070693_100367171 Ga0070693_1003671712 185
263 3300005548 Ga0070665_100000328 Ga0070665_10000032826 185
264 3300005548 Ga0070665_100044535 Ga0070665_1000445353 185
265 3300005548 Ga0070665_100095824 Ga0070665_1000958243 185
266 3300005548 Ga0070665_100130366 Ga0070665_1001303664 185
267 3300005563 Ga0068855_100051412 Ga0068855_1000514126 185
268 3300005563 Ga0068855_100762641 Ga0068855_1007626412 185
269 3300005563 Ga0068855_100818891 Ga0068855_1008188912 185
270 3300005563 Ga0068855_100875036 Ga0068855_1008750362 185
271 3300005577 Ga0068857_100621682 Ga0068857_1006216822 185
272 3300005614 Ga0068856_100025196 Ga0068856_1000251965 185
273 3300005614 Ga0068856_100075833 Ga0068856_1000758331 185
274 3300005616 Ga0068852_100322914 Ga0068852_1003229142 185
275 3300005617 Ga0068859_100726574 Ga0068859_1007265741 185
276 3300005618 Ga0068864_100199175 Ga0068864_1001991752 185
277 3300005842 Ga0068858_100119044 Ga0068858_1001190444 185
278 3300005843 Ga0068860_100148694 Ga0068860_1001486942 185
279 3300005843 Ga0068860_100160498 Ga0068860_1001604984 185
280 3300006237 Ga0097621_100434689 Ga0097621_1004346892 185
281 3300006931 Ga0097620_100726453 Ga0097620_1007264532 185
282 3300009093 Ga0105240_10149248 Ga0105240_101492484 185
283 3300009093 Ga0105240_10150964 Ga0105240_101509643 185
284 3300009093 Ga0105240_10346765 Ga0105240_103467652 185
285 3300009093 Ga0105240_10392435 Ga0105240_103924352 185
286 3300009098 Ga0105245_10290779 Ga0105245_102907792 185
287 3300009174 Ga0105241_10679041 Ga0105241_106790412 185
288 3300009177 Ga0105248_10549423 Ga0105248_105494232 185
289 3300009545 Ga0105237_10054465 Ga0105237_100544654 185
290 3300009545 Ga0105237_10259852 Ga0105237_102598523 185
291 3300009545 Ga0105237_11028899 Ga0105237_110288992 185
292 3300009551 Ga0105238_10035871 Ga0105238_100358712 185
293 3300009551 Ga0105238_10167382 Ga0105238_101673823 185
294 3300009551 Ga0105238_10551172 Ga0105238_105511722 185
295 3300010375 Ga0105239_10102347 Ga0105239_101023475 185
296 3300010375 Ga0105239_10917458 Ga0105239_109174582 185
297 3300010375 Ga0105239_11107419 Ga0105239_111074192 185
298 3300011119 Ga0105246_10037750 Ga0105246_100377505 185
299 3300013104 Ga0157370_10044085 Ga0157370_100440855 185
300 3300013104 Ga0157370_10459845 Ga0157370_104598452 185
301 3300013105 Ga0157369_11650399 Ga0157369_116503991 185
302 3300013296 Ga0157374_10177442 Ga0157374_101774422 185
303 3300013297 Ga0157378_10012780 Ga0157378_100127807 185
304 3300013306 Ga0163162_10003970 Ga0163162_100039706 185
305 3300013306 Ga0163162_10481034 Ga0163162_104810342 185
306 3300013306 Ga0163162_11040825 Ga0163162_110408252 185
307 3300013307 Ga0157372_11235764 Ga0157372_112357642 185
308 3300013308 Ga0157375_10229850 Ga0157375_102298503 185
309 3300014325 Ga0163163_10000006 Ga0163163_10000006192 185
310 3300014325 Ga0163163_10014059 Ga0163163_100140597 185
311 3300014968 Ga0157379_10000605 Ga0157379_100006056 185
312 3300014969 Ga0157376_10145202 Ga0157376_101452021 185
313 3300014969 Ga0157376_10343402 Ga0157376_103434022 185
314 3300014969 Ga0157376_10425855 Ga0157376_104258552 185
315 3300025261 Ga0209233_1000013 Ga0209233_1000013511 185
316 3300025261 Ga0209233_1007476 Ga0209233_10074764 185
317 3300025297 Ga0209758_1000013 Ga0209758_100001337 185
318 3300025903 Ga0207680_10042591 Ga0207680_100425915 185
319 3300025907 Ga0207645_10027200 Ga0207645_100272003 185
320 3300025908 Ga0207643_10092806 Ga0207643_100928064 185
321 3300025909 Ga0207705_10642245 Ga0207705_106422452 185
322 3300025911 Ga0207654_10009595 Ga0207654_100095953 185
323 3300025912 Ga0207707_10115820 Ga0207707_101158203 185
324 3300025912 Ga0207707_10154383 Ga0207707_101543834 185
325 3300025912 Ga0207707_10584124 Ga0207707_105841242 185
326 3300025913 Ga0207695_10024152 Ga0207695_100241526 185
327 3300025913 Ga0207695_10068651 Ga0207695_100686512 185
328 3300025913 Ga0207695_10108011 Ga0207695_101080114 185
329 3300025913 Ga0207695_10278056 Ga0207695_102780563 185
330 3300025913 Ga0207695_10871491 Ga0207695_108714911 185
331 3300025914 Ga0207671_10302441 Ga0207671_103024412 185
332 3300025917 Ga0207660_10068902 Ga0207660_100689024 185
333 3300025917 Ga0207660_10544744 Ga0207660_105447442 185
334 3300025919 Ga0207657_10008929 Ga0207657_100089297 185
335 3300025919 Ga0207657_10019317 Ga0207657_100193174 185
336 3300025920 Ga0207649_10065522 Ga0207649_100655223 185
337 3300025921 Ga0207652_10012053 Ga0207652_100120534 185
338 3300025924 Ga0207694_10212792 Ga0207694_102127923 185
339 3300025924 Ga0207694_10300903 Ga0207694_103009032 185
340 3300025924 Ga0207694_10464523 Ga0207694_104645232 185
341 3300025928 Ga0207700_10642641 Ga0207700_106426412 185
342 3300025931 Ga0207644_10618321 Ga0207644_106183212 185
343 3300025932 Ga0207690_10193300 Ga0207690_101933003 185
344 3300025933 Ga0207706_10215006 Ga0207706_102150062 185
345 3300025934 Ga0207686_10057250 Ga0207686_100572502 185
346 3300025934 Ga0207686_10232093 Ga0207686_102320933 185
347 3300025935 Ga0207709_10203795 Ga0207709_102037953 185
348 3300025940 Ga0207691_10239737 Ga0207691_102397372 185
349 3300025942 Ga0207689_10097246 Ga0207689_100972463 185
350 3300025942 Ga0207689_10573035 Ga0207689_105730352 185
351 3300025944 Ga0207661_10306757 Ga0207661_103067572 185
352 3300025949 Ga0207667_10066953 Ga0207667_100669535 185
353 3300025949 Ga0207667_10669967 Ga0207667_106699672 185
354 3300025961 Ga0207712_11255860 Ga0207712_112558601 185
355 3300025981 Ga0207640_11476620 Ga0207640_114766201 185
356 3300025986 Ga0207658_10024071 Ga0207658_100240716 185
357 3300025986 Ga0207658_10066504 Ga0207658_100665045 185
358 3300026035 Ga0207703_10046062 Ga0207703_100460624 185
359 3300026035 Ga0207703_10125427 Ga0207703_101254274 185
360 3300026041 Ga0207639_10262667 Ga0207639_102626672 185
361 3300026041 Ga0207639_10400712 Ga0207639_104007122 185
362 3300026041 Ga0207639_11005079 Ga0207639_110050791 185
363 3300026089 Ga0207648_10019524 Ga0207648_100195246 185
364 3300026089 Ga0207648_10022437 Ga0207648_100224377 185
365 3300026116 Ga0207674_10443039 Ga0207674_104430392 185
366 3300026118 Ga0207675_100112676 Ga0207675_1001126765 185
367 3300026121 Ga0207683_10666275 Ga0207683_106662752 185
368 3300028379 Ga0268266_10000975 Ga0268266_1000097534 185
369 3300028379 Ga0268266_10014103 Ga0268266_100141037 185
370 3300028379 Ga0268266_10051777 Ga0268266_100517774 185
371 3300028380 Ga0268265_10300745 Ga0268265_103007453 185
372 3300028381 Ga0268264_10054695 Ga0268264_100546952 185
373 3300028381 Ga0268264_10102962 Ga0268264_101029623 185
374 3300028577 Ga0265318_10000568 Ga0265318_1000056814 185
375 3300031238 Ga0265332_10054006 Ga0265332_100540062 185
376 3300031239 Ga0265328_10126075 Ga0265328_101260751 185
377 3300031240 Ga0265320_10045471 Ga0265320_100454713 185
378 3300031250 Ga0265331_10018706 Ga0265331_100187064 185
379 3300031595 Ga0265313_10002805 Ga0265313_1000280513 185
380 3300031711 Ga0265314_10005911 Ga0265314_100059116 185
381 3300031711 Ga0265314_10147613 Ga0265314_101476132 185
382 3300031730 Ga0307516_10055871 Ga0307516_100558714 185
383 3300037418 Ga0395900_0201363 Ga0395900_0201363_1029_1586 185
384 3300037466 Ga0395898_0013029 Ga0395898_0013029_324_881 185
385 3300038443 Ga0395901_0024715 Ga0395901_0024715_2071_2628 185
386 3300045976 Ga0466967_0092802 Ga0466967_0092802_1792_2349 185
387 3300045976 Ga0466967_0786934 Ga0466967_0786934_146_715 185
388 3300046535 Ga0495586_0463730 Ga0495586_0463730_53_610 185
389 3300046536 Ga0495587_0241172 Ga0495587_0241172_218_787 185
390 3300046692 Ga0495671_0343249 Ga0495671_0343249_100_663 185
391 3300048924 Ga0496121_0000572 Ga0496121_0000572_61062_61619 185
392 3300048924 Ga0496121_0003884 Ga0496121_0003884_12716_13273 185
393 3300048929 Ga0496126_0209457 Ga0496126_0209457_47_604 185
394 3300049568 Ga0501031_0002923 Ga0501031_0002923_3784_4341 185
395 3300049569 Ga0501032_0074448 Ga0501032_0074448_822_1379 185
396 3300049570 Ga0501033_0003655 Ga0501033_0003655_3989_4546 185
397 3300049571 Ga0501034_0134076 Ga0501034_0134076_1211_1768 185
398 3300049571 Ga0501034_0315685 Ga0501034_0315685_335_892 185
399 3300049572 Ga0501036_0004570 Ga0501036_0004570_6234_6791 185
400 3300049574 Ga0501038_0285053 Ga0501038_0285053_58_615 185
401 3300049575 Ga0501039_0012070 Ga0501039_0012070_2289_2846 185
402 3300049578 Ga0501042_0005927 Ga0501042_0005927_3398_3955 185
403 3300049579 Ga0501043_0049084 Ga0501043_0049084_1016_1573 185
404 3300049580 Ga0501046_0001636 Ga0501046_0001636_14668_15225 185
405 3300049580 Ga0501046_0005593 Ga0501046_0005593_5583_6140 185
406 3300049581 Ga0501047_0005965 Ga0501047_0005965_4395_4952 185
407 3300049581 Ga0501047_0019746 Ga0501047_0019746_3808_4365 185
408 3300049581 Ga0501047_0065983 Ga0501047_0065983_1745_2302 185
409 3300049581 Ga0501047_0417838 Ga0501047_0417838_249_806 185
410 3300049582 Ga0501048_0004393 Ga0501048_0004393_6488_7045 185
411 3300049583 Ga0501067_0001919 Ga0501067_0001919_5588_6145 185
412 3300049586 Ga0501070_0004446 Ga0501070_0004446_10524_11081 185
413 3300049588 Ga0501072_0937236 Ga0501072_0937236_83_640 185
414 3300049589 Ga0501073_0127358 Ga0501073_0127358_174_731 185
415 3300049589 Ga0501073_0227864 Ga0501073_0227864_160_717 185
416 3300049590 Ga0501074_0001155 Ga0501074_0001155_2656_3213 185
417 3300049741 Ga0501079_0003788 Ga0501079_0003788_10576_11133 185
418 3300049741 Ga0501079_0543903 Ga0501079_0543903_16_573 185
419 3300049742 Ga0501080_0574789 Ga0501080_0574789_161_718 185
420 3300049744 Ga0501083_0004091 Ga0501083_0004091_3324_3881 185
421 3300049822 Ga0501035_0026973 Ga0501035_0026973_2107_2664 185
422 3300049823 Ga0501044_0006311 Ga0501044_0006311_10348_10905 185
423 3300049823 Ga0501044_0058585 Ga0501044_0058585_1680_2237 185
424 3300049824 Ga0501045_0016862 Ga0501045_0016862_4592_5149 185
425 3300053080 Ga0500635_0055027 Ga0500635_0055027_590_1147 185
426 3300053103 Ga0500555_048956 Ga0500555_048956_382_951 185
427 3300054114 Ga0501084_0009877 Ga0501084_0009877_3502_4059 185
428 3300060353 Ga0501082_0007125 Ga0501082_0007125_1183_1740 185

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

43

186

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9747 12 177
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9725 12 177
3iwt-assembly1.cif.gz_A structure of hypothetical molybdenum cofactor biosynthesis protein b from sulfolobus tokodaii 0.9651 20 166
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.944 12 177
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9389 17 185
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9708 12 177 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9671 17 157 3.40.980.10
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9435 21 158 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9421 12 177 3.40.980.10
1o8nC00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9123 22 159 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A7U4J719-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9937 12 185 GO:0005829
GO:0006777
AF-A0A661DIQ2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9936 16 174 GO:0005829
GO:0006777
AF-A0A6N1DPE1-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9934 17 185 GO:0005829
GO:0006777
AF-A0A523K612-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9934 12 185 GO:0005829
GO:0006777
AF-A0A1N7FG22-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9934 18 177 GO:0005829
GO:0006777

Feature Viewer

pLDDT pTM Quality
94.06 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map