F441540

General Info

Members Datasets Scaffolds Average Seq Length
427 286 404 199

Family's Representative Sequence

Representative Sequence 3300048925|Ga0496122_0404539|Ga0496122_0404539_12_650
Length 212
Sequence VKALIRRREVLLAACASALLAACDAGPFKGLFGSSTPAAKFNGVDLTGAQYARGFTLPDQNGKTRTLADFKGKVVVLFFGYTQCPDICPTSLAELAQAKESMGKDGDRVQGLFITVDPERDTPELLKAYMANFDPTFLGLRGTPDETKAAAKEFKAYYAKVPGKTPDTYTMDHTAAFYVFDPAGKIRLFMRNDLGPQQLASDLKQLLADPAA

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
4 2643221672 Variovorax sp. Root434 Isolate Unclassified
5 2738541307 Variovorax sp. GV008 Isolate Unclassified
6 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
7 2831864461 Roseateles noduli HZ7 Isolate Nodule
8 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
9 2842677519 Variovorax sp. R-72495 Isolate Unclassified
10 2842733646 Variovorax sp. R-72446 Isolate Unclassified
11 2842747753 Variovorax sp. R-72060 Isolate Unclassified
12 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
13 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
14 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
15 2904424332 Duganella sp. 1411 Isolate Rhizosphere
16 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
17 2904456579 Variovorax sp. 2002 Isolate Unclassified
18 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
19 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
20 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
21 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
22 2929520902 Variovorax beijingensis 502 Isolate Unclassified
23 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
27 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
28 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
29 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
30 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
78 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
79 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
128 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
156 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
157 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
166 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
167 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
168 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
169 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
170 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
171 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
172 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
173 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
174 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
175 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
176 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
177 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
178 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
179 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
180 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
183 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
197 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
225 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
229 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
230 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
233 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
243 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
244 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
245 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
263 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
264 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
281 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
282 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
283 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.61
Metatranscriptomes 0
Isolates 5.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.08
Nodule 2.34
Rhizoplane 2.11
Rhizosphere 69.32
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1024625 3300002987 Bacteria 1067
2 JGI25153J46596_10047024 3300003215 Bacteria 1273
3 rootH1_10113865 3300003323 Bacteria 1033
4 Ga0055526_1000135 3300003771 Bacteria 65528
5 Ga0055526_1002360 3300003771 Bacteria 12814
6 Ga0055526_1009630 3300003771 Bacteria 4616
7 Ga0055537_1000049 3300003773 Bacteria 87244
8 Ga0055537_1000103 3300003773 Bacteria 63399
9 Ga0055524_1000022 3300003775 Bacteria 224103
10 Ga0055524_1006641 3300003775 Bacteria 5002
11 Ga0055524_1027017 3300003775 Bacteria 1755
12 Ga0055524_1027776 3300003775 Bacteria 1708
13 Ga0055534_1000049 3300003784 Bacteria 92974
14 Ga0055534_1000317 3300003784 Bacteria 32025
15 Ga0055534_1003010 3300003784 Bacteria 5540
16 Ga0055528_1000031 3300003790 Bacteria 120960
17 Ga0055528_1000357 3300003790 Bacteria 37139
18 Ga0055528_1007771 3300003790 Bacteria 4692
19 Ga0055528_1023739 3300003790 Bacteria 1860
20 Ga0055540_1026626 3300003792 Bacteria 1396
21 Ga0055531_10024709 3300003794 Bacteria 2206
22 Ga0055531_10049325 3300003794 Bacteria 1126
23 Ga0055531_10068806 3300003794 Bacteria 826
24 Ga0065165_1000016 3300005262 Bacteria 286248
25 Ga0065165_1029330 3300005262 Bacteria 1764
26 Ga0065714_10105564 3300005288 Bacteria 1563
27 Ga0065715_10138857 3300005293 Bacteria 1885
28 Ga0070658_11010435 3300005327 Bacteria 723
29 Ga0070670_100007479 3300005331 Bacteria 9278
30 Ga0070670_100283213 3300005331 Bacteria 1447
31 Ga0070682_100055311 3300005337 Bacteria 2492
32 Ga0070668_100058253 3300005347 Bacteria 2988
33 Ga0070669_100032936 3300005353 Bacteria 3746
34 Ga0070669_100055415 3300005353 Bacteria 2905
35 Ga0070675_100023567 3300005354 Bacteria 4923
36 Ga0070671_100114890 3300005355 Bacteria 2263
37 Ga0070673_100052396 3300005364 Bacteria 3201
38 Ga0070673_100929405 3300005364 Bacteria 808
39 Ga0070659_100833758 3300005366 Bacteria 803
40 Ga0070667_100591538 3300005367 Bacteria 1022
41 Ga0070713_100000266 3300005436 Bacteria 34256
42 Ga0070711_100413144 3300005439 Bacteria 1098
43 Ga0070678_100513800 3300005456 Bacteria 1059
44 Ga0070662_100119391 3300005457 Bacteria 2019
45 Ga0068867_100317853 3300005459 Bacteria 1289
46 Ga0068867_101284644 3300005459 Bacteria 675
47 Ga0070679_100245024 3300005530 Bacteria 1749
48 Ga0070672_100078372 3300005543 Bacteria 2644
49 Ga0070665_100013363 3300005548 Bacteria 8263
50 Ga0068855_100132953 3300005563 Bacteria 2840
51 Ga0070664_100198962 3300005564 Bacteria 1787
52 Ga0068852_100608119 3300005616 Bacteria 1098
53 Ga0068864_100003116 3300005618 Bacteria 13699
54 Ga0068864_100024778 3300005618 Bacteria 5047
55 Ga0068864_100129101 3300005618 Bacteria 2268
56 Ga0068861_100120413 3300005719 Bacteria 2116
57 Ga0068863_100007332 3300005841 Bacteria 10795
58 Ga0068863_100105310 3300005841 Bacteria 2683
59 Ga0068863_100470712 3300005841 Bacteria 1235
60 Ga0068863_100525808 3300005841 Bacteria 1167
61 Ga0068858_100387753 3300005842 Bacteria 1341
62 Ga0068860_100529414 3300005843 Bacteria 1179
63 Ga0081539_10070393 3300005985 Bacteria 1878
64 Ga0075365_10751368 3300006038 Bacteria 689
65 Ga0075363_100025921 3300006048 Bacteria 2995
66 Ga0075364_10114356 3300006051 Bacteria 1803
67 Ga0075362_10018463 3300006177 Bacteria 2886
68 Ga0075366_10035898 3300006195 Bacteria 2922
69 Ga0075370_10000954 3300006353 Bacteria 11903
70 Ga0075370_10009650 3300006353 Bacteria 5022
71 Ga0075370_10294577 3300006353 Bacteria 964
72 Ga0075428_100103780 3300006844 Bacteria 3100
73 Ga0075433_10325017 3300006852 Bacteria 1361
74 Ga0099823_1000101 3300006944 Bacteria 41834
75 Ga0079104_1014502 3300006946 Bacteria 2375
76 Ga0099826_10000006 3300006948 Bacteria 432260
77 Ga0099826_10003969 3300006948 Bacteria 10245
78 Ga0099826_10138236 3300006948 Bacteria 1411
79 Ga0075435_100059630 3300007076 Bacteria 3094
80 Ga0075435_100195913 3300007076 Bacteria 1711
81 Ga0105248_10267508 3300009177 Bacteria 1925
82 Ga0105248_10557653 3300009177 Bacteria 1293
83 Ga0157317_1000252 3300012475 Bacteria 2003
84 Ga0157319_1000015 3300012497 Bacteria 130857
85 Ga0157347_1001809 3300012502 Bacteria 1741
86 Ga0157373_10072813 3300013100 Bacteria 2425
87 Ga0163162_10839940 3300013306 Bacteria 1034
88 Ga0157375_10076591 3300013308 Bacteria 3372
89 Ga0163163_10003666 3300014325 Bacteria 13067
90 Ga0157380_10141995 3300014326 Bacteria 2065
91 Ga0157380_11387273 3300014326 Bacteria 753
92 Ga0182008_10003510 3300014497 Bacteria 9451
93 Ga0157376_10323117 3300014969 Bacteria 1468
94 Ga0182006_1148632 3300015261 Bacteria 796
95 Ga0163161_10008385 3300017792 Bacteria 7153
96 Ga0213872_10242618 3300021361 Bacteria 761
97 Ga0209258_104510 3300025242 Bacteria 2614
98 Ga0209565_1000020 3300025263 Bacteria 432627
99 Ga0209565_1000035 3300025263 Bacteria 298125
100 Ga0209673_1000006 3300025273 Bacteria 650600
101 Ga0209673_1000295 3300025273 Bacteria 92499
102 Ga0209673_1010195 3300025273 Bacteria 3982
103 Ga0209673_1010225 3300025273 Bacteria 3974
104 Ga0209673_1043613 3300025273 Bacteria 1250
105 Ga0209673_1076549 3300025273 Bacteria 779
106 Ga0209130_1017734 3300025284 Bacteria 1688
107 Ga0209675_1000005 3300025291 Bacteria 849192
108 Ga0209675_1000014 3300025291 Bacteria 421902
109 Ga0209675_1006340 3300025291 Bacteria 4766
110 Ga0209676_1012489 3300025292 Bacteria 3332
111 Ga0209025_1002422 3300025294 Bacteria 19823
112 Ga0209025_1008203 3300025294 Bacteria 7556
113 Ga0209564_1000008 3300025295 Bacteria 953227
114 Ga0209564_1000083 3300025295 Bacteria 259272
115 Ga0209564_1000493 3300025295 Bacteria 65593
116 Ga0209758_1000278 3300025297 Bacteria 102052
117 Ga0209758_1050209 3300025297 Bacteria 1465
118 Ga0209050_1006258 3300025298 Bacteria 7131
119 Ga0209256_1000035 3300025299 Bacteria 386754
120 Ga0209256_1000141 3300025299 Bacteria 152280
121 Ga0209256_1000424 3300025299 Bacteria 66333
122 Ga0209256_1001222 3300025299 Bacteria 28622
123 Ga0209256_1028678 3300025299 Bacteria 1566
124 Ga0209256_1041506 3300025299 Bacteria 1169
125 Ga0209051_1001113 3300025303 Bacteria 24611
126 Ga0209051_1046565 3300025303 Bacteria 1490
127 Ga0209051_1047257 3300025303 Bacteria 1472
128 Ga0209257_1002253 3300025304 Bacteria 19751
129 Ga0209257_1003886 3300025304 Bacteria 12194
130 Ga0209257_1083735 3300025304 Bacteria 812
131 Ga0207705_10225352 3300025909 Bacteria 1425
132 Ga0207705_10824865 3300025909 Bacteria 719
133 Ga0207707_10849908 3300025912 Unclassified 757
134 Ga0207652_10212027 3300025921 Bacteria 1744
135 Ga0207681_10012025 3300025923 Bacteria 5332
136 Ga0207681_10019983 3300025923 Bacteria 4242
137 Ga0207650_10206121 3300025925 Bacteria 1577
138 Ga0207700_10001736 3300025928 Bacteria 12389
139 Ga0207644_10275559 3300025931 Bacteria 1349
140 Ga0207690_10621946 3300025932 Bacteria 883
141 Ga0207706_10051249 3300025933 Bacteria 3645
142 Ga0207706_10455951 3300025933 Bacteria 1106
143 Ga0207669_10147844 3300025937 Bacteria 1641
144 Ga0207665_10010762 3300025939 Bacteria 6006
145 Ga0207691_10002059 3300025940 Bacteria 19656
146 Ga0207711_10536270 3300025941 Bacteria 1091
147 Ga0207689_10083549 3300025942 Bacteria 2625
148 Ga0207679_10169937 3300025945 Bacteria 1794
149 Ga0207651_10017566 3300025960 Bacteria 4228
150 Ga0207668_10014157 3300025972 Bacteria 4933
151 Ga0207658_10143201 3300025986 Bacteria 1938
152 Ga0207658_10178630 3300025986 Bacteria 1755
153 Ga0207677_10062403 3300026023 Bacteria 2585
154 Ga0207641_10012354 3300026088 Bacteria 7004
155 Ga0207641_10150491 3300026088 Bacteria 2107
156 Ga0207641_10356161 3300026088 Bacteria 1396
157 Ga0207648_10086035 3300026089 Bacteria 2742
158 Ga0207676_10000809 3300026095 Bacteria 24391
159 Ga0207676_10025446 3300026095 Bacteria 4391
160 Ga0207676_10070872 3300026095 Bacteria 2796
161 Ga0207675_100102496 3300026118 Bacteria 2697
162 Ga0207675_100312903 3300026118 Bacteria 1532
163 Ga0207683_10177790 3300026121 Bacteria 1929
164 Ga0209389_1001650 3300027296 Bacteria 16043
165 Ga0209371_1028996 3300027312 Bacteria 1228
166 Ga0209282_1000003 3300027666 Bacteria 856377
167 Ga0209282_1000587 3300027666 Bacteria 17828
168 Ga0268266_10019737 3300028379 Bacteria 5744
169 Ga0268266_10120896 3300028379 Bacteria 2331
170 Ga0268256_1021107 3300030500 Bacteria 1740
171 Ga0307512_10217478 3300030522 Bacteria 1004
172 Ga0265330_10002590 3300031235 Bacteria 9822
173 Ga0265332_10000365 3300031238 Bacteria 33505
174 Ga0265328_10008612 3300031239 Bacteria 4196
175 Ga0265325_10003625 3300031241 Bacteria 10028
176 Ga0265329_10003951 3300031242 Bacteria 6328
177 Ga0265331_10000588 3300031250 Bacteria 32461
178 Ga0265331_10002911 3300031250 Bacteria 11313
179 Ga0265327_10000042 3300031251 Bacteria 287487
180 Ga0265327_10001246 3300031251 Bacteria 33969
181 Ga0265316_10010812 3300031344 Bacteria 8290
182 Ga0307408_100022103 3300031548 Bacteria 4316
183 Ga0307408_100089404 3300031548 Bacteria 2321
184 Ga0307408_100803058 3300031548 Bacteria 854
185 Ga0265314_10004338 3300031711 Bacteria 13220
186 Ga0265342_10003581 3300031712 Bacteria 12674
187 Ga0307405_10244850 3300031731 Bacteria 1330
188 Ga0307405_10993528 3300031731 Bacteria 715
189 Ga0307416_101369960 3300032002 Bacteria 813
190 Ga0307414_10318113 3300032004 Bacteria 1323
191 Ga0307414_10422686 3300032004 Bacteria 1162
192 Ga0307414_10495241 3300032004 Bacteria 1080
193 Ga0307414_10824003 3300032004 Bacteria 847
194 Ga0373941_0399908 3300035115 Bacteria 568
195 Ga0373931_0120603 3300035691 Bacteria 1498
196 Ga0395900_0118452 3300037418 Bacteria 2717
197 Ga0395898_0040954 3300037466 Bacteria 4577
198 Ga0395905_0000672 3300037471 Bacteria 45490
199 Ga0395905_0178158 3300037471 Bacteria 1995
200 Ga0395905_0743539 3300037471 Bacteria 883
201 Ga0395901_0018816 3300038443 Bacteria 7060
202 Ga0436361_0441007 3300039447 Bacteria 54865
203 Ga0436361_0483803 3300039447 Bacteria 1555
204 Ga0436361_0698556 3300039447 Bacteria 25315
205 Ga0439436_0000228 3300041404 Bacteria 13481
206 Ga0439447_019305 3300041407 Bacteria 1819
207 Ga0439461_0003902 3300041410 Bacteria 2471
208 Ga0439466_0004686 3300041411 Bacteria 5255
209 Ga0439465_0000179 3300041413 Bacteria 16210
210 Ga0439465_0198719 3300041413 Bacteria 730
211 Ga0451797_1338734 3300041453 Bacteria 676
212 Ga0451804_0834910 3300041463 Bacteria 1262
213 Ga0451837_0920920 3300041494 Bacteria 719
214 Ga0451843_0651635 3300041509 Bacteria 953
215 Ga0451853_2147470 3300041512 Bacteria 1612
216 Ga0439431_0013407 3300041997 Bacteria 1891
217 Ga0439433_0000297 3300041999 Bacteria 8590
218 Ga0439442_002165 3300042002 Bacteria 3863
219 Ga0439442_007988 3300042002 Bacteria 2138
220 Ga0439432_000674 3300042006 Bacteria 12782
221 Ga0439449_0024984 3300042007 Bacteria 2232
222 Ga0439452_001146 3300042010 Bacteria 11542
223 Ga0439457_005934 3300042014 Bacteria 3020
224 Ga0439457_036092 3300042014 Bacteria 1100
225 Ga0439462_0003260 3300042015 Bacteria 3879
226 Ga0450921_000103 3300042123 Bacteria 2708
227 Ga0450923_016019 3300042125 Bacteria 1407
228 Ga0450890_000932 3300042127 Bacteria 4232
229 Ga0450890_008087 3300042127 Bacteria 1345
230 Ga0450896_012249 3300042133 Bacteria 1213
231 Ga0450906_001450 3300042145 Bacteria 5164
232 Ga0450907_022810 3300042146 Bacteria 1055
233 Ga0450910_041875 3300042147 Bacteria 741
234 Ga0439446_0007142 3300042156 Bacteria 2930
235 Ga0439446_0066721 3300042156 Bacteria 1095
236 Ga0450909_020442 3300042185 Bacteria 986
237 Ga0439434_0002846 3300042435 Bacteria 5050
238 Ga0439434_0013944 3300042435 Bacteria 2388
239 Ga0439434_0026869 3300042435 Bacteria 1739
240 Ga0450918_000471 3300042531 Bacteria 8579
241 Ga0450893_0008044 3300042532 Bacteria 1716
242 Ga0466969_0010533 3300044656 Bacteria 4901
243 Ga0453683_0182205 3300044673 Unclassified 1332
244 Ga0466966_0005021 3300044684 Bacteria 8703
245 Ga0466966_0005834 3300044684 Bacteria 8118
246 Ga0466961_0024698 3300044693 Bacteria 3865
247 Ga0466961_0030995 3300044693 Bacteria 3437
248 Ga0466961_0269775 3300044693 Bacteria 1042
249 Ga0466963_0139677 3300044694 Bacteria 1678
250 Ga0466964_0018962 3300044706 Bacteria 2642
251 Ga0466970_0010270 3300044765 Bacteria 4749
252 Ga0466959_0004338 3300045049 Bacteria 9479
253 Ga0466958_0402628 3300045836 Bacteria 883
254 Ga0495627_006803 3300046453 Bacteria 4450
255 Ga0495627_011242 3300046453 Bacteria 3219
256 Ga0495627_018059 3300046453 Bacteria 2386
257 Ga0495592_0053514 3300046454 Bacteria 2994
258 Ga0495592_0499468 3300046454 Bacteria 755
259 Ga0495651_0291944 3300046462 Bacteria 1097
260 Ga0495650_0000133 3300046471 Bacteria 173878
261 Ga0495605_0000010 3300046474 Bacteria 319487
262 Ga0495605_0142225 3300046474 Bacteria 1076
263 Ga0495585_0003718 3300046492 Bacteria 10202
264 Ga0495596_0197857 3300046500 Bacteria 781
265 Ga0495607_0011950 3300046501 Bacteria 5751
266 Ga0495583_0007646 3300046506 Bacteria 6739
267 Ga0495606_0000542 3300046507 Bacteria 60618
268 Ga0495610_0025268 3300046512 Bacteria 3190
269 Ga0495631_0067040 3300046518 Bacteria 1553
270 Ga0495637_0005370 3300046520 Bacteria 6543
271 Ga0495637_0026172 3300046520 Bacteria 2622
272 Ga0495643_0000318 3300046522 Bacteria 66545
273 Ga0495643_0064805 3300046522 Bacteria 1930
274 Ga0495643_0202968 3300046522 Bacteria 951
275 Ga0495648_0036444 3300046524 Bacteria 3173
276 Ga0495642_0044430 3300046528 Bacteria 1813
277 Ga0495642_0052220 3300046528 Bacteria 1683
278 Ga0495642_0096464 3300046528 Bacteria 1255
279 Ga0495665_0034954 3300046531 Bacteria 2686
280 Ga0495586_0060720 3300046535 Bacteria 2056
281 Ga0495609_0015695 3300046538 Bacteria 3542
282 Ga0495609_0030057 3300046538 Bacteria 2472
283 Ga0495609_0066797 3300046538 Bacteria 1584
284 Ga0495597_0009785 3300046542 Bacteria 4719
285 Ga0495597_0124549 3300046542 Bacteria 1072
286 Ga0495622_0036048 3300046557 Bacteria 2307
287 Ga0495633_0016687 3300046558 Bacteria 3779
288 Ga0495633_0128077 3300046558 Bacteria 1174
289 Ga0495633_0214070 3300046558 Bacteria 883
290 Ga0495625_0000045 3300046660 Bacteria 202475
291 Ga0495625_0032918 3300046660 Bacteria 3838
292 Ga0495625_0256391 3300046660 Bacteria 1133
293 Ga0495635_0207740 3300046663 Bacteria 1327
294 Ga0495659_0067290 3300046664 Bacteria 1336
295 Ga0495661_0004320 3300046665 Bacteria 10294
296 Ga0495661_0077479 3300046665 Bacteria 1926
297 Ga0495661_0150393 3300046665 Bacteria 1258
298 Ga0495588_0015029 3300046674 Bacteria 3718
299 Ga0495588_0027209 3300046674 Bacteria 2857
300 Ga0495657_0714370 3300046675 Bacteria 576
301 Ga0495670_0014354 3300046691 Bacteria 3894
302 Ga0495670_0193591 3300046691 Bacteria 1075
303 Ga0495671_0025022 3300046692 Bacteria 3105
304 Ga0495671_0059840 3300046692 Bacteria 1881
305 Ga0495671_0204716 3300046692 Bacteria 957
306 Ga0495649_0001619 3300046694 Bacteria 16762
307 Ga0495649_0063626 3300046694 Bacteria 1982
308 Ga0495660_0022933 3300046810 Bacteria 3562
309 Ga0495660_0089134 3300046810 Bacteria 1606
310 Ga0495660_0253629 3300046810 Bacteria 815
311 Ga0495636_0018894 3300047318 Bacteria 2767
312 Ga0495672_0000005 3300047320 Bacteria 593294
313 Ga0495672_0000944 3300047320 Bacteria 30335
314 Ga0495676_0369510 3300047321 Bacteria 956
315 Ga0495683_0036308 3300047323 Bacteria 2502
316 Ga0495687_000931 3300047443 Bacteria 30356
317 Ga0495687_004928 3300047443 Bacteria 8739
318 Ga0495681_0007645 3300047470 Bacteria 6875
319 Ga0495681_0083141 3300047470 Bacteria 1425
320 Ga0495686_0153750 3300047472 Bacteria 1349
321 Ga0495615_0031459 3300048090 Bacteria 1273
322 Ga0495626_0003592 3300048091 Bacteria 9866
323 Ga0496102_0029914 3300048905 Bacteria 4873
324 Ga0496103_0001612 3300048906 Bacteria 14822
325 Ga0496107_0304296 3300048910 Bacteria 1187
326 Ga0496108_0242127 3300048911 Bacteria 1569
327 Ga0496109_0441783 3300048912 Bacteria 1229
328 Ga0496112_0025517 3300048915 Bacteria 5675
329 Ga0496115_0010117 3300048918 Bacteria 7036
330 Ga0496116_0072670 3300048919 Bacteria 2173
331 Ga0496122_0000331 3300048925 Bacteria 102617
332 Ga0496122_0075485 3300048925 Bacteria 2377
333 Ga0496122_0404539 3300048925 Bacteria 692
334 Ga0496123_0001132 3300048926 Bacteria 39831
335 Ga0496125_0034938 3300048928 Bacteria 4421
336 Ga0496126_0020553 3300048929 Bacteria 6467
337 Ga0495678_003411 3300049459 Bacteria 9864
338 Ga0495678_003447 3300049459 Bacteria 9798
339 Ga0501031_0008105 3300049568 Bacteria 6845
340 Ga0501031_0019255 3300049568 Bacteria 4444
341 Ga0501032_0000588 3300049569 Bacteria 29293
342 Ga0501032_0158472 3300049569 Bacteria 1486
343 Ga0501033_0014282 3300049570 Bacteria 6035
344 Ga0501033_0015115 3300049570 Bacteria 5857
345 Ga0501033_0115943 3300049570 Bacteria 1946
346 Ga0501034_0000844 3300049571 Bacteria 45327
347 Ga0501036_0001286 3300049572 Bacteria 19223
348 Ga0501036_0005166 3300049572 Bacteria 10558
349 Ga0501036_0026932 3300049572 Bacteria 4858
350 Ga0501037_0007634 3300049573 Bacteria 7918
351 Ga0501037_0044733 3300049573 Bacteria 3251
352 Ga0501038_0264117 3300049574 Bacteria 1359
353 Ga0501039_0033590 3300049575 Bacteria 3956
354 Ga0501040_0019487 3300049576 Bacteria 4512
355 Ga0501042_0061499 3300049578 Bacteria 2683
356 Ga0501043_0014613 3300049579 Bacteria 6146
357 Ga0501043_0054642 3300049579 Bacteria 3136
358 Ga0501043_0066893 3300049579 Bacteria 2822
359 Ga0501043_0138859 3300049579 Bacteria 1903
360 Ga0501046_0004594 3300049580 Bacteria 12468
361 Ga0501046_0013874 3300049580 Bacteria 6807
362 Ga0501047_0002699 3300049581 Bacteria 16886
363 Ga0501047_0172714 3300049581 Bacteria 2030
364 Ga0501048_0013798 3300049582 Bacteria 5992
365 Ga0501068_0181607 3300049584 Bacteria 1330
366 Ga0501209_000027 3300049656 Bacteria 14413
367 Ga0501249_007116 3300049679 Bacteria 2306
368 Ga0501269_000066 3300049766 Bacteria 32371
369 Ga0501035_0003981 3300049822 Bacteria 14083
370 Ga0501035_0005295 3300049822 Bacteria 12212
371 Ga0501035_0027247 3300049822 Bacteria 5223
372 Ga0501035_0221980 3300049822 Bacteria 1613
373 Ga0501044_0000111 3300049823 Bacteria 100080
374 Ga0501044_0002722 3300049823 Bacteria 20105
375 Ga0501044_0006145 3300049823 Bacteria 13263
376 Ga0501044_0006735 3300049823 Bacteria 12667
377 nmdc:mga03683_19456_c1 3300050489 Bacteria 2592
378 nmdc:mga03683_3239_c1 3300050489 Bacteria 5213
379 nmdc:mga03n38_36944_c1 3300050490 Bacteria 2103
380 nmdc:mga03n38_47788_c1 3300050490 Bacteria 1896
381 nmdc:mga00v17_162759_c1 3300050491 Bacteria 1437
382 nmdc:mga00v17_228052_c1 3300050491 Bacteria 1207
383 nmdc:mga0yw44_3869_c1 3300050492 Bacteria 6740
384 nmdc:mga0k408_145493_c1 3300050493 Bacteria 1411
385 nmdc:mga0k408_5217_c1 3300050493 Bacteria 6599
386 nmdc:mga06z11_349077_c1 3300050494 Bacteria 885
387 nmdc:mga07m45_13979_c1 3300050496 Bacteria 4268
388 nmdc:mga07m45_17999_c1 3300050496 Bacteria 3805
389 nmdc:mga0rr50_185930_c1 3300050513 Bacteria 1700
390 nmdc:mga0rr50_83908_c1 3300050513 Bacteria 2465
391 nmdc:mga0a205_46663_c1 3300050515 Bacteria 4178
392 Ga0500610_0002892 3300053079 Bacteria 6459
393 Ga0500610_0003622 3300053079 Bacteria 5976
394 Ga0495619_0092277 3300053085 Bacteria 2051
395 Ga0500643_032092 3300053087 Bacteria 1597
396 Ga0500593_000088 3300053117 Bacteria 33611
397 Ga0500607_036363 3300053121 Bacteria 2688
398 Ga0500642_0086554 3300053130 Bacteria 1445
399 Ga0500559_0040014 3300053136 Bacteria 2040
400 Ga0500559_0082107 3300053136 Bacteria 1466
401 Ga0500590_006940 3300053148 Bacteria 5553
402 Ga0500627_0007585 3300053158 Bacteria 3791
403 Ga0500634_0037319 3300053161 Bacteria 2643
404 Ga0500645_111979 3300053730 Bacteria 765

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035115 Ga0373941_0399908 Ga0373941_0399908_26_538 168
2 3300046454 Ga0495592_0053514 Ga0495592_0053514_1001_1597 168
3 3300046492 Ga0495585_0003718 Ga0495585_0003718_3970_4554 168
4 3300046528 Ga0495642_0052220 Ga0495642_0052220_326_931 168
5 3300046558 Ga0495633_0016687 Ga0495633_0016687_2892_3476 168
6 3300046665 Ga0495661_0004320 Ga0495661_0004320_3678_4262 168
7 3300046691 Ga0495670_0014354 Ga0495670_0014354_2947_3531 168
8 3300053148 Ga0500590_006940 Ga0500590_006940_3950_4546 168
9 3300046674 Ga0495588_0027209 Ga0495588_0027209_669_1253 170
10 3300048910 Ga0496107_0304296 Ga0496107_0304296_153_737 170
11 3300046810 Ga0495660_0022933 Ga0495660_0022933_818_1405 172
12 3300047320 Ga0495672_0000005 Ga0495672_0000005_555431_556018 172
13 3300047472 Ga0495686_0153750 Ga0495686_0153750_607_1194 172
14 3300046675 Ga0495657_0714370 Ga0495657_0714370_11_559 178
15 3300046660 Ga0495625_0256391 Ga0495625_0256391_147_731 183
16 3300046664 Ga0495659_0067290 Ga0495659_0067290_526_1110 183
17 3300050490 nmdc:mga03n38_36944_c1 nmdc:mga03n38_36944_c1_53_616 183
18 3300005459 Ga0068867_101284644 Ga0068867_1012846441 184
19 3300025937 Ga0207669_10147844 Ga0207669_101478441 184
20 3300041453 Ga0451797_1338734 Ga0451797_1338734_91_666 184
21 3300041413 Ga0439465_0198719 Ga0439465_0198719_138_719 185
22 3300042146 Ga0450907_022810 Ga0450907_022810_406_990 186
23 3300003790 Ga0055528_1007771 Ga0055528_10077713 188
24 3300035691 Ga0373931_0120603 Ga0373931_0120603_574_1149 188
25 iso_pu_bacteria 2511231026 2511385790 188
26 iso_pu_bacteria 2904424332 2904429529 188
27 3300003775 Ga0055524_1000022 Ga0055524_1000022179 189
28 3300006948 Ga0099826_10000006 Ga0099826_10000006230 189
29 3300025299 Ga0209256_1000035 Ga0209256_1000035179 189
30 3300025923 Ga0207681_10019983 Ga0207681_100199835 189
31 3300027666 Ga0209282_1000003 Ga0209282_1000003145 189
32 3300041494 Ga0451837_0920920 Ga0451837_0920920_78_686 189
33 3300046454 Ga0495592_0499468 Ga0495592_0499468_47_676 189
34 3300046462 Ga0495651_0291944 Ga0495651_0291944_222_851 189
35 3300046520 Ga0495637_0026172 Ga0495637_0026172_735_1316 189
36 3300047470 Ga0495681_0007645 Ga0495681_0007645_4648_5232 189
37 iso_pu_bacteria 2842733646 2842733974 189
38 iso_pu_bacteria 2842747753 2842752577 189
39 3300003771 Ga0055526_1002360 Ga0055526_100236011 190
40 3300003771 Ga0055526_1009630 Ga0055526_10096302 190
41 3300003773 Ga0055537_1000103 Ga0055537_100010310 190
42 3300003775 Ga0055524_1006641 Ga0055524_10066411 190
43 3300003784 Ga0055534_1000317 Ga0055534_100031728 190
44 3300003790 Ga0055528_1000031 Ga0055528_100003176 190
45 3300005327 Ga0070658_11010435 Ga0070658_110104351 190
46 3300005337 Ga0070682_100055311 Ga0070682_1000553113 190
47 3300005353 Ga0070669_100032936 Ga0070669_1000329364 190
48 3300005364 Ga0070673_100929405 Ga0070673_1009294052 190
49 3300005530 Ga0070679_100245024 Ga0070679_1002450242 190
50 3300005841 Ga0068863_100470712 Ga0068863_1004707122 190
51 3300005842 Ga0068858_100387753 Ga0068858_1003877532 190
52 3300005843 Ga0068860_100529414 Ga0068860_1005294142 190
53 3300009177 Ga0105248_10557653 Ga0105248_105576532 190
54 3300013100 Ga0157373_10072813 Ga0157373_100728132 190
55 3300025263 Ga0209565_1000035 Ga0209565_1000035106 190
56 3300025273 Ga0209673_1000006 Ga0209673_1000006196 190
57 3300025291 Ga0209675_1000005 Ga0209675_1000005576 190
58 3300025295 Ga0209564_1000008 Ga0209564_1000008391 190
59 3300025295 Ga0209564_1000083 Ga0209564_100008360 190
60 3300025299 Ga0209256_1000141 Ga0209256_100014152 190
61 3300025909 Ga0207705_10824865 Ga0207705_108248652 190
62 3300025912 Ga0207707_10849908 Ga0207707_108499082 190
63 3300025921 Ga0207652_10212027 Ga0207652_102120272 190
64 3300025933 Ga0207706_10455951 Ga0207706_104559512 190
65 3300025941 Ga0207711_10536270 Ga0207711_105362702 190
66 3300025945 Ga0207679_10169937 Ga0207679_101699372 190
67 3300025986 Ga0207658_10143201 Ga0207658_101432013 190
68 3300026088 Ga0207641_10356161 Ga0207641_103561612 190
69 3300026118 Ga0207675_100312903 Ga0207675_1003129032 190
70 3300031548 Ga0307408_100803058 Ga0307408_1008030581 190
71 3300032004 Ga0307414_10824003 Ga0307414_108240032 190
72 3300039447 Ga0436361_0441007 Ga0436361_0441007_25650_26267 190
73 3300039447 Ga0436361_0698556 Ga0436361_0698556_9822_10439 190
74 3300046453 Ga0495627_011242 Ga0495627_011242_2545_3165 190
75 3300046453 Ga0495627_018059 Ga0495627_018059_691_1272 190
76 3300046471 Ga0495650_0000133 Ga0495650_0000133_53121_53705 190
77 3300046512 Ga0495610_0025268 Ga0495610_0025268_2271_2855 190
78 3300046522 Ga0495643_0000318 Ga0495643_0000318_48860_49444 190
79 3300046522 Ga0495643_0202968 Ga0495643_0202968_265_849 190
80 3300046524 Ga0495648_0036444 Ga0495648_0036444_2172_2756 190
81 3300046538 Ga0495609_0015695 Ga0495609_0015695_2462_3046 190
82 3300046660 Ga0495625_0032918 Ga0495625_0032918_471_1055 190
83 3300046692 Ga0495671_0204716 Ga0495671_0204716_137_757 190
84 3300046694 Ga0495649_0001619 Ga0495649_0001619_13397_13981 190
85 3300046694 Ga0495649_0063626 Ga0495649_0063626_815_1390 190
86 3300046810 Ga0495660_0253629 Ga0495660_0253629_163_747 190
87 3300047320 Ga0495672_0000944 Ga0495672_0000944_5934_6518 190
88 3300047323 Ga0495683_0036308 Ga0495683_0036308_1144_1728 190
89 3300048919 Ga0496116_0072670 Ga0496116_0072670_1258_1866 190
90 3300048925 Ga0496122_0075485 Ga0496122_0075485_361_981 190
91 3300049459 Ga0495678_003411 Ga0495678_003411_2499_3083 190
92 3300049459 Ga0495678_003447 Ga0495678_003447_6614_7198 190
93 3300049568 Ga0501031_0008105 Ga0501031_0008105_2395_2991 190
94 3300049568 Ga0501031_0019255 Ga0501031_0019255_2298_2891 190
95 3300049569 Ga0501032_0000588 Ga0501032_0000588_14680_15273 190
96 3300049569 Ga0501032_0158472 Ga0501032_0158472_586_1179 190
97 3300049570 Ga0501033_0014282 Ga0501033_0014282_5404_6000 190
98 3300049570 Ga0501033_0015115 Ga0501033_0015115_4317_4910 190
99 3300049570 Ga0501033_0115943 Ga0501033_0115943_671_1267 190
100 3300049571 Ga0501034_0000844 Ga0501034_0000844_2783_3376 190
101 3300049572 Ga0501036_0001286 Ga0501036_0001286_2783_3376 190
102 3300049572 Ga0501036_0005166 Ga0501036_0005166_1873_2469 190
103 3300049572 Ga0501036_0026932 Ga0501036_0026932_1015_1611 190
104 3300049573 Ga0501037_0007634 Ga0501037_0007634_1818_2411 190
105 3300049573 Ga0501037_0044733 Ga0501037_0044733_1311_1907 190
106 3300049574 Ga0501038_0264117 Ga0501038_0264117_459_1055 190
107 3300049575 Ga0501039_0033590 Ga0501039_0033590_1570_2166 190
108 3300049576 Ga0501040_0019487 Ga0501040_0019487_1234_1827 190
109 3300049578 Ga0501042_0061499 Ga0501042_0061499_455_1048 190
110 3300049579 Ga0501043_0014613 Ga0501043_0014613_2771_3364 190
111 3300049579 Ga0501043_0054642 Ga0501043_0054642_1280_1876 190
112 3300049579 Ga0501043_0066893 Ga0501043_0066893_193_789 190
113 3300049579 Ga0501043_0138859 Ga0501043_0138859_680_1276 190
114 3300049580 Ga0501046_0004594 Ga0501046_0004594_9195_9788 190
115 3300049580 Ga0501046_0013874 Ga0501046_0013874_5472_6068 190
116 3300049581 Ga0501047_0002699 Ga0501047_0002699_2783_3376 190
117 3300049581 Ga0501047_0172714 Ga0501047_0172714_245_841 190
118 3300049582 Ga0501048_0013798 Ga0501048_0013798_4011_4604 190
119 3300049584 Ga0501068_0181607 Ga0501068_0181607_560_1153 190
120 3300049656 Ga0501209_000027 Ga0501209_000027_13535_14116 190
121 3300049822 Ga0501035_0003981 Ga0501035_0003981_12112_12705 190
122 3300049822 Ga0501035_0005295 Ga0501035_0005295_6388_6984 190
123 3300049822 Ga0501035_0027247 Ga0501035_0027247_2805_3401 190
124 3300049822 Ga0501035_0221980 Ga0501035_0221980_264_857 190
125 3300049823 Ga0501044_0000111 Ga0501044_0000111_63_659 190
126 3300049823 Ga0501044_0002722 Ga0501044_0002722_14022_14615 190
127 3300049823 Ga0501044_0006145 Ga0501044_0006145_6095_6691 190
128 3300049823 Ga0501044_0006735 Ga0501044_0006735_8657_9253 190
129 3300050489 nmdc:mga03683_3239_c1 nmdc:mga03683_3239_c1_4505_5125 190
130 3300050493 nmdc:mga0k408_5217_c1 nmdc:mga0k408_5217_c1_1452_2072 190
131 iso_pu_bacteria 2881101125 2881102620 190
132 3300006852 Ga0075433_10325017 Ga0075433_103250172 191
133 3300007076 Ga0075435_100059630 Ga0075435_1000596302 191
134 3300025939 Ga0207665_10010762 Ga0207665_100107628 191
135 3300046474 Ga0495605_0142225 Ga0495605_0142225_156_749 191
136 3300046500 Ga0495596_0197857 Ga0495596_0197857_46_639 191
137 3300046518 Ga0495631_0067040 Ga0495631_0067040_57_650 191
138 3300046528 Ga0495642_0044430 Ga0495642_0044430_24_617 191
139 3300046538 Ga0495609_0066797 Ga0495609_0066797_963_1556 191
140 3300046542 Ga0495597_0009785 Ga0495597_0009785_693_1286 191
141 3300046542 Ga0495597_0124549 Ga0495597_0124549_69_662 191
142 3300046558 Ga0495633_0128077 Ga0495633_0128077_444_1037 191
143 3300046665 Ga0495661_0150393 Ga0495661_0150393_363_956 191
144 3300046692 Ga0495671_0059840 Ga0495671_0059840_163_756 191
145 3300047470 Ga0495681_0083141 Ga0495681_0083141_14_607 191
146 3300048091 Ga0495626_0003592 Ga0495626_0003592_6979_7572 191
147 3300048918 Ga0496115_0010117 Ga0496115_0010117_4194_4787 191
148 3300048929 Ga0496126_0020553 Ga0496126_0020553_186_773 191
149 3300050513 nmdc:mga0rr50_83908_c1 nmdc:mga0rr50_83908_c1_1716_2312 191
150 3300050515 nmdc:mga0a205_46663_c1 nmdc:mga0a205_46663_c1_3221_3817 191
151 iso_pu_bacteria 2886848708 2886849897 191
152 3300005288 Ga0065714_10105564 Ga0065714_101055642 192
153 3300005293 Ga0065715_10138857 Ga0065715_101388572 192
154 3300005436 Ga0070713_100000266 Ga0070713_10000026629 192
155 3300005439 Ga0070711_100413144 Ga0070711_1004131441 192
156 3300006038 Ga0075365_10751368 Ga0075365_107513681 192
157 3300014497 Ga0182008_10003510 Ga0182008_1000351011 192
158 3300015261 Ga0182006_1148632 Ga0182006_11486322 192
159 3300021361 Ga0213872_10242618 Ga0213872_102426181 192
160 3300025928 Ga0207700_10001736 Ga0207700_100017363 192
161 3300039447 Ga0436361_0483803 Ga0436361_0483803_702_1295 192
162 3300046474 Ga0495605_0000010 Ga0495605_0000010_5856_6449 192
163 3300046506 Ga0495583_0007646 Ga0495583_0007646_4319_4915 192
164 3300046528 Ga0495642_0096464 Ga0495642_0096464_511_1107 192
165 3300046531 Ga0495665_0034954 Ga0495665_0034954_1427_2026 192
166 3300046535 Ga0495586_0060720 Ga0495586_0060720_480_1079 192
167 3300046557 Ga0495622_0036048 Ga0495622_0036048_561_1160 192
168 3300046663 Ga0495635_0207740 Ga0495635_0207740_204_803 192
169 3300047318 Ga0495636_0018894 Ga0495636_0018894_1754_2350 192
170 3300047321 Ga0495676_0369510 Ga0495676_0369510_228_827 192
171 3300048905 Ga0496102_0029914 Ga0496102_0029914_3538_4134 192
172 3300048906 Ga0496103_0001612 Ga0496103_0001612_5984_6574 192
173 3300048928 Ga0496125_0034938 Ga0496125_0034938_2500_3117 192
174 3300049679 Ga0501249_007116 Ga0501249_007116_786_1376 192
175 3300049766 Ga0501269_000066 Ga0501269_000066_18000_18590 192
176 3300053085 Ga0495619_0092277 Ga0495619_0092277_1270_1893 192
177 iso_pu_bacteria 2643221628 2644161730 192
178 3300003215 JGI25153J46596_10047024 JGI25153J46596_100470241 193
179 3300003771 Ga0055526_1000135 Ga0055526_100013565 193
180 3300005331 Ga0070670_100007479 Ga0070670_1000074799 193
181 3300005331 Ga0070670_100283213 Ga0070670_1002832132 193
182 3300005347 Ga0070668_100058253 Ga0070668_1000582532 193
183 3300005353 Ga0070669_100055415 Ga0070669_1000554152 193
184 3300005354 Ga0070675_100023567 Ga0070675_1000235677 193
185 3300005355 Ga0070671_100114890 Ga0070671_1001148904 193
186 3300005364 Ga0070673_100052396 Ga0070673_1000523964 193
187 3300005367 Ga0070667_100591538 Ga0070667_1005915382 193
188 3300005456 Ga0070678_100513800 Ga0070678_1005138002 193
189 3300005457 Ga0070662_100119391 Ga0070662_1001193912 193
190 3300005459 Ga0068867_100317853 Ga0068867_1003178532 193
191 3300005543 Ga0070672_100078372 Ga0070672_1000783724 193
192 3300005564 Ga0070664_100198962 Ga0070664_1001989622 193
193 3300005616 Ga0068852_100608119 Ga0068852_1006081192 193
194 3300005618 Ga0068864_100003116 Ga0068864_10000311610 193
195 3300005618 Ga0068864_100024778 Ga0068864_1000247785 193
196 3300005618 Ga0068864_100129101 Ga0068864_1001291014 193
197 3300005719 Ga0068861_100120413 Ga0068861_1001204134 193
198 3300005841 Ga0068863_100007332 Ga0068863_1000073326 193
199 3300005841 Ga0068863_100105310 Ga0068863_1001053104 193
200 3300005841 Ga0068863_100525808 Ga0068863_1005258082 193
201 3300006844 Ga0075428_100103780 Ga0075428_1001037802 193
202 3300007076 Ga0075435_100195913 Ga0075435_1001959132 193
203 3300009177 Ga0105248_10267508 Ga0105248_102675083 193
204 3300013308 Ga0157375_10076591 Ga0157375_100765913 193
205 3300014325 Ga0163163_10003666 Ga0163163_100036669 193
206 3300014326 Ga0157380_10141995 Ga0157380_101419952 193
207 3300014969 Ga0157376_10323117 Ga0157376_103231172 193
208 3300025294 Ga0209025_1002422 Ga0209025_10024224 193
209 3300025295 Ga0209564_1000493 Ga0209564_10004934 193
210 3300025297 Ga0209758_1000278 Ga0209758_1000278101 193
211 3300025923 Ga0207681_10012025 Ga0207681_100120256 193
212 3300025925 Ga0207650_10206121 Ga0207650_102061212 193
213 3300025931 Ga0207644_10275559 Ga0207644_102755592 193
214 3300025933 Ga0207706_10051249 Ga0207706_100512493 193
215 3300025940 Ga0207691_10002059 Ga0207691_1000205921 193
216 3300025960 Ga0207651_10017566 Ga0207651_100175664 193
217 3300025972 Ga0207668_10014157 Ga0207668_100141576 193
218 3300025986 Ga0207658_10178630 Ga0207658_101786304 193
219 3300026088 Ga0207641_10012354 Ga0207641_100123543 193
220 3300026088 Ga0207641_10150491 Ga0207641_101504913 193
221 3300026089 Ga0207648_10086035 Ga0207648_100860352 193
222 3300026095 Ga0207676_10000809 Ga0207676_100008099 193
223 3300026095 Ga0207676_10025446 Ga0207676_100254465 193
224 3300026095 Ga0207676_10070872 Ga0207676_100708724 193
225 3300026118 Ga0207675_100102496 Ga0207675_1001024964 193
226 3300026121 Ga0207683_10177790 Ga0207683_101777902 193
227 3300028379 Ga0268266_10120896 Ga0268266_101208962 193
228 3300031235 Ga0265330_10002590 Ga0265330_100025903 193
229 3300031238 Ga0265332_10000365 Ga0265332_100003656 193
230 3300031239 Ga0265328_10008612 Ga0265328_100086122 193
231 3300031241 Ga0265325_10003625 Ga0265325_100036256 193
232 3300031242 Ga0265329_10003951 Ga0265329_100039516 193
233 3300031250 Ga0265331_10000588 Ga0265331_1000058820 193
234 3300031250 Ga0265331_10002911 Ga0265331_100029113 193
235 3300031251 Ga0265327_10000042 Ga0265327_10000042272 193
236 3300031251 Ga0265327_10001246 Ga0265327_1000124617 193
237 3300031344 Ga0265316_10010812 Ga0265316_100108129 193
238 3300031711 Ga0265314_10004338 Ga0265314_100043387 193
239 3300031712 Ga0265342_10003581 Ga0265342_1000358110 193
240 3300041463 Ga0451804_0834910 Ga0451804_0834910_66_686 193
241 3300041509 Ga0451843_0651635 Ga0451843_0651635_212_808 193
242 3300041512 Ga0451853_2147470 Ga0451853_2147470_232_852 193
243 3300044656 Ga0466969_0010533 Ga0466969_0010533_2621_3211 193
244 3300044684 Ga0466966_0005021 Ga0466966_0005021_7688_8293 193
245 3300044684 Ga0466966_0005834 Ga0466966_0005834_3528_4118 193
246 3300044693 Ga0466961_0024698 Ga0466961_0024698_1626_2231 193
247 3300044693 Ga0466961_0030995 Ga0466961_0030995_1023_1613 193
248 3300044693 Ga0466961_0269775 Ga0466961_0269775_296_898 193
249 3300044706 Ga0466964_0018962 Ga0466964_0018962_1894_2499 193
250 3300044765 Ga0466970_0010270 Ga0466970_0010270_1897_2502 193
251 3300045049 Ga0466959_0004338 Ga0466959_0004338_77_667 193
252 3300045836 Ga0466958_0402628 Ga0466958_0402628_227_829 193
253 3300046501 Ga0495607_0011950 Ga0495607_0011950_4039_4638 193
254 3300046507 Ga0495606_0000542 Ga0495606_0000542_4450_5049 193
255 3300046522 Ga0495643_0064805 Ga0495643_0064805_679_1281 193
256 3300046538 Ga0495609_0030057 Ga0495609_0030057_1677_2276 193
257 3300047443 Ga0495687_000931 Ga0495687_000931_5298_5897 193
258 3300047443 Ga0495687_004928 Ga0495687_004928_4425_5024 193
259 3300048090 Ga0495615_0031459 Ga0495615_0031459_198_800 193
260 3300048911 Ga0496108_0242127 Ga0496108_0242127_892_1512 193
261 3300048912 Ga0496109_0441783 Ga0496109_0441783_331_951 193
262 3300048915 Ga0496112_0025517 Ga0496112_0025517_3914_4534 193
263 3300048925 Ga0496122_0000331 Ga0496122_0000331_96123_96719 193
264 3300048926 Ga0496123_0001132 Ga0496123_0001132_6800_7396 193
265 3300050494 nmdc:mga06z11_349077_c1 nmdc:mga06z11_349077_c1_283_867 193
266 3300050513 nmdc:mga0rr50_185930_c1 nmdc:mga0rr50_185930_c1_568_1161 193
267 3300053136 Ga0500559_0040014 Ga0500559_0040014_690_1286 193
268 3300053136 Ga0500559_0082107 Ga0500559_0082107_697_1293 193
269 iso_pu_bacteria 2513020051 2513230636 193
270 iso_pu_bacteria 2643221672 2644399726 193
271 iso_pu_bacteria 2738541307 2738880634 193
272 iso_pu_bacteria 2831265667 2831269211 193
273 iso_pu_bacteria 2831864461 2831869382 193
274 iso_pu_bacteria 2838054893 2838059185 193
275 iso_pu_bacteria 2842677519 2842679700 193
276 iso_pu_bacteria 2904449895 2904452570 193
277 iso_pu_bacteria 2904456579 2904460831 193
278 iso_pu_bacteria 2904541872 2904545285 193
279 iso_pu_bacteria 2919462493 2919463799 193
280 iso_pu_bacteria 2928084124 2928088552 193
281 iso_pu_bacteria 2929160207 2929165477 193
282 iso_pu_bacteria 2929520902 2929522522 193
283 iso_pu_bacteria 2945909444 2945909850 193
284 3300005366 Ga0070659_100833758 Ga0070659_1008337581 194
285 3300005548 Ga0070665_100013363 Ga0070665_1000133639 194
286 3300005563 Ga0068855_100132953 Ga0068855_1001329533 194
287 3300005985 Ga0081539_10070393 Ga0081539_100703932 194
288 3300014326 Ga0157380_11387273 Ga0157380_113872732 194
289 3300025909 Ga0207705_10225352 Ga0207705_102253522 194
290 3300025932 Ga0207690_10621946 Ga0207690_106219462 194
291 3300025942 Ga0207689_10083549 Ga0207689_100835492 194
292 3300026023 Ga0207677_10062403 Ga0207677_100624033 194
293 3300028379 Ga0268266_10019737 Ga0268266_100197372 194
294 3300037418 Ga0395900_0118452 Ga0395900_0118452_1428_2027 194
295 3300037466 Ga0395898_0040954 Ga0395898_0040954_3394_3993 194
296 3300037471 Ga0395905_0000672 Ga0395905_0000672_38782_39369 194
297 3300037471 Ga0395905_0178158 Ga0395905_0178158_641_1234 194
298 3300037471 Ga0395905_0743539 Ga0395905_0743539_150_749 194
299 3300038443 Ga0395901_0018816 Ga0395901_0018816_1275_1874 194
300 3300042014 Ga0439457_036092 Ga0439457_036092_141_749 194
301 3300042435 Ga0439434_0026869 Ga0439434_0026869_453_1061 194
302 3300044694 Ga0466963_0139677 Ga0466963_0139677_488_1072 194
303 iso_pu_bacteria 2885192300 2885193009 194
304 3300003323 rootH1_10113865 rootH1_101138652 195
305 3300003773 Ga0055537_1000049 Ga0055537_100004989 195
306 3300003775 Ga0055524_1027017 Ga0055524_10270172 195
307 3300003775 Ga0055524_1027776 Ga0055524_10277762 195
308 3300003784 Ga0055534_1000049 Ga0055534_100004911 195
309 3300003790 Ga0055528_1000357 Ga0055528_100035711 195
310 3300003790 Ga0055528_1023739 Ga0055528_10237392 195
311 3300003792 Ga0055540_1026626 Ga0055540_10266262 195
312 3300003794 Ga0055531_10024709 Ga0055531_100247092 195
313 3300003794 Ga0055531_10049325 Ga0055531_100493251 195
314 3300005262 Ga0065165_1000016 Ga0065165_1000016153 195
315 3300006048 Ga0075363_100025921 Ga0075363_1000259212 195
316 3300006051 Ga0075364_10114356 Ga0075364_101143562 195
317 3300006177 Ga0075362_10018463 Ga0075362_100184633 195
318 3300006195 Ga0075366_10035898 Ga0075366_100358982 195
319 3300006353 Ga0075370_10000954 Ga0075370_100009542 195
320 3300006353 Ga0075370_10009650 Ga0075370_100096502 195
321 3300006353 Ga0075370_10294577 Ga0075370_102945772 195
322 3300006944 Ga0099823_1000101 Ga0099823_100010118 195
323 3300006946 Ga0079104_1014502 Ga0079104_10145022 195
324 3300006948 Ga0099826_10003969 Ga0099826_100039699 195
325 3300006948 Ga0099826_10138236 Ga0099826_101382362 195
326 3300012475 Ga0157317_1000252 Ga0157317_10002522 195
327 3300012497 Ga0157319_1000015 Ga0157319_1000015125 195
328 3300017792 Ga0163161_10008385 Ga0163161_100083858 195
329 3300025242 Ga0209258_104510 Ga0209258_1045102 195
330 3300025263 Ga0209565_1000020 Ga0209565_1000020317 195
331 3300025273 Ga0209673_1000295 Ga0209673_100029511 195
332 3300025273 Ga0209673_1010195 Ga0209673_10101954 195
333 3300025273 Ga0209673_1010225 Ga0209673_10102253 195
334 3300025291 Ga0209675_1000014 Ga0209675_1000014306 195
335 3300025294 Ga0209025_1008203 Ga0209025_100820311 195
336 3300025297 Ga0209758_1050209 Ga0209758_10502092 195
337 3300025298 Ga0209050_1006258 Ga0209050_10062584 195
338 3300025299 Ga0209256_1000424 Ga0209256_10004242 195
339 3300025299 Ga0209256_1001222 Ga0209256_100122222 195
340 3300025299 Ga0209256_1028678 Ga0209256_10286782 195
341 3300025303 Ga0209051_1001113 Ga0209051_100111316 195
342 3300025303 Ga0209051_1047257 Ga0209051_10472573 195
343 3300025304 Ga0209257_1002253 Ga0209257_100225311 195
344 3300025304 Ga0209257_1003886 Ga0209257_100388612 195
345 3300027296 Ga0209389_1001650 Ga0209389_100165014 195
346 3300027312 Ga0209371_1028996 Ga0209371_10289962 195
347 3300027666 Ga0209282_1000587 Ga0209282_10005874 195
348 3300030500 Ga0268256_1021107 Ga0268256_10211072 195
349 3300031548 Ga0307408_100022103 Ga0307408_1000221033 195
350 3300031548 Ga0307408_100089404 Ga0307408_1000894042 195
351 3300031731 Ga0307405_10244850 Ga0307405_102448502 195
352 3300031731 Ga0307405_10993528 Ga0307405_109935281 195
353 3300032002 Ga0307416_101369960 Ga0307416_1013699601 195
354 3300032004 Ga0307414_10318113 Ga0307414_103181131 195
355 3300032004 Ga0307414_10422686 Ga0307414_104226862 195
356 3300032004 Ga0307414_10495241 Ga0307414_104952412 195
357 3300041404 Ga0439436_0000228 Ga0439436_0000228_10088_10702 195
358 3300041407 Ga0439447_019305 Ga0439447_019305_749_1363 195
359 3300041410 Ga0439461_0003902 Ga0439461_0003902_1473_2087 195
360 3300041411 Ga0439466_0004686 Ga0439466_0004686_316_930 195
361 3300041413 Ga0439465_0000179 Ga0439465_0000179_5143_5757 195
362 3300041997 Ga0439431_0013407 Ga0439431_0013407_625_1239 195
363 3300041999 Ga0439433_0000297 Ga0439433_0000297_1558_2172 195
364 3300042002 Ga0439442_002165 Ga0439442_002165_1465_2079 195
365 3300042002 Ga0439442_007988 Ga0439442_007988_834_1445 195
366 3300042006 Ga0439432_000674 Ga0439432_000674_6896_7510 195
367 3300042007 Ga0439449_0024984 Ga0439449_0024984_667_1281 195
368 3300042010 Ga0439452_001146 Ga0439452_001146_4144_4758 195
369 3300042014 Ga0439457_005934 Ga0439457_005934_1155_1769 195
370 3300042015 Ga0439462_0003260 Ga0439462_0003260_931_1545 195
371 3300042123 Ga0450921_000103 Ga0450921_000103_1439_2050 195
372 3300042125 Ga0450923_016019 Ga0450923_016019_536_1147 195
373 3300042127 Ga0450890_000932 Ga0450890_000932_2497_3114 195
374 3300042127 Ga0450890_008087 Ga0450890_008087_325_936 195
375 3300042133 Ga0450896_012249 Ga0450896_012249_448_1059 195
376 3300042145 Ga0450906_001450 Ga0450906_001450_1996_2607 195
377 3300042147 Ga0450910_041875 Ga0450910_041875_79_690 195
378 3300042156 Ga0439446_0007142 Ga0439446_0007142_1665_2279 195
379 3300042156 Ga0439446_0066721 Ga0439446_0066721_86_697 195
380 3300042185 Ga0450909_020442 Ga0450909_020442_19_630 195
381 3300042435 Ga0439434_0002846 Ga0439434_0002846_4177_4788 195
382 3300042435 Ga0439434_0013944 Ga0439434_0013944_1654_2268 195
383 3300042531 Ga0450918_000471 Ga0450918_000471_3546_4157 195
384 3300042532 Ga0450893_0008044 Ga0450893_0008044_717_1328 195
385 3300046660 Ga0495625_0000045 Ga0495625_0000045_89484_90095 195
386 3300048925 Ga0496122_0404539 Ga0496122_0404539_12_650 195
387 3300050491 nmdc:mga00v17_162759_c1 nmdc:mga00v17_162759_c1_498_1109 195
388 3300050493 nmdc:mga0k408_145493_c1 nmdc:mga0k408_145493_c1_211_828 195
389 3300050496 nmdc:mga07m45_13979_c1 nmdc:mga07m45_13979_c1_105_716 195
390 3300050496 nmdc:mga07m45_17999_c1 nmdc:mga07m45_17999_c1_2857_3474 195
391 3300013306 Ga0163162_10839940 Ga0163162_108399402 196
392 3300025273 Ga0209673_1076549 Ga0209673_10765492 196
393 3300025299 Ga0209256_1041506 Ga0209256_10415062 196
394 3300044673 Ga0453683_0182205 Ga0453683_0182205_244_840 196
395 3300050489 nmdc:mga03683_19456_c1 nmdc:mga03683_19456_c1_1419_2033 196
396 3300050491 nmdc:mga00v17_228052_c1 nmdc:mga00v17_228052_c1_560_1174 196
397 3300050492 nmdc:mga0yw44_3869_c1 nmdc:mga0yw44_3869_c1_17_631 196
398 3300012502 Ga0157347_1001809 Ga0157347_10018092 197
399 3300030522 Ga0307512_10217478 Ga0307512_102174781 197
400 3300046453 Ga0495627_006803 Ga0495627_006803_608_1213 197
401 3300046520 Ga0495637_0005370 Ga0495637_0005370_1703_2308 197
402 3300046558 Ga0495633_0214070 Ga0495633_0214070_163_768 197
403 3300046665 Ga0495661_0077479 Ga0495661_0077479_460_1065 197
404 3300046674 Ga0495588_0015029 Ga0495588_0015029_915_1520 197
405 3300046691 Ga0495670_0193591 Ga0495670_0193591_97_702 197
406 3300046692 Ga0495671_0025022 Ga0495671_0025022_363_968 197
407 3300046810 Ga0495660_0089134 Ga0495660_0089134_628_1233 197
408 3300050490 nmdc:mga03n38_47788_c1 nmdc:mga03n38_47788_c1_148_762 197
409 3300053079 Ga0500610_0002892 Ga0500610_0002892_2923_3528 197
410 3300053079 Ga0500610_0003622 Ga0500610_0003622_5126_5731 197
411 3300053087 Ga0500643_032092 Ga0500643_032092_398_1003 197
412 3300053117 Ga0500593_000088 Ga0500593_000088_4406_5011 197
413 3300053121 Ga0500607_036363 Ga0500607_036363_1576_2181 197
414 3300053130 Ga0500642_0086554 Ga0500642_0086554_19_624 197
415 3300053158 Ga0500627_0007585 Ga0500627_0007585_1559_2164 197
416 3300053161 Ga0500634_0037319 Ga0500634_0037319_829_1434 197
417 3300053730 Ga0500645_111979 Ga0500645_111979_132_737 197
418 3300002987 JGI25159J45721_1024625 JGI25159J45721_10246251 198
419 3300003784 Ga0055534_1003010 Ga0055534_10030105 198
420 3300003794 Ga0055531_10068806 Ga0055531_100688061 198
421 3300005262 Ga0065165_1029330 Ga0065165_10293302 198
422 3300025273 Ga0209673_1043613 Ga0209673_10436132 198
423 3300025284 Ga0209130_1017734 Ga0209130_10177342 198
424 3300025291 Ga0209675_1006340 Ga0209675_10063405 198
425 3300025292 Ga0209676_1012489 Ga0209676_10124894 198
426 3300025303 Ga0209051_1046565 Ga0209051_10465652 198
427 3300025304 Ga0209257_1083735 Ga0209257_10837352 198

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02630

SCO1-SenC

SCO1/SenC

52

186

0.98

PF00578

AhpC-TSA

AhpC/TSA family

49

189

0.9

PF08534

Redoxin

Redoxin

33

205

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6n5u-assembly3.cif.gz_C crystal structure of arabidopsis thaliana scoi with copper bound 0.9022 43 196
1wp0-assembly1.cif.gz_A human sco1 0.8992 43 193
4wbr-assembly1.cif.gz_D structure of bradyrhizobium japonicum scoi with copper bound 0.8897 43 194
2gt6-assembly1.cif.gz_A solution structure of human cu(i) sco1 0.8825 36 196
2b7j-assembly4.cif.gz_D crystal structure of yeast sco1 with copper bound 0.8782 43 197
ID Description Score Start End Superfamily
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9069 43 193 3.40.30.10
af_K7MTL0_161_316_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9043 56 196 3.40.30.10
af_Q4D9Q9_96_284_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.878 43 196 3.40.30.10
4txoH00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8681 43 194 3.40.30.10
af_Q54TT7_154_312_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8587 43 193 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A4Q3UX82-F1-model_v4 SCO family protein 0.9903 54 196 GO:0046872
AF-A0A4Q3JSY0-F1-model_v4 deleted 0.9822 29 194
AF-A0A127P773-F1-model_v4 AhpC/TSA family protein 0.9773 28 195 GO:0046872
AF-A0A4S1E6Z8-F1-model_v4 SCO family protein 0.9713 18 197 GO:0046872
AF-A0A2R5EN75-F1-model_v4 Lipoprotein 0.9675 29 196 GO:0046872

Feature Viewer

pLDDT pTM Quality
90.67 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map