F441486

General Info

Members Datasets Scaffolds Average Seq Length
427 290 854 336

Family's Representative Sequence

Representative Sequence 3300033544|Ga0316215_1000850|Ga0316215_10008502
Length 335
Sequence MQLGMIGLGRMGGNIVRRLMKHGHTTVVYDKDPKAVAALAADGAAGAKALEDFIKTLEKPRTAWVMLPAGKITEATIEALAKLMESGDVIIDGGNTFWQDDVRRGKALKERGIHYLDVGTSGGVWGIERGYCMMIGGDKAVVDRLNPIFAALAPGIGDIPRTPGREEGRDPRIEQGYIHAGPVGAGHFVKMIHNGIEYGLMQAYAEGFDILNNANIEALPPDHRFDLNIADIAEVWRRGSVIPSWLLDLTASALAKNPTLASYSGFVEDSGEGRWTVNAAIDEAVPAEVLTAALFARFRSRKDHTFAERILSAMRDGFGGHKEPQPSATNVASKV

Samples

Sample ID Description Type Environment
1 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
51 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
52 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
53 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
54 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
113 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
114 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
120 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
133 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
134 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
135 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
149 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
150 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
151 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
179 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
180 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
181 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
182 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
197 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
201 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
218 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
243 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
252 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
255 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
256 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
257 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
258 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
259 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
260 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
261 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
262 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
263 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
264 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
265 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
266 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
267 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
268 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
269 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 2508501050 Microvirga lupini Lut6 Isolate Nodule
272 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
273 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
274 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
275 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
276 2734482264 Dyella sp. AD052 Isolate Unclassified
277 2738543009 Luteibacter sp. OK325 Isolate Unclassified
278 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
279 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
280 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
281 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
282 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
283 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
284 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
285 2919085039 Luteibacter sp. 1214 Isolate Unclassified
286 2919404418 Luteibacter sp. 3190 Isolate Unclassified
287 2941471342 Luteibacter sp. 621 Isolate Unclassified
288 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
289 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
290 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.32
Metatranscriptomes 0
Isolates 4.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.37
Nodule 0.47
Rhizoplane 1.64
Rhizosphere 76.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316215_1000850 3300033544 Bacteria 3034
2 JGI24738J21930_10000944 3300002075 Bacteria 8346
3 Ga0065165_1000113 3300005262 Bacteria 135963
4 Ga0070683_100028648 3300005329 Bacteria 5035
5 Ga0070666_10000012 3300005335 Bacteria 244720
6 Ga0070680_100055436 3300005336 Bacteria 3239
7 Ga0070660_100048270 3300005339 Bacteria 3269
8 Ga0070709_10000372 3300005434 Bacteria 27588
9 Ga0070714_100048275 3300005435 Bacteria 3620
10 Ga0070714_100109327 3300005435 Bacteria 2445
11 Ga0070713_100004487 3300005436 Bacteria 9385
12 Ga0070713_100053992 3300005436 Bacteria 3331
13 Ga0070710_10000509 3300005437 Bacteria 18274
14 Ga0070711_100008047 3300005439 Bacteria 6436
15 Ga0070711_100022579 3300005439 Bacteria 4080
16 Ga0070708_100000786 3300005445 Bacteria 23908
17 Ga0070708_100037281 3300005445 Bacteria 4240
18 Ga0070706_100007601 3300005467 Bacteria 10143
19 Ga0070698_100006803 3300005471 Bacteria 12397
20 Ga0070699_100030203 3300005518 Bacteria 4678
21 Ga0070679_100013347 3300005530 Bacteria 7866
22 Ga0070679_100207739 3300005530 Bacteria 1922
23 Ga0070684_100048429 3300005535 Bacteria 3687
24 Ga0070697_100000316 3300005536 Bacteria 38384
25 Ga0070697_100026563 3300005536 Bacteria 4627
26 Ga0070697_100119970 3300005536 Bacteria 2199
27 Ga0070665_100067490 3300005548 Bacteria 3586
28 Ga0068855_100561337 3300005563 Bacteria 1235
29 Ga0068857_100004229 3300005577 Bacteria 12096
30 Ga0068859_100476562 3300005617 Bacteria 1343
31 Ga0068851_10096131 3300005834 Bacteria 1566
32 Ga0068863_100083571 3300005841 Bacteria 3025
33 Ga0068860_100194934 3300005843 Bacteria 1961
34 Ga0070717_10019227 3300006028 Bacteria 5354
35 Ga0070715_10015179 3300006163 Bacteria 2867
36 Ga0070716_100042867 3300006173 Bacteria 2528
37 Ga0070716_100175674 3300006173 Bacteria 1401
38 Ga0070712_100112952 3300006175 Bacteria 2030
39 Ga0075367_10005099 3300006178 Bacteria 6483
40 Ga0075369_10003780 3300006186 Bacteria 5539
41 Ga0075433_10093869 3300006852 Bacteria 2655
42 Ga0075436_100211089 3300006914 Bacteria 1376
43 Ga0097620_100476573 3300006931 Bacteria 1343
44 Ga0099794_10076880 3300007265 Bacteria 1641
45 Ga0105240_10277701 3300009093 Bacteria 1926
46 Ga0105247_10003378 3300009101 Bacteria 10435
47 Ga0105237_10007103 3300009545 Bacteria 12305
48 Ga0105238_10000540 3300009551 Bacteria 39588
49 Ga0105238_10024764 3300009551 Bacteria 6116
50 Ga0105238_10056518 3300009551 Bacteria 3937
51 Ga0157370_10000278 3300013104 Bacteria 64936
52 Ga0157372_10167002 3300013307 Bacteria 2545
53 Ga0157375_10348219 3300013308 Bacteria 1647
54 Ga0182008_10032257 3300014497 Bacteria 2632
55 Ga0157379_10346369 3300014968 Bacteria 1360
56 Ga0182006_1000223 3300015261 Bacteria 55257
57 Ga0182006_1000883 3300015261 Bacteria 20147
58 Ga0182007_10005058 3300015262 Bacteria 5856
59 Ga0182005_1000228 3300015265 Bacteria 36744
60 Ga0182005_1000488 3300015265 Bacteria 20452
61 Ga0163161_10018592 3300017792 Bacteria 4869
62 Ga0213873_10005865 3300021358 Bacteria 2383
63 Ga0213874_10018568 3300021377 Bacteria 1881
64 Ga0213876_10000797 3300021384 Bacteria 21401
65 Ga0213875_10031157 3300021388 Bacteria 2524
66 Ga0209437_101370 3300025233 Bacteria 6221
67 Ga0209148_1001464 3300025254 Bacteria 11915
68 Ga0209129_1001620 3300025258 Bacteria 12205
69 Ga0209256_1006588 3300025299 Bacteria 6079
70 Ga0209051_1013798 3300025303 Bacteria 3814
71 Ga0207692_10001401 3300025898 Bacteria 9021
72 Ga0207692_10010595 3300025898 Bacteria 3891
73 Ga0207680_10000013 3300025903 Bacteria 244716
74 Ga0207685_10042668 3300025905 Bacteria 1705
75 Ga0207699_10000245 3300025906 Bacteria 30434
76 Ga0207699_10020729 3300025906 Bacteria 3529
77 Ga0207699_10098112 3300025906 Bacteria 1853
78 Ga0207705_10028982 3300025909 Bacteria 3948
79 Ga0207684_10000901 3300025910 Bacteria 33793
80 Ga0207684_10043786 3300025910 Bacteria 3796
81 Ga0207707_10129897 3300025912 Bacteria 2204
82 Ga0207707_10181885 3300025912 Bacteria 1835
83 Ga0207671_10028210 3300025914 Bacteria 4196
84 Ga0207693_10001027 3300025915 Bacteria 24967
85 Ga0207693_10003833 3300025915 Bacteria 12803
86 Ga0207663_10002846 3300025916 Bacteria 8362
87 Ga0207660_10032363 3300025917 Bacteria 3609
88 Ga0207657_10008220 3300025919 Bacteria 10624
89 Ga0207649_10058244 3300025920 Bacteria 2418
90 Ga0207649_10111655 3300025920 Bacteria 1827
91 Ga0207652_10058806 3300025921 Bacteria 3312
92 Ga0207646_10037291 3300025922 Bacteria 4383
93 Ga0207646_10324413 3300025922 Bacteria 1391
94 Ga0207694_10002295 3300025924 Bacteria 15650
95 Ga0207700_10029510 3300025928 Bacteria 3871
96 Ga0207700_10132642 3300025928 Bacteria 2036
97 Ga0207664_10005476 3300025929 Bacteria 8685
98 Ga0207664_10006161 3300025929 Bacteria 8226
99 Ga0207664_10049573 3300025929 Bacteria 3307
100 Ga0207665_10000299 3300025939 Bacteria 34205
101 Ga0207665_10084276 3300025939 Bacteria 2193
102 Ga0207665_10093509 3300025939 Bacteria 2088
103 Ga0207661_10012752 3300025944 Bacteria 6123
104 Ga0207667_10061768 3300025949 Bacteria 3919
105 Ga0207668_10124570 3300025972 Bacteria 1957
106 Ga0207674_10010665 3300026116 Bacteria 10392
107 Ga0207683_10043150 3300026121 Bacteria 3940
108 Ga0209179_1001990 3300027512 Bacteria 2662
109 Ga0268266_10000021 3300028379 Bacteria 522453
110 Ga0265337_1010259 3300028556 Bacteria 3291
111 Ga0265326_10006963 3300028558 Bacteria 3485
112 Ga0265334_10001889 3300028573 Bacteria 9926
113 Ga0265334_10022977 3300028573 Bacteria 2539
114 Ga0265323_10002637 3300028653 Bacteria 8129
115 Ga0265336_10000128 3300028666 Bacteria 55655
116 Ga0307517_10063201 3300028786 Bacteria 3466
117 Ga0265338_10000119 3300028800 Bacteria 146599
118 Ga0265324_10000858 3300029957 Bacteria 19540
119 Ga0265330_10023832 3300031235 Bacteria 2778
120 Ga0265332_10022850 3300031238 Bacteria 2759
121 Ga0265325_10014166 3300031241 Bacteria 4515
122 Ga0265325_10025717 3300031241 Bacteria 3194
123 Ga0265340_10026236 3300031247 Bacteria 2946
124 Ga0265339_10016374 3300031249 Bacteria 4420
125 Ga0265339_10021079 3300031249 Bacteria 3799
126 Ga0265327_10050092 3300031251 Bacteria 2187
127 Ga0307408_100129721 3300031548 Bacteria 1965
128 Ga0307508_10072231 3300031616 Bacteria 3025
129 Ga0307508_10099989 3300031616 Bacteria 2494
130 Ga0265314_10030660 3300031711 Bacteria 3978
131 Ga0265314_10034552 3300031711 Bacteria 3695
132 Ga0265342_10010854 3300031712 Bacteria 6269
133 Ga0265342_10015242 3300031712 Bacteria 5066
134 Ga0307516_10104461 3300031730 Bacteria 2645
135 Ga0307412_10000405 3300031911 Bacteria 26327
136 Ga0307507_10067342 3300033179 Bacteria 3275
137 Ga0307510_10017231 3300033180 Bacteria 8525
138 Ga0307510_10029780 3300033180 Bacteria 6204
139 Ga0373934_0010542 3300035086 Bacteria 3470
140 Ga0373923_0011847 3300035111 Bacteria 3210
141 Ga0373945_0010133 3300035116 Bacteria 3099
142 Ga0373953_0005753 3300035117 Bacteria 4045
143 Ga0373954_0011250 3300035118 Bacteria 3961
144 Ga0373956_0001282 3300035119 Bacteria 10406
145 Ga0373956_0019656 3300035119 Bacteria 2866
146 Ga0373957_0001863 3300035120 Bacteria 5844
147 Ga0373960_0028966 3300035121 Bacteria 1532
148 Ga0373946_0098017 3300035171 Bacteria 1310
149 Ga0373955_0003409 3300035172 Bacteria 6987
150 Ga0373924_0013813 3300035410 Bacteria 3039
151 Ga0373935_0000380 3300035692 Bacteria 22819
152 Ga0373935_0060789 3300035692 Bacteria 2417
153 Ga0373935_0316683 3300035692 Bacteria 1106
154 Ga0373927_0001457 3300035695 Bacteria 17844
155 Ga0373927_0001953 3300035695 Bacteria 15232
156 Ga0373933_0001851 3300035724 Bacteria 12231
157 Ga0373947_0006743 3300035725 Bacteria 6662
158 Ga0373947_0008967 3300035725 Bacteria 5749
159 Ga0373947_0044681 3300035725 Bacteria 2649
160 Ga0373937_0007351 3300036401 Bacteria 9537
161 Ga0373937_0024733 3300036401 Bacteria 5419
162 Ga0373937_0029647 3300036401 Bacteria 4956
163 Ga0373925_0047517 3300037068 Bacteria 3195
164 Ga0436364_1408940 3300037853 Bacteria 4613
165 Ga0436365_0231312 3300039437 Bacteria 21381
166 Ga0436360_1185898 3300039438 Bacteria 3482
167 Ga0436363_0902492 3300039450 Bacteria 4801
168 Ga0436362_0475471 3300039453 Bacteria 1263
169 Ga0436362_0915568 3300039453 Bacteria 2794
170 Ga0439436_0000020 3300041404 Bacteria 66117
171 Ga0439465_0000651 3300041413 Bacteria 10617
172 Ga0439465_0054536 3300041413 Bacteria 1315
173 Ga0439445_0032029 3300042004 Bacteria 1369
174 Ga0450908_000081 3300042184 Bacteria 19420
175 Ga0466982_0000059 3300044672 Bacteria 30023
176 Ga0466967_0328991 3300045976 Bacteria 1475
177 Ga0495617_000281 3300046452 Bacteria 29503
178 Ga0495592_0013927 3300046454 Bacteria 6109
179 Ga0495592_0059662 3300046454 Bacteria 2808
180 Ga0495603_0001331 3300046455 Bacteria 14352
181 Ga0495603_0017421 3300046455 Bacteria 4346
182 Ga0495629_0000573 3300046459 Bacteria 29885
183 Ga0495629_0004863 3300046459 Bacteria 10077
184 Ga0495638_0000390 3300046460 Bacteria 54002
185 Ga0495651_0017742 3300046462 Bacteria 5510
186 Ga0495651_0030324 3300046462 Bacteria 4217
187 Ga0495651_0115193 3300046462 Bacteria 1982
188 Ga0495653_0006915 3300046463 Bacteria 9321
189 Ga0495653_0053531 3300046463 Bacteria 3087
190 Ga0495650_0001443 3300046471 Bacteria 22930
191 Ga0495650_0002814 3300046471 Bacteria 13353
192 Ga0495650_0014341 3300046471 Bacteria 4132
193 Ga0495650_0031000 3300046471 Bacteria 2413
194 Ga0495580_0001254 3300046472 Bacteria 22415
195 Ga0495580_0042354 3300046472 Bacteria 3244
196 Ga0495582_0003489 3300046473 Bacteria 8858
197 Ga0495662_0000041 3300046476 Bacteria 43651
198 Ga0495662_0111961 3300046476 Bacteria 1338
199 Ga0495664_0004365 3300046477 Bacteria 7732
200 Ga0495584_0007727 3300046491 Bacteria 5597
201 Ga0495585_0001675 3300046492 Bacteria 16940
202 Ga0495607_0000098 3300046501 Bacteria 92012
203 Ga0495607_0001275 3300046501 Bacteria 22531
204 Ga0495607_0007620 3300046501 Bacteria 7459
205 Ga0495583_0010141 3300046506 Bacteria 5531
206 Ga0495606_0001810 3300046507 Bacteria 27188
207 Ga0495606_0004119 3300046507 Bacteria 14765
208 Ga0495606_0091236 3300046507 Bacteria 1873
209 Ga0495608_0007959 3300046511 Bacteria 7449
210 Ga0495608_0010939 3300046511 Bacteria 6324
211 Ga0495610_0002415 3300046512 Bacteria 15735
212 Ga0495616_0000085 3300046513 Bacteria 79620
213 Ga0495616_0047075 3300046513 Bacteria 2173
214 Ga0495618_0178605 3300046514 Bacteria 1349
215 Ga0495620_0001257 3300046515 Bacteria 15492
216 Ga0495620_0007755 3300046515 Bacteria 5798
217 Ga0495628_0018230 3300046516 Bacteria 5819
218 Ga0495628_0041656 3300046516 Bacteria 3666
219 Ga0495631_0000661 3300046518 Bacteria 22256
220 Ga0495631_0001913 3300046518 Bacteria 12268
221 Ga0495632_0000262 3300046519 Bacteria 52466
222 Ga0495632_0044181 3300046519 Bacteria 2224
223 Ga0495632_0095114 3300046519 Bacteria 1408
224 Ga0495637_0002715 3300046520 Bacteria 9642
225 Ga0495648_0003074 3300046524 Bacteria 14907
226 Ga0495648_0003892 3300046524 Bacteria 12945
227 Ga0495666_0036819 3300046526 Bacteria 2382
228 Ga0495652_0008250 3300046529 Bacteria 9526
229 Ga0495652_0109679 3300046529 Bacteria 2221
230 Ga0495665_0003894 3300046531 Bacteria 8078
231 Ga0495640_0005841 3300046533 Bacteria 9774
232 Ga0495640_0015312 3300046533 Bacteria 5773
233 Ga0495640_0215461 3300046533 Bacteria 1212
234 Ga0495587_0014614 3300046536 Bacteria 4918
235 Ga0495587_0039646 3300046536 Bacteria 2817
236 Ga0495609_0018055 3300046538 Bacteria 3272
237 Ga0495645_0022213 3300046543 Bacteria 4589
238 Ga0495645_0109812 3300046543 Bacteria 1952
239 Ga0495622_0001958 3300046557 Bacteria 10091
240 Ga0495667_0030201 3300046559 Bacteria 3644
241 Ga0495667_0044106 3300046559 Bacteria 2953
242 Ga0495667_0113894 3300046559 Bacteria 1748
243 Ga0495668_0025850 3300046616 Bacteria 3334
244 Ga0495634_0000417 3300046642 Bacteria 42219
245 Ga0495634_0009571 3300046642 Bacteria 7142
246 Ga0495611_0000001 3300046648 Bacteria 2628469
247 Ga0495611_0000860 3300046648 Bacteria 16642
248 Ga0495625_0000001 3300046660 Bacteria 1641829
249 Ga0495625_0022652 3300046660 Bacteria 4813
250 Ga0495625_0045198 3300046660 Bacteria 3185
251 Ga0495635_0001812 3300046663 Bacteria 14436
252 Ga0495661_0002677 3300046665 Bacteria 13629
253 Ga0495588_0002918 3300046674 Bacteria 7374
254 Ga0495657_0021254 3300046675 Bacteria 4657
255 Ga0495599_0005883 3300046678 Bacteria 7370
256 Ga0495599_0017982 3300046678 Bacteria 4402
257 Ga0495623_0009661 3300046679 Bacteria 6263
258 Ga0495646_0015116 3300046680 Bacteria 4903
259 Ga0495647_0000353 3300046681 Bacteria 12981
260 Ga0495613_0005918 3300046689 Bacteria 9154
261 Ga0495613_0014138 3300046689 Bacteria 5923
262 Ga0495624_0009468 3300046690 Bacteria 6747
263 Ga0495670_0002285 3300046691 Bacteria 9458
264 Ga0495670_0006034 3300046691 Bacteria 5935
265 Ga0495670_0013330 3300046691 Bacteria 4043
266 Ga0495671_0002521 3300046692 Bacteria 11520
267 Ga0495589_0000458 3300046794 Bacteria 29894
268 Ga0495600_0008574 3300046809 Bacteria 6286
269 Ga0495600_0012734 3300046809 Bacteria 5266
270 Ga0495600_0016665 3300046809 Bacteria 4670
271 Ga0495660_0000410 3300046810 Bacteria 36526
272 Ga0495660_0000670 3300046810 Bacteria 26361
273 Ga0495581_0000302 3300047315 Bacteria 24109
274 Ga0495604_0050259 3300047317 Bacteria 3237
275 Ga0495674_0000400 3300047319 Bacteria 38852
276 Ga0495680_0033312 3300047322 Bacteria 4172
277 Ga0495683_0001431 3300047323 Bacteria 15696
278 Ga0495675_0002638 3300047444 Bacteria 10748
279 Ga0495679_000001 3300047446 Bacteria 1607568
280 Ga0495673_0000001 3300047469 Bacteria 1630730
281 Ga0495673_0000099 3300047469 Bacteria 179978
282 Ga0495673_0001289 3300047469 Bacteria 20453
283 Ga0495684_0007772 3300047471 Bacteria 8301
284 Ga0495684_0016371 3300047471 Bacteria 5709
285 Ga0495684_0169359 3300047471 Bacteria 1625
286 Ga0495686_0000975 3300047472 Bacteria 35076
287 Ga0495686_0034732 3300047472 Bacteria 3245
288 Ga0495686_0076951 3300047472 Bacteria 2043
289 Ga0495593_0000029 3300047673 Bacteria 60282
290 Ga0495593_0001879 3300047673 Bacteria 12513
291 Ga0495602_0075109 3300048088 Bacteria 2869
292 Ga0496100_0036387 3300048903 Bacteria 3105
293 Ga0496104_0004169 3300048907 Bacteria 12544
294 Ga0496106_0000847 3300048909 Bacteria 22191
295 Ga0496106_0003300 3300048909 Bacteria 12041
296 Ga0496110_0178606 3300048913 Bacteria 1927
297 Ga0496114_0076981 3300048917 Bacteria 2812
298 Ga0496115_0089898 3300048918 Bacteria 2508
299 Ga0496117_0025248 3300048920 Bacteria 4677
300 Ga0496118_0001098 3300048921 Bacteria 42106
301 Ga0496118_0005498 3300048921 Bacteria 14381
302 Ga0496118_0009152 3300048921 Bacteria 10066
303 Ga0496118_0110740 3300048921 Bacteria 1823
304 Ga0496119_0024052 3300048922 Bacteria 4299
305 Ga0496120_0136332 3300048923 Bacteria 1251
306 Ga0496121_0000287 3300048924 Bacteria 104774
307 Ga0496121_0000350 3300048924 Bacteria 96129
308 Ga0496121_0000595 3300048924 Bacteria 67907
309 Ga0496121_0004295 3300048924 Bacteria 19315
310 Ga0496121_0008969 3300048924 Bacteria 11605
311 Ga0496121_0054405 3300048924 Bacteria 3344
312 Ga0496121_0252122 3300048924 Bacteria 1223
313 Ga0496123_0038107 3300048926 Bacteria 3384
314 Ga0496124_0000954 3300048927 Bacteria 46159
315 Ga0496124_0001605 3300048927 Bacteria 32479
316 Ga0496124_0007050 3300048927 Bacteria 12041
317 Ga0496125_0046452 3300048928 Bacteria 3642
318 Ga0496126_0004752 3300048929 Bacteria 16014
319 Ga0496126_0023863 3300048929 Bacteria 5919
320 Ga0496126_0063931 3300048929 Bacteria 3297
321 Ga0495678_000132 3300049459 Bacteria 88496
322 Ga0495682_0064295 3300049460 Bacteria 1322
323 Ga0501031_0024689 3300049568 Bacteria 3919
324 Ga0501032_0077721 3300049569 Bacteria 2209
325 Ga0501032_0081664 3300049569 Bacteria 2150
326 Ga0501033_0000447 3300049570 Bacteria 39400
327 Ga0501033_0020710 3300049570 Bacteria 4969
328 Ga0501033_0057980 3300049570 Bacteria 2861
329 Ga0501034_0123863 3300049571 Bacteria 2570
330 Ga0501036_0023385 3300049572 Bacteria 5206
331 Ga0501037_0001156 3300049573 Bacteria 19521
332 Ga0501038_0008424 3300049574 Bacteria 9485
333 Ga0501038_0013172 3300049574 Bacteria 7542
334 Ga0501038_0022031 3300049574 Bacteria 5714
335 Ga0501039_0007243 3300049575 Bacteria 8450
336 Ga0501039_0026401 3300049575 Bacteria 4462
337 Ga0501039_0295956 3300049575 Bacteria 1272
338 Ga0501042_0010019 3300049578 Bacteria 6337
339 Ga0501043_0003627 3300049579 Bacteria 12682
340 Ga0501043_0077279 3300049579 Bacteria 2615
341 Ga0501043_0113400 3300049579 Bacteria 2129
342 Ga0501043_0128614 3300049579 Bacteria 1985
343 Ga0501046_0013294 3300049580 Bacteria 6974
344 Ga0501047_0052595 3300049581 Bacteria 3936
345 Ga0501047_0077855 3300049581 Bacteria 3189
346 Ga0501048_0031029 3300049582 Bacteria 3867
347 Ga0501067_0064796 3300049583 Bacteria 2023
348 Ga0501067_0106439 3300049583 Bacteria 1558
349 Ga0501070_0031700 3300049586 Bacteria 4428
350 Ga0501070_0033671 3300049586 Bacteria 4288
351 Ga0501073_0112377 3300049589 Bacteria 1889
352 Ga0501074_0028495 3300049590 Bacteria 4047
353 Ga0501076_0050622 3300049592 Bacteria 3287
354 Ga0501079_0054251 3300049741 Bacteria 3091
355 Ga0501081_0298697 3300049743 Bacteria 1181
356 Ga0501083_0009362 3300049744 Bacteria 6914
357 Ga0501035_0027836 3300049822 Bacteria 5165
358 Ga0501035_0029333 3300049822 Bacteria 5016
359 Ga0501035_0189496 3300049822 Bacteria 1768
360 Ga0501044_0033759 3300049823 Bacteria 5373
361 Ga0501044_0043985 3300049823 Bacteria 4637
362 Ga0501044_0175892 3300049823 Bacteria 2109
363 Ga0501044_0187693 3300049823 Bacteria 2031
364 Ga0501044_0265140 3300049823 Bacteria 1655
365 Ga0501045_0014077 3300049824 Bacteria 5663
366 nmdc:mga03683_90738_c1 3300050489 Bacteria 1332
367 nmdc:mga06z11_1472_c1 3300050494 Bacteria 8770
368 nmdc:mga08x19_11011_c1 3300050514 Bacteria 5443
369 nmdc:mga08x19_194264_c1 3300050514 Bacteria 1389
370 nmdc:mga0sz30_14905_c1 3300050516 Bacteria 3066
371 Ga0495601_0003958 3300053077 Bacteria 8531
372 Ga0495612_0019527 3300053078 Bacteria 2713
373 Ga0500635_0001193 3300053080 Bacteria 6219
374 Ga0500635_0013508 3300053080 Bacteria 2373
375 Ga0495595_0005343 3300053084 Bacteria 5197
376 Ga0495595_0042985 3300053084 Bacteria 2071
377 Ga0495619_0008654 3300053085 Bacteria 6440
378 Ga0495619_0012720 3300053085 Bacteria 5296
379 Ga0495619_0035069 3300053085 Bacteria 3262
380 Ga0500643_000002 3300053087 Bacteria 1277657
381 Ga0500566_0000239 3300053094 Bacteria 29379
382 Ga0500640_001013 3300053095 Bacteria 7991
383 Ga0500555_000526 3300053103 Bacteria 15339
384 Ga0500572_000392 3300053111 Bacteria 15487
385 Ga0500572_001472 3300053111 Bacteria 6396
386 Ga0500595_003551 3300053119 Bacteria 7246
387 Ga0500608_032147 3300053122 Bacteria 2492
388 Ga0500614_000777 3300053123 Bacteria 8094
389 Ga0500559_0001233 3300053136 Bacteria 15080
390 Ga0500559_0003940 3300053136 Bacteria 7167
391 Ga0500559_0119049 3300053136 Bacteria 1227
392 Ga0500588_0002576 3300053146 Bacteria 3715
393 Ga0500603_000503 3300053150 Bacteria 9924
394 Ga0500603_000601 3300053150 Bacteria 8954
395 Ga0500603_021027 3300053150 Bacteria 1601
396 Ga0500616_0000705 3300053153 Bacteria 38798
397 Ga0500630_003788 3300053159 Bacteria 7331
398 Ga0500633_0003308 3300053160 Bacteria 3497
399 Ga0500639_000076 3300053163 Bacteria 45936
400 Ga0500639_003776 3300053163 Bacteria 7666
401 Ga0500639_042163 3300053163 Bacteria 2397
402 Ga0500637_0006044 3300053178 Bacteria 5920
403 Ga0500637_0109994 3300053178 Bacteria 1598
404 Ga0500645_001051 3300053730 Bacteria 15382
405 Ga0500596_000867 3300053735 Bacteria 6009
406 Ga0500596_004982 3300053735 Bacteria 2381
407 Ga0501082_0075269 3300060353 Bacteria 2908
408 2508725950 2508501050 Bacteria 9633614
409 2509076368 2508501114 Bacteria 7082538
410 2595445817 2593339238 Bacteria 4182970
411 2595452525 2593339239 Bacteria 4124669
412 2721027882 2718218334 Bacteria 4765486
413 2735836546 2734482264 Unclassified 5014763
414 2739228459 2738543009 Bacteria 4944499
415 2807409039 2806310737 Bacteria 5751088
416 2807457375 2806310745 Bacteria 5742165
417 2819565129 2818991440 Bacteria 4774720
418 2842916155 2842914999 Bacteria 4419378
419 2842921858 2842918807 Bacteria 4289178
420 2884340190 2884338543 Bacteria 4610696
421 2904466797 2904463128 Bacteria 4775606
422 2919085726 2919085039 Bacteria 4532964
423 2919405850 2919404418 Bacteria 4232372
424 2941475877 2941471342 Bacteria 5018624
425 2953997862 2953994433 Bacteria 4303959
426 8056118174 8056115690 Bacteria 5527654
427 8056124151 8056120720 Bacteria 5758328
428 Ga0316215_1000850
429 JGI24738J21930_10000944
430 Ga0065165_1000113
431 Ga0070683_100028648
432 Ga0070666_10000012
433 Ga0070680_100055436
434 Ga0070660_100048270
435 Ga0070709_10000372
436 Ga0070714_100048275
437 Ga0070714_100109327
438 Ga0070713_100004487
439 Ga0070713_100053992
440 Ga0070710_10000509
441 Ga0070711_100008047
442 Ga0070711_100022579
443 Ga0070708_100000786
444 Ga0070708_100037281
445 Ga0070706_100007601
446 Ga0070698_100006803
447 Ga0070699_100030203
448 Ga0070679_100013347
449 Ga0070679_100207739
450 Ga0070684_100048429
451 Ga0070697_100000316
452 Ga0070697_100026563
453 Ga0070697_100119970
454 Ga0070665_100067490
455 Ga0068855_100561337
456 Ga0068857_100004229
457 Ga0068859_100476562
458 Ga0068851_10096131
459 Ga0068863_100083571
460 Ga0068860_100194934
461 Ga0070717_10019227
462 Ga0070715_10015179
463 Ga0070716_100042867
464 Ga0070716_100175674
465 Ga0070712_100112952
466 Ga0075367_10005099
467 Ga0075369_10003780
468 Ga0075433_10093869
469 Ga0075436_100211089
470 Ga0097620_100476573
471 Ga0099794_10076880
472 Ga0105240_10277701
473 Ga0105247_10003378
474 Ga0105237_10007103
475 Ga0105238_10000540
476 Ga0105238_10024764
477 Ga0105238_10056518
478 Ga0157370_10000278
479 Ga0157372_10167002
480 Ga0157375_10348219
481 Ga0182008_10032257
482 Ga0157379_10346369
483 Ga0182006_1000223
484 Ga0182006_1000883
485 Ga0182007_10005058
486 Ga0182005_1000228
487 Ga0182005_1000488
488 Ga0163161_10018592
489 Ga0213873_10005865
490 Ga0213874_10018568
491 Ga0213876_10000797
492 Ga0213875_10031157
493 Ga0209437_101370
494 Ga0209148_1001464
495 Ga0209129_1001620
496 Ga0209256_1006588
497 Ga0209051_1013798
498 Ga0207692_10001401
499 Ga0207692_10010595
500 Ga0207680_10000013
501 Ga0207685_10042668
502 Ga0207699_10000245
503 Ga0207699_10020729
504 Ga0207699_10098112
505 Ga0207705_10028982
506 Ga0207684_10000901
507 Ga0207684_10043786
508 Ga0207707_10129897
509 Ga0207707_10181885
510 Ga0207671_10028210
511 Ga0207693_10001027
512 Ga0207693_10003833
513 Ga0207663_10002846
514 Ga0207660_10032363
515 Ga0207657_10008220
516 Ga0207649_10058244
517 Ga0207649_10111655
518 Ga0207652_10058806
519 Ga0207646_10037291
520 Ga0207646_10324413
521 Ga0207694_10002295
522 Ga0207700_10029510
523 Ga0207700_10132642
524 Ga0207664_10005476
525 Ga0207664_10006161
526 Ga0207664_10049573
527 Ga0207665_10000299
528 Ga0207665_10084276
529 Ga0207665_10093509
530 Ga0207661_10012752
531 Ga0207667_10061768
532 Ga0207668_10124570
533 Ga0207674_10010665
534 Ga0207683_10043150
535 Ga0209179_1001990
536 Ga0268266_10000021
537 Ga0265337_1010259
538 Ga0265326_10006963
539 Ga0265334_10001889
540 Ga0265334_10022977
541 Ga0265323_10002637
542 Ga0265336_10000128
543 Ga0307517_10063201
544 Ga0265338_10000119
545 Ga0265324_10000858
546 Ga0265330_10023832
547 Ga0265332_10022850
548 Ga0265325_10014166
549 Ga0265325_10025717
550 Ga0265340_10026236
551 Ga0265339_10016374
552 Ga0265339_10021079
553 Ga0265327_10050092
554 Ga0307408_100129721
555 Ga0307508_10072231
556 Ga0307508_10099989
557 Ga0265314_10030660
558 Ga0265314_10034552
559 Ga0265342_10010854
560 Ga0265342_10015242
561 Ga0307516_10104461
562 Ga0307412_10000405
563 Ga0307507_10067342
564 Ga0307510_10017231
565 Ga0307510_10029780
566 Ga0373934_0010542
567 Ga0373923_0011847
568 Ga0373945_0010133
569 Ga0373953_0005753
570 Ga0373954_0011250
571 Ga0373956_0001282
572 Ga0373956_0019656
573 Ga0373957_0001863
574 Ga0373960_0028966
575 Ga0373946_0098017
576 Ga0373955_0003409
577 Ga0373924_0013813
578 Ga0373935_0000380
579 Ga0373935_0060789
580 Ga0373935_0316683
581 Ga0373927_0001457
582 Ga0373927_0001953
583 Ga0373933_0001851
584 Ga0373947_0006743
585 Ga0373947_0008967
586 Ga0373947_0044681
587 Ga0373937_0007351
588 Ga0373937_0024733
589 Ga0373937_0029647
590 Ga0373925_0047517
591 Ga0436364_1408940
592 Ga0436365_0231312
593 Ga0436360_1185898
594 Ga0436363_0902492
595 Ga0436362_0475471
596 Ga0436362_0915568
597 Ga0439436_0000020
598 Ga0439465_0000651
599 Ga0439465_0054536
600 Ga0439445_0032029
601 Ga0450908_000081
602 Ga0466982_0000059
603 Ga0466967_0328991
604 Ga0495617_000281
605 Ga0495592_0013927
606 Ga0495592_0059662
607 Ga0495603_0001331
608 Ga0495603_0017421
609 Ga0495629_0000573
610 Ga0495629_0004863
611 Ga0495638_0000390
612 Ga0495651_0017742
613 Ga0495651_0030324
614 Ga0495651_0115193
615 Ga0495653_0006915
616 Ga0495653_0053531
617 Ga0495650_0001443
618 Ga0495650_0002814
619 Ga0495650_0014341
620 Ga0495650_0031000
621 Ga0495580_0001254
622 Ga0495580_0042354
623 Ga0495582_0003489
624 Ga0495662_0000041
625 Ga0495662_0111961
626 Ga0495664_0004365
627 Ga0495584_0007727
628 Ga0495585_0001675
629 Ga0495607_0000098
630 Ga0495607_0001275
631 Ga0495607_0007620
632 Ga0495583_0010141
633 Ga0495606_0001810
634 Ga0495606_0004119
635 Ga0495606_0091236
636 Ga0495608_0007959
637 Ga0495608_0010939
638 Ga0495610_0002415
639 Ga0495616_0000085
640 Ga0495616_0047075
641 Ga0495618_0178605
642 Ga0495620_0001257
643 Ga0495620_0007755
644 Ga0495628_0018230
645 Ga0495628_0041656
646 Ga0495631_0000661
647 Ga0495631_0001913
648 Ga0495632_0000262
649 Ga0495632_0044181
650 Ga0495632_0095114
651 Ga0495637_0002715
652 Ga0495648_0003074
653 Ga0495648_0003892
654 Ga0495666_0036819
655 Ga0495652_0008250
656 Ga0495652_0109679
657 Ga0495665_0003894
658 Ga0495640_0005841
659 Ga0495640_0015312
660 Ga0495640_0215461
661 Ga0495587_0014614
662 Ga0495587_0039646
663 Ga0495609_0018055
664 Ga0495645_0022213
665 Ga0495645_0109812
666 Ga0495622_0001958
667 Ga0495667_0030201
668 Ga0495667_0044106
669 Ga0495667_0113894
670 Ga0495668_0025850
671 Ga0495634_0000417
672 Ga0495634_0009571
673 Ga0495611_0000001
674 Ga0495611_0000860
675 Ga0495625_0000001
676 Ga0495625_0022652
677 Ga0495625_0045198
678 Ga0495635_0001812
679 Ga0495661_0002677
680 Ga0495588_0002918
681 Ga0495657_0021254
682 Ga0495599_0005883
683 Ga0495599_0017982
684 Ga0495623_0009661
685 Ga0495646_0015116
686 Ga0495647_0000353
687 Ga0495613_0005918
688 Ga0495613_0014138
689 Ga0495624_0009468
690 Ga0495670_0002285
691 Ga0495670_0006034
692 Ga0495670_0013330
693 Ga0495671_0002521
694 Ga0495589_0000458
695 Ga0495600_0008574
696 Ga0495600_0012734
697 Ga0495600_0016665
698 Ga0495660_0000410
699 Ga0495660_0000670
700 Ga0495581_0000302
701 Ga0495604_0050259
702 Ga0495674_0000400
703 Ga0495680_0033312
704 Ga0495683_0001431
705 Ga0495675_0002638
706 Ga0495679_000001
707 Ga0495673_0000001
708 Ga0495673_0000099
709 Ga0495673_0001289
710 Ga0495684_0007772
711 Ga0495684_0016371
712 Ga0495684_0169359
713 Ga0495686_0000975
714 Ga0495686_0034732
715 Ga0495686_0076951
716 Ga0495593_0000029
717 Ga0495593_0001879
718 Ga0495602_0075109
719 Ga0496100_0036387
720 Ga0496104_0004169
721 Ga0496106_0000847
722 Ga0496106_0003300
723 Ga0496110_0178606
724 Ga0496114_0076981
725 Ga0496115_0089898
726 Ga0496117_0025248
727 Ga0496118_0001098
728 Ga0496118_0005498
729 Ga0496118_0009152
730 Ga0496118_0110740
731 Ga0496119_0024052
732 Ga0496120_0136332
733 Ga0496121_0000287
734 Ga0496121_0000350
735 Ga0496121_0000595
736 Ga0496121_0004295
737 Ga0496121_0008969
738 Ga0496121_0054405
739 Ga0496121_0252122
740 Ga0496123_0038107
741 Ga0496124_0000954
742 Ga0496124_0001605
743 Ga0496124_0007050
744 Ga0496125_0046452
745 Ga0496126_0004752
746 Ga0496126_0023863
747 Ga0496126_0063931
748 Ga0495678_000132
749 Ga0495682_0064295
750 Ga0501031_0024689
751 Ga0501032_0077721
752 Ga0501032_0081664
753 Ga0501033_0000447
754 Ga0501033_0020710
755 Ga0501033_0057980
756 Ga0501034_0123863
757 Ga0501036_0023385
758 Ga0501037_0001156
759 Ga0501038_0008424
760 Ga0501038_0013172
761 Ga0501038_0022031
762 Ga0501039_0007243
763 Ga0501039_0026401
764 Ga0501039_0295956
765 Ga0501042_0010019
766 Ga0501043_0003627
767 Ga0501043_0077279
768 Ga0501043_0113400
769 Ga0501043_0128614
770 Ga0501046_0013294
771 Ga0501047_0052595
772 Ga0501047_0077855
773 Ga0501048_0031029
774 Ga0501067_0064796
775 Ga0501067_0106439
776 Ga0501070_0031700
777 Ga0501070_0033671
778 Ga0501073_0112377
779 Ga0501074_0028495
780 Ga0501076_0050622
781 Ga0501079_0054251
782 Ga0501081_0298697
783 Ga0501083_0009362
784 Ga0501035_0027836
785 Ga0501035_0029333
786 Ga0501035_0189496
787 Ga0501044_0033759
788 Ga0501044_0043985
789 Ga0501044_0175892
790 Ga0501044_0187693
791 Ga0501044_0265140
792 Ga0501045_0014077
793 nmdc:mga03683_90738_c1
794 nmdc:mga06z11_1472_c1
795 nmdc:mga08x19_11011_c1
796 nmdc:mga08x19_194264_c1
797 nmdc:mga0sz30_14905_c1
798 Ga0495601_0003958
799 Ga0495612_0019527
800 Ga0500635_0001193
801 Ga0500635_0013508
802 Ga0495595_0005343
803 Ga0495595_0042985
804 Ga0495619_0008654
805 Ga0495619_0012720
806 Ga0495619_0035069
807 Ga0500643_000002
808 Ga0500566_0000239
809 Ga0500640_001013
810 Ga0500555_000526
811 Ga0500572_000392
812 Ga0500572_001472
813 Ga0500595_003551
814 Ga0500608_032147
815 Ga0500614_000777
816 Ga0500559_0001233
817 Ga0500559_0003940
818 Ga0500559_0119049
819 Ga0500588_0002576
820 Ga0500603_000503
821 Ga0500603_000601
822 Ga0500603_021027
823 Ga0500616_0000705
824 Ga0500630_003788
825 Ga0500633_0003308
826 Ga0500639_000076
827 Ga0500639_003776
828 Ga0500639_042163
829 Ga0500637_0006044
830 Ga0500637_0109994
831 Ga0500645_001051
832 Ga0500596_000867
833 Ga0500596_004982
834 Ga0501082_0075269
835 2508725950
836 2509076368
837 2595445817
838 2595452525
839 2721027882
840 2735836546
841 2739228459
842 2807409039
843 2807457375
844 2819565129
845 2842916155
846 2842921858
847 2884340190
848 2904466797
849 2919085726
850 2919405850
851 2941475877
852 2953997862
853 8056118174
854 8056124151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

2

159

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

186

219

0.94

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

214

325

0.83

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

2

95

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.95 2 32
6pvj-assembly1.cif.gz_A crystal structure of phqk in complex with malbrancheamide c 0.9488 2 32
7xe3-assembly1.cif.gz_A crystal structure of lsd2 in complex with cis-4-br-2,5-f2-pcpa (s1024) 0.9432 2 30
6bzt-assembly3.cif.gz_C crystal structure of halogenase pltm l111y mutant in complex with fad 0.9423 2 30
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.9401 2 30
ID Description Score Start End Superfamily
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9449 1 178 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9366 1 137 3.40.50.720
3qhaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 1 152 3.40.50.720
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9317 3 30 3.50.50.60
4e21B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9289 1 178 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0L0LZ89-F1-model_v4 deleted 0.9937 1 115
AF-A0A525I822-F1-model_v4 6-phosphogluconate dehydrogenase (Decarboxylating) 0.9918 1 85 GO:0004616
GO:0050661
AF-A0A7C2WQY9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9906 1 115 GO:0004616
GO:0050661
AF-A0A521XLA1-F1-model_v4 6-phosphogluconate dehydrogenase 0.9839 1 143 GO:0004616
GO:0050661
AF-A0A7W1CXV2-F1-model_v4 NAD(P)-binding domain-containing protein 0.9768 1 144 GO:0004616
GO:0050661

Map