F441461

General Info

Members Datasets Scaffolds Average Seq Length
427 206 854 299

Family's Representative Sequence

Representative Sequence 3300025916|Ga0207663_10014708|Ga0207663_100147083
Length 340
Sequence VKQHIAVEGEADLRAEPTDVGLTNPTTSNLCKRFGAKRQRKMPELPDIVVYMEALEQRVVGHVLENLEVRGPSLLRTADPPVYSVQGQRVTALRRIGKRIAFGFDNDLWLVFHLMIAGRLHWSQKKKTADGRRTLAAFDFDNGTLTLTEAGTRKRASLHLVRGEAGLAALDPGGVDVFAVSLDQFSAVLTSANHTLKRALTDPRLFSGIGNAYSDEILFHAQLSPVLLTQRMKPEEIKRLYEATKQTLTLWTENLRKESGTKFPEKVTAFRDEMAVHGRYGKPCPRCGAKVQRIRYASNETDYCPHCQTGGKLLADRSLSRLLRQDWPRTPEELEERRRA

Samples

Sample ID Description Type Environment
1 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
118 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
119 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
128 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
135 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
136 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
137 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
188 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
189 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 3.75
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 11.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207663_10014708 3300025916 Bacteria 4295
2 MBSR1b_contig_10062352 2162886012 Bacteria 1268
3 Ga0058861_11992058 3300004800 Unclassified 1163
4 Ga0070658_10019953 3300005327 Bacteria 5369
5 Ga0068869_100098978 3300005334 Bacteria 2204
6 Ga0070666_10056437 3300005335 Bacteria 2652
7 Ga0070680_100010286 3300005336 Bacteria 7211
8 Ga0070680_100059231 3300005336 Unclassified 3132
9 Ga0068868_100346709 3300005338 Bacteria 1271
10 Ga0070660_100051598 3300005339 Bacteria 3168
11 Ga0070660_100115924 3300005339 Bacteria 2136
12 Ga0070675_100001345 3300005354 Bacteria 18013
13 Ga0070674_100001329 3300005356 Bacteria 13027
14 Ga0070674_100195751 3300005356 Unclassified 1557
15 Ga0070659_100064591 3300005366 Bacteria 2897
16 Ga0070659_100066729 3300005366 Bacteria 2852
17 Ga0070703_10012385 3300005406 Bacteria 2416
18 Ga0070709_10009465 3300005434 Bacteria 5378
19 Ga0070709_10025918 3300005434 Bacteria 3469
20 Ga0070709_10322153 3300005434 Unclassified 1135
21 Ga0070713_100212257 3300005436 Bacteria 1753
22 Ga0070710_10242161 3300005437 Bacteria 1156
23 Ga0070711_100015198 3300005439 Bacteria 4868
24 Ga0070711_100088212 3300005439 Bacteria 2228
25 Ga0070711_100164531 3300005439 Bacteria 1685
26 Ga0070705_100007876 3300005440 Bacteria 5262
27 Ga0070694_100021655 3300005444 Bacteria 4111
28 Ga0070708_100017395 3300005445 Bacteria 5995
29 Ga0070662_100152230 3300005457 Unclassified 1802
30 Ga0070681_10044528 3300005458 Bacteria 4442
31 Ga0070681_10044601 3300005458 Bacteria 4439
32 Ga0070681_10056938 3300005458 Bacteria 3889
33 Ga0070681_10106959 3300005458 Bacteria 2739
34 Ga0070681_10206646 3300005458 Bacteria 1881
35 Ga0070681_10209560 3300005458 Unclassified 1865
36 Ga0070706_100014925 3300005467 Bacteria 7176
37 Ga0070706_100299475 3300005467 Bacteria 1501
38 Ga0070698_100395187 3300005471 Bacteria 1316
39 Ga0070699_100009693 3300005518 Bacteria 8339
40 Ga0070699_100099008 3300005518 Unclassified 2555
41 Ga0070679_100004784 3300005530 Bacteria 12486
42 Ga0070679_100006710 3300005530 Bacteria 10735
43 Ga0070684_100082939 3300005535 Unclassified 2840
44 Ga0070684_100111017 3300005535 Bacteria 2459
45 Ga0070684_100206938 3300005535 Bacteria 1788
46 Ga0070697_100000335 3300005536 Bacteria 37062
47 Ga0068853_100101439 3300005539 Unclassified 2545
48 Ga0070686_100012734 3300005544 Bacteria 4801
49 Ga0070686_100199265 3300005544 Bacteria 1434
50 Ga0070695_100006165 3300005545 Bacteria 7087
51 Ga0070693_100008341 3300005547 Bacteria 5102
52 Ga0070693_100024020 3300005547 Bacteria 3265
53 Ga0070665_100179794 3300005548 Bacteria 2116
54 Ga0070704_100002936 3300005549 Bacteria 9687
55 Ga0068855_100005945 3300005563 Bacteria 14877
56 Ga0068855_100028134 3300005563 Bacteria 6723
57 Ga0068855_100078935 3300005563 Bacteria 3818
58 Ga0068855_100449141 3300005563 Unclassified 1407
59 Ga0070664_100223564 3300005564 Bacteria 1685
60 Ga0068856_100012972 3300005614 Bacteria 8068
61 Ga0068856_100563347 3300005614 Bacteria 1161
62 Ga0068852_100029211 3300005616 Bacteria 4526
63 Ga0068852_100047949 3300005616 Bacteria 3648
64 Ga0068859_100126896 3300005617 Unclassified 2621
65 Ga0068861_100141115 3300005719 Bacteria 1966
66 Ga0068862_100072947 3300005844 Bacteria 2966
67 Ga0068862_100095782 3300005844 Bacteria 2590
68 Ga0070717_10000072 3300006028 Bacteria 84584
69 Ga0070717_10062690 3300006028 Unclassified 3084
70 Ga0070716_100104517 3300006173 Bacteria 1743
71 Ga0070712_100069202 3300006175 Bacteria 2517
72 Ga0070712_100099968 3300006175 Bacteria 2142
73 Ga0075367_10009773 3300006178 Bacteria 5025
74 Ga0075366_10076022 3300006195 Bacteria 2004
75 Ga0068871_100116528 3300006358 Bacteria 2252
76 Ga0075428_100134051 3300006844 Bacteria 2693
77 Ga0075430_100051061 3300006846 Bacteria 3486
78 Ga0075430_100420409 3300006846 Bacteria 1103
79 Ga0075434_100443808 3300006871 Bacteria 1319
80 Ga0075436_100121883 3300006914 Bacteria 1825
81 Ga0097620_100126898 3300006931 Unclassified 2621
82 Ga0105240_10001445 3300009093 Bacteria 40579
83 Ga0105240_10159935 3300009093 Bacteria 2676
84 Ga0105240_10296193 3300009093 Bacteria 1852
85 Ga0105240_10351815 3300009093 Unclassified 1671
86 Ga0105240_10469990 3300009093 Bacteria 1404
87 Ga0105245_10001277 3300009098 Bacteria 22704
88 Ga0105245_10144536 3300009098 Bacteria 2243
89 Ga0114129_10171312 3300009147 Bacteria 2960
90 Ga0105241_10131415 3300009174 Bacteria 2028
91 Ga0105241_10163994 3300009174 Bacteria 1829
92 Ga0105242_10071782 3300009176 Bacteria 2874
93 Ga0105242_10231703 3300009176 Bacteria 1655
94 Ga0105248_10010725 3300009177 Bacteria 10115
95 Ga0105248_10088424 3300009177 Bacteria 3487
96 Ga0105248_10184694 3300009177 Bacteria 2350
97 Ga0105237_10002642 3300009545 Bacteria 22062
98 Ga0105238_10027037 3300009551 Bacteria 5848
99 Ga0105238_10080059 3300009551 Bacteria 3256
100 Ga0105238_10160037 3300009551 Bacteria 2227
101 Ga0105239_10003562 3300010375 Bacteria 19042
102 Ga0105239_10005855 3300010375 Bacteria 14331
103 Ga0105239_10046289 3300010375 Bacteria 4767
104 Ga0105239_10051245 3300010375 Bacteria 4525
105 Ga0105239_10234107 3300010375 Bacteria 2061
106 Ga0105239_10320036 3300010375 Unclassified 1749
107 Ga0157370_10014291 3300013104 Bacteria 8125
108 Ga0157370_10047273 3300013104 Bacteria 4126
109 Ga0157370_10123299 3300013104 Unclassified 2419
110 Ga0157370_10271386 3300013104 Bacteria 1567
111 Ga0157369_10021520 3300013105 Bacteria 7213
112 Ga0157369_10024109 3300013105 Bacteria 6772
113 Ga0157369_10270436 3300013105 Unclassified 1771
114 Ga0157369_10289359 3300013105 Bacteria 1706
115 Ga0157369_10374880 3300013105 Bacteria 1477
116 Ga0157369_10570209 3300013105 Unclassified 1169
117 Ga0157369_10718900 3300013105 Bacteria 1028
118 Ga0157374_10045955 3300013296 Bacteria 4042
119 Ga0157374_10065756 3300013296 Bacteria 3406
120 Ga0157374_10099802 3300013296 Bacteria 2782
121 Ga0157378_10049950 3300013297 Bacteria 3722
122 Ga0157378_10127698 3300013297 Bacteria 2351
123 Ga0163162_10003010 3300013306 Bacteria 16108
124 Ga0157372_10038756 3300013307 Bacteria 5259
125 Ga0157372_10085203 3300013307 Bacteria 3584
126 Ga0163163_10000059 3300014325 Bacteria 123393
127 Ga0163163_10191333 3300014325 Bacteria 2095
128 Ga0157380_10649422 3300014326 Bacteria 1052
129 Ga0157379_10253128 3300014968 Bacteria 1599
130 Ga0213876_10049008 3300021384 Unclassified 2231
131 Ga0213875_10003491 3300021388 Bacteria 8945
132 Ga0213875_10067197 3300021388 Bacteria 1675
133 Ga0213875_10106903 3300021388 Bacteria 1306
134 Ga0224712_10104244 3300022467 Unclassified 1208
135 Ga0207713_1090403 3300025735 Bacteria 1077
136 Ga0207653_10018979 3300025885 Bacteria 2167
137 Ga0207705_10060519 3300025909 Bacteria 2735
138 Ga0207684_10002645 3300025910 Bacteria 17926
139 Ga0207654_10181545 3300025911 Bacteria 1373
140 Ga0207707_10012251 3300025912 Bacteria 7455
141 Ga0207707_10056277 3300025912 Unclassified 3422
142 Ga0207707_10065494 3300025912 Bacteria 3165
143 Ga0207707_10204265 3300025912 Bacteria 1722
144 Ga0207707_10288357 3300025912 Bacteria 1420
145 Ga0207695_10008516 3300025913 Bacteria 12824
146 Ga0207695_10084534 3300025913 Unclassified 3204
147 Ga0207695_10273399 3300025913 Bacteria 1585
148 Ga0207693_10009746 3300025915 Bacteria 7822
149 Ga0207660_10003127 3300025917 Bacteria 10823
150 Ga0207660_10289505 3300025917 Bacteria 1302
151 Ga0207657_10001616 3300025919 Bacteria 24238
152 Ga0207652_10204369 3300025921 Bacteria 1778
153 Ga0207694_10080675 3300025924 Bacteria 2554
154 Ga0207659_10148599 3300025926 Unclassified 1827
155 Ga0207687_10001897 3300025927 Bacteria 14374
156 Ga0207687_10028905 3300025927 Bacteria 3726
157 Ga0207700_10005732 3300025928 Bacteria 7461
158 Ga0207700_10440680 3300025928 Bacteria 1147
159 Ga0207664_10425437 3300025929 Unclassified 1183
160 Ga0207690_10045589 3300025932 Bacteria 2897
161 Ga0207690_10077369 3300025932 Bacteria 2312
162 Ga0207706_10029633 3300025933 Bacteria 4885
163 Ga0207706_10090023 3300025933 Unclassified 2698
164 Ga0207669_10002440 3300025937 Bacteria 7928
165 Ga0207704_10181662 3300025938 Bacteria 1521
166 Ga0207704_10615599 3300025938 Unclassified 891
167 Ga0207665_10032127 3300025939 Bacteria 3475
168 Ga0207711_10119885 3300025941 Bacteria 2348
169 Ga0207711_10128947 3300025941 Bacteria 2266
170 Ga0207661_10136929 3300025944 Bacteria 2104
171 Ga0207661_10228052 3300025944 Bacteria 1648
172 Ga0207667_10004072 3300025949 Bacteria 17963
173 Ga0207667_10010423 3300025949 Bacteria 10866
174 Ga0207667_10036360 3300025949 Bacteria 5279
175 Ga0207667_10346505 3300025949 Bacteria 1515
176 Ga0207703_10117857 3300026035 Unclassified 2275
177 Ga0207639_10012271 3300026041 Bacteria 5967
178 Ga0207702_10095774 3300026078 Bacteria 2609
179 Ga0207702_10115002 3300026078 Unclassified 2399
180 Ga0207702_10116749 3300026078 Bacteria 2382
181 Ga0207702_10520968 3300026078 Bacteria 1161
182 Ga0207641_10334410 3300026088 Bacteria 1440
183 Ga0207674_10051969 3300026116 Bacteria 4180
184 Ga0207675_100031575 3300026118 Bacteria 4934
185 Ga0207698_10082262 3300026142 Bacteria 2602
186 Ga0207698_10249915 3300026142 Bacteria 1622
187 Ga0268266_10258632 3300028379 Bacteria 1613
188 Ga0268264_10616201 3300028381 Bacteria 1071
189 Ga0265338_10000750 3300028800 Bacteria 55295
190 Ga0265338_10205347 3300028800 Bacteria 1483
191 Ga0265339_10049447 3300031249 Bacteria 2302
192 Ga0265339_10072608 3300031249 Bacteria 1831
193 Ga0265316_10005797 3300031344 Bacteria 11917
194 Ga0265314_10002993 3300031711 Bacteria 16724
195 Ga0265314_10013053 3300031711 Bacteria 6741
196 Ga0373926_0001607 3300035083 Bacteria 6956
197 Ga0373926_0063939 3300035083 Bacteria 1344
198 Ga0373934_0000303 3300035086 Bacteria 17350
199 Ga0373923_0003177 3300035111 Bacteria 5221
200 Ga0373923_0034829 3300035111 Bacteria 2046
201 Ga0373923_0068876 3300035111 Bacteria 1516
202 Ga0373936_0025425 3300035113 Bacteria 2315
203 Ga0373941_0122026 3300035115 Bacteria 930
204 Ga0373945_0002402 3300035116 Bacteria 5872
205 Ga0373953_0005465 3300035117 Bacteria 4128
206 Ga0373954_0000123 3300035118 Bacteria 26172
207 Ga0373956_0032155 3300035119 Bacteria 2301
208 Ga0373956_0111163 3300035119 Bacteria 1276
209 Ga0373956_0112913 3300035119 Bacteria 1265
210 Ga0373956_0168386 3300035119 Bacteria 1034
211 Ga0373943_0003767 3300035170 Bacteria 6888
212 Ga0373943_0070197 3300035170 Bacteria 1772
213 Ga0373946_0064009 3300035171 Unclassified 1572
214 Ga0373955_0000328 3300035172 Bacteria 19745
215 Ga0373924_0011308 3300035410 Bacteria 3312
216 Ga0373924_0053826 3300035410 Bacteria 1672
217 Ga0373935_0008245 3300035692 Bacteria 6236
218 Ga0373935_0087670 3300035692 Bacteria 2032
219 Ga0373935_0173880 3300035692 Bacteria 1475
220 Ga0373927_0002459 3300035695 Bacteria 13514
221 Ga0373927_0024716 3300035695 Bacteria 3925
222 Ga0373927_0051480 3300035695 Bacteria 2663
223 Ga0373927_0174429 3300035695 Unclassified 1410
224 Ga0373927_0217666 3300035695 Bacteria 1254
225 Ga0373933_0001026 3300035724 Bacteria 16986
226 Ga0373933_0064146 3300035724 Bacteria 2222
227 Ga0373933_0222445 3300035724 Bacteria 1211
228 Ga0373947_0017726 3300035725 Bacteria 4096
229 Ga0373947_0094764 3300035725 Bacteria 1867
230 Ga0373947_0200273 3300035725 Bacteria 1306
231 Ga0373947_0300314 3300035725 Bacteria 1070
232 Ga0373937_0000484 3300036401 Bacteria 36426
233 Ga0373937_0002671 3300036401 Bacteria 14863
234 Ga0373937_0130021 3300036401 Bacteria 2351
235 Ga0373937_0300619 3300036401 Bacteria 1517
236 Ga0373937_0317102 3300036401 Unclassified 1475
237 Ga0373925_0004986 3300037068 Bacteria 9969
238 Ga0373925_0013643 3300037068 Bacteria 5883
239 Ga0373925_0027524 3300037068 Bacteria 4160
240 Ga0373925_0093079 3300037068 Bacteria 2306
241 Ga0373925_0107335 3300037068 Bacteria 2153
242 Ga0436364_0274913 3300037853 Bacteria 5531
243 Ga0436364_0275743 3300037853 Bacteria 7064
244 Ga0436364_0795669 3300037853 Bacteria 5102
245 Ga0436364_1009930 3300037853 Bacteria 1310
246 Ga0395901_0137475 3300038443 Bacteria 2568
247 Ga0436365_1544070 3300039437 Bacteria 7409
248 Ga0436363_1062809 3300039450 Bacteria 3800
249 Ga0451791_1073183 3300041451 Bacteria 1073
250 Ga0450908_028866 3300042184 Bacteria 965
251 Ga0450918_007130 3300042531 Bacteria 1987
252 Ga0466957_0000173 3300044842 Bacteria 28668
253 Ga0466959_0004734 3300045049 Bacteria 9165
254 Ga0451576_0314868 3300045051 Bacteria 1637
255 Ga0466967_0008287 3300045976 Bacteria 7596
256 Ga0495592_0077129 3300046454 Unclassified 2417
257 Ga0495651_0025802 3300046462 Bacteria 4576
258 Ga0495651_0057802 3300046462 Bacteria 2977
259 Ga0495653_0098101 3300046463 Bacteria 2128
260 Ga0495580_0001613 3300046472 Bacteria 19841
261 Ga0495580_0048940 3300046472 Bacteria 2991
262 Ga0495580_0324498 3300046472 Bacteria 1046
263 Ga0495594_0008549 3300046499 Bacteria 5278
264 Ga0495608_0039226 3300046511 Bacteria 3176
265 Ga0495628_0202598 3300046516 Bacteria 1495
266 Ga0495663_0026319 3300046525 Unclassified 1702
267 Ga0495652_0059586 3300046529 Bacteria 3230
268 Ga0495665_0010073 3300046531 Bacteria 5121
269 Ga0495665_0030018 3300046531 Bacteria 2910
270 Ga0495587_0004339 3300046536 Bacteria 9360
271 Ga0495599_0167901 3300046678 Bacteria 1355
272 Ga0495623_0010485 3300046679 Bacteria 5998
273 Ga0495604_0000257 3300047317 Bacteria 47142
274 Ga0495604_0036197 3300047317 Unclassified 3892
275 Ga0495675_0097964 3300047444 Bacteria 1837
276 Ga0495684_0001093 3300047471 Bacteria 21862
277 Ga0495602_0004292 3300048088 Bacteria 14846
278 Ga0495602_0381401 3300048088 Unclassified 1010
279 Ga0496102_0019529 3300048905 Bacteria 5970
280 Ga0496102_0114747 3300048905 Bacteria 2513
281 Ga0496102_0524230 3300048905 Bacteria 1107
282 Ga0496103_0036626 3300048906 Bacteria 3005
283 Ga0496104_0014621 3300048907 Bacteria 7091
284 Ga0496104_0240332 3300048907 Bacteria 1723
285 Ga0496104_0348259 3300048907 Bacteria 1394
286 Ga0496105_0017277 3300048908 Bacteria 5780
287 Ga0496111_0003341 3300048914 Bacteria 9919
288 Ga0496112_0010251 3300048915 Bacteria 8495
289 Ga0496112_0223270 3300048915 Bacteria 1840
290 Ga0496113_0012257 3300048916 Bacteria 5755
291 Ga0496113_0098007 3300048916 Bacteria 2269
292 Ga0496115_0044123 3300048918 Bacteria 3555
293 Ga0496115_0167709 3300048918 Bacteria 1816
294 Ga0501031_0002524 3300049568 Bacteria 11651
295 Ga0501031_0042766 3300049568 Bacteria 2957
296 Ga0501032_0038975 3300049569 Bacteria 3234
297 Ga0501033_0018983 3300049570 Bacteria 5198
298 Ga0501033_0019173 3300049570 Bacteria 5172
299 Ga0501033_0034939 3300049570 Bacteria 3768
300 Ga0501033_0060263 3300049570 Bacteria 2801
301 Ga0501033_0278984 3300049570 Bacteria 1180
302 Ga0501034_0355096 3300049571 Unclassified 1393
303 Ga0501036_0000076 3300049572 Bacteria 60845
304 Ga0501036_0007328 3300049572 Bacteria 8986
305 Ga0501036_0041960 3300049572 Bacteria 3873
306 Ga0501037_0002759 3300049573 Bacteria 12708
307 Ga0501037_0127055 3300049573 Bacteria 1830
308 Ga0501038_0005397 3300049574 Bacteria 11882
309 Ga0501038_0018333 3300049574 Bacteria 6319
310 Ga0501038_0041658 3300049574 Bacteria 4004
311 Ga0501038_0158072 3300049574 Bacteria 1844
312 Ga0501038_0364678 3300049574 Bacteria 1123
313 Ga0501039_0005957 3300049575 Bacteria 9237
314 Ga0501039_0025123 3300049575 Bacteria 4576
315 Ga0501039_0032505 3300049575 Bacteria 4023
316 Ga0501039_0087210 3300049575 Bacteria 2431
317 Ga0501039_0112458 3300049575 Bacteria 2129
318 Ga0501040_0016765 3300049576 Bacteria 4856
319 Ga0501040_0058911 3300049576 Bacteria 2638
320 Ga0501040_0062979 3300049576 Bacteria 2551
321 Ga0501040_0366680 3300049576 Bacteria 1032
322 Ga0501041_0002279 3300049577 Bacteria 10860
323 Ga0501041_0006575 3300049577 Bacteria 6808
324 Ga0501041_0010037 3300049577 Bacteria 5579
325 Ga0501041_0023770 3300049577 Bacteria 3675
326 Ga0501041_0095312 3300049577 Bacteria 1839
327 Ga0501041_0096360 3300049577 Unclassified 1829
328 Ga0501042_0015943 3300049578 Bacteria 5153
329 Ga0501042_0264777 3300049578 Unclassified 1241
330 Ga0501043_0026638 3300049579 Unclassified 4536
331 Ga0501043_0127224 3300049579 Unclassified 1998
332 Ga0501043_0181495 3300049579 Bacteria 1640
333 Ga0501046_0000757 3300049580 Bacteria 31241
334 Ga0501046_0015694 3300049580 Bacteria 6358
335 Ga0501046_0016680 3300049580 Bacteria 6145
336 Ga0501046_0066895 3300049580 Bacteria 2799
337 Ga0501047_0014410 3300049581 Bacteria 7517
338 Ga0501047_0018297 3300049581 Bacteria 6714
339 Ga0501047_0221083 3300049581 Bacteria 1750
340 Ga0501048_0002408 3300049582 Bacteria 14275
341 Ga0501048_0004072 3300049582 Bacteria 11126
342 Ga0501048_0009083 3300049582 Bacteria 7482
343 Ga0501048_0161805 3300049582 Bacteria 1584
344 Ga0501067_0003817 3300049583 Bacteria 8313
345 Ga0501068_0003338 3300049584 Bacteria 8612
346 Ga0501068_0021376 3300049584 Bacteria 3778
347 Ga0501068_0059933 3300049584 Bacteria 2311
348 Ga0501069_0007228 3300049585 Bacteria 5821
349 Ga0501069_0039836 3300049585 Bacteria 2596
350 Ga0501070_0002074 3300049586 Bacteria 17596
351 Ga0501071_0006539 3300049587 Bacteria 7567
352 Ga0501071_0013098 3300049587 Bacteria 5646
353 Ga0501071_0016714 3300049587 Bacteria 5046
354 Ga0501071_0094487 3300049587 Bacteria 2199
355 Ga0501071_0173418 3300049587 Bacteria 1615
356 Ga0501072_0001332 3300049588 Bacteria 18500
357 Ga0501072_0014040 3300049588 Bacteria 6138
358 Ga0501072_0018110 3300049588 Bacteria 5416
359 Ga0501072_0030332 3300049588 Bacteria 4228
360 Ga0501072_0112988 3300049588 Bacteria 2162
361 Ga0501074_0007236 3300049590 Bacteria 8017
362 Ga0501074_0013377 3300049590 Bacteria 5966
363 Ga0501075_0002402 3300049591 Bacteria 12442
364 Ga0501075_0007652 3300049591 Bacteria 7497
365 Ga0501075_0024981 3300049591 Unclassified 4387
366 Ga0501075_0085094 3300049591 Bacteria 2395
367 Ga0501075_0239157 3300049591 Bacteria 1384
368 Ga0501076_0000781 3300049592 Bacteria 20543
369 Ga0501076_0001304 3300049592 Bacteria 16640
370 Ga0501076_0021113 3300049592 Bacteria 4990
371 Ga0501076_0028521 3300049592 Bacteria 4335
372 Ga0501076_0082725 3300049592 Bacteria 2577
373 Ga0501076_0236859 3300049592 Bacteria 1493
374 Ga0501077_0001586 3300049593 Bacteria 13692
375 Ga0501077_0017234 3300049593 Bacteria 4557
376 Ga0501077_0068817 3300049593 Bacteria 2244
377 Ga0501077_0079350 3300049593 Bacteria 2080
378 Ga0501079_0003060 3300049741 Bacteria 12238
379 Ga0501079_0004748 3300049741 Bacteria 10068
380 Ga0501079_0009517 3300049741 Bacteria 7366
381 Ga0501079_0046126 3300049741 Bacteria 3362
382 Ga0501079_0091170 3300049741 Bacteria 2361
383 Ga0501079_0197818 3300049741 Bacteria 1569
384 Ga0501079_0235501 3300049741 Bacteria 1430
385 Ga0501079_0328300 3300049741 Bacteria 1198
386 Ga0501080_0000049 3300049742 Bacteria 76472
387 Ga0501080_0046600 3300049742 Bacteria 4035
388 Ga0501080_0123122 3300049742 Bacteria 2402
389 Ga0501081_0000240 3300049743 Bacteria 28015
390 Ga0501081_0017232 3300049743 Unclassified 4779
391 Ga0501081_0018077 3300049743 Bacteria 4677
392 Ga0501081_0030931 3300049743 Bacteria 3627
393 Ga0501081_0103382 3300049743 Unclassified 2016
394 Ga0501081_0152070 3300049743 Bacteria 1663
395 Ga0501035_0012443 3300049822 Bacteria 7864
396 Ga0501035_0013125 3300049822 Bacteria 7645
397 Ga0501035_0022632 3300049822 Bacteria 5773
398 Ga0501044_0004617 3300049823 Bacteria 15411
399 Ga0501045_0000066 3300049824 Bacteria 48342
400 Ga0501045_0021173 3300049824 Bacteria 4649
401 Ga0501045_0055824 3300049824 Bacteria 2888
402 Ga0501045_0057365 3300049824 Bacteria 2849
403 nmdc:mga0k408_93097_c1 3300050493 Bacteria 1772
404 nmdc:mga05p37_112_c1 3300050507 Bacteria 73572
405 nmdc:mga0n895_124476_c1 3300050512 Bacteria 2601
406 nmdc:mga0n895_238471_c1 3300050512 Unclassified 1845
407 nmdc:mga0a205_36495_c1 3300050515 Bacteria 4722
408 Ga0495619_0019463 3300053085 Bacteria 4317
409 Ga0500568_0055175 3300053139 Unclassified 1551
410 Ga0501084_0005002 3300054114 Bacteria 10842
411 Ga0501084_0005325 3300054114 Bacteria 10535
412 Ga0501084_0030646 3300054114 Bacteria 4497
413 Ga0501084_0047353 3300054114 Bacteria 3601
414 Ga0501084_0057116 3300054114 Bacteria 3266
415 Ga0501084_0575742 3300054114 Bacteria 951
416 Ga0501082_0003569 3300060353 Bacteria 13580
417 Ga0501082_0003717 3300060353 Bacteria 13332
418 Ga0501082_0023330 3300060353 Bacteria 5337
419 Ga0501082_0111080 3300060353 Bacteria 2372
420 Ga0501082_0134260 3300060353 Bacteria 2147
421 Ga0501082_0216350 3300060353 Unclassified 1667
422 Ga0501082_0376984 3300060353 Bacteria 1238
423 Ga0466962_0140490 3300061719 Bacteria 1170
424 Ga0530510_0000772 3300061734 Bacteria 20824
425 Ga0530510_0020380 3300061734 Unclassified 4714
426 Ga0530510_0132439 3300061734 Unclassified 1835
427 Ga0530510_0237394 3300061734 Bacteria 1357
428 Ga0207663_10014708
429 MBSR1b_contig_10062352
430 Ga0058861_11992058
431 Ga0070658_10019953
432 Ga0068869_100098978
433 Ga0070666_10056437
434 Ga0070680_100010286
435 Ga0070680_100059231
436 Ga0068868_100346709
437 Ga0070660_100051598
438 Ga0070660_100115924
439 Ga0070675_100001345
440 Ga0070674_100001329
441 Ga0070674_100195751
442 Ga0070659_100064591
443 Ga0070659_100066729
444 Ga0070703_10012385
445 Ga0070709_10009465
446 Ga0070709_10025918
447 Ga0070709_10322153
448 Ga0070713_100212257
449 Ga0070710_10242161
450 Ga0070711_100015198
451 Ga0070711_100088212
452 Ga0070711_100164531
453 Ga0070705_100007876
454 Ga0070694_100021655
455 Ga0070708_100017395
456 Ga0070662_100152230
457 Ga0070681_10044528
458 Ga0070681_10044601
459 Ga0070681_10056938
460 Ga0070681_10106959
461 Ga0070681_10206646
462 Ga0070681_10209560
463 Ga0070706_100014925
464 Ga0070706_100299475
465 Ga0070698_100395187
466 Ga0070699_100009693
467 Ga0070699_100099008
468 Ga0070679_100004784
469 Ga0070679_100006710
470 Ga0070684_100082939
471 Ga0070684_100111017
472 Ga0070684_100206938
473 Ga0070697_100000335
474 Ga0068853_100101439
475 Ga0070686_100012734
476 Ga0070686_100199265
477 Ga0070695_100006165
478 Ga0070693_100008341
479 Ga0070693_100024020
480 Ga0070665_100179794
481 Ga0070704_100002936
482 Ga0068855_100005945
483 Ga0068855_100028134
484 Ga0068855_100078935
485 Ga0068855_100449141
486 Ga0070664_100223564
487 Ga0068856_100012972
488 Ga0068856_100563347
489 Ga0068852_100029211
490 Ga0068852_100047949
491 Ga0068859_100126896
492 Ga0068861_100141115
493 Ga0068862_100072947
494 Ga0068862_100095782
495 Ga0070717_10000072
496 Ga0070717_10062690
497 Ga0070716_100104517
498 Ga0070712_100069202
499 Ga0070712_100099968
500 Ga0075367_10009773
501 Ga0075366_10076022
502 Ga0068871_100116528
503 Ga0075428_100134051
504 Ga0075430_100051061
505 Ga0075430_100420409
506 Ga0075434_100443808
507 Ga0075436_100121883
508 Ga0097620_100126898
509 Ga0105240_10001445
510 Ga0105240_10159935
511 Ga0105240_10296193
512 Ga0105240_10351815
513 Ga0105240_10469990
514 Ga0105245_10001277
515 Ga0105245_10144536
516 Ga0114129_10171312
517 Ga0105241_10131415
518 Ga0105241_10163994
519 Ga0105242_10071782
520 Ga0105242_10231703
521 Ga0105248_10010725
522 Ga0105248_10088424
523 Ga0105248_10184694
524 Ga0105237_10002642
525 Ga0105238_10027037
526 Ga0105238_10080059
527 Ga0105238_10160037
528 Ga0105239_10003562
529 Ga0105239_10005855
530 Ga0105239_10046289
531 Ga0105239_10051245
532 Ga0105239_10234107
533 Ga0105239_10320036
534 Ga0157370_10014291
535 Ga0157370_10047273
536 Ga0157370_10123299
537 Ga0157370_10271386
538 Ga0157369_10021520
539 Ga0157369_10024109
540 Ga0157369_10270436
541 Ga0157369_10289359
542 Ga0157369_10374880
543 Ga0157369_10570209
544 Ga0157369_10718900
545 Ga0157374_10045955
546 Ga0157374_10065756
547 Ga0157374_10099802
548 Ga0157378_10049950
549 Ga0157378_10127698
550 Ga0163162_10003010
551 Ga0157372_10038756
552 Ga0157372_10085203
553 Ga0163163_10000059
554 Ga0163163_10191333
555 Ga0157380_10649422
556 Ga0157379_10253128
557 Ga0213876_10049008
558 Ga0213875_10003491
559 Ga0213875_10067197
560 Ga0213875_10106903
561 Ga0224712_10104244
562 Ga0207713_1090403
563 Ga0207653_10018979
564 Ga0207705_10060519
565 Ga0207684_10002645
566 Ga0207654_10181545
567 Ga0207707_10012251
568 Ga0207707_10056277
569 Ga0207707_10065494
570 Ga0207707_10204265
571 Ga0207707_10288357
572 Ga0207695_10008516
573 Ga0207695_10084534
574 Ga0207695_10273399
575 Ga0207693_10009746
576 Ga0207660_10003127
577 Ga0207660_10289505
578 Ga0207657_10001616
579 Ga0207652_10204369
580 Ga0207694_10080675
581 Ga0207659_10148599
582 Ga0207687_10001897
583 Ga0207687_10028905
584 Ga0207700_10005732
585 Ga0207700_10440680
586 Ga0207664_10425437
587 Ga0207690_10045589
588 Ga0207690_10077369
589 Ga0207706_10029633
590 Ga0207706_10090023
591 Ga0207669_10002440
592 Ga0207704_10181662
593 Ga0207704_10615599
594 Ga0207665_10032127
595 Ga0207711_10119885
596 Ga0207711_10128947
597 Ga0207661_10136929
598 Ga0207661_10228052
599 Ga0207667_10004072
600 Ga0207667_10010423
601 Ga0207667_10036360
602 Ga0207667_10346505
603 Ga0207703_10117857
604 Ga0207639_10012271
605 Ga0207702_10095774
606 Ga0207702_10115002
607 Ga0207702_10116749
608 Ga0207702_10520968
609 Ga0207641_10334410
610 Ga0207674_10051969
611 Ga0207675_100031575
612 Ga0207698_10082262
613 Ga0207698_10249915
614 Ga0268266_10258632
615 Ga0268264_10616201
616 Ga0265338_10000750
617 Ga0265338_10205347
618 Ga0265339_10049447
619 Ga0265339_10072608
620 Ga0265316_10005797
621 Ga0265314_10002993
622 Ga0265314_10013053
623 Ga0373926_0001607
624 Ga0373926_0063939
625 Ga0373934_0000303
626 Ga0373923_0003177
627 Ga0373923_0034829
628 Ga0373923_0068876
629 Ga0373936_0025425
630 Ga0373941_0122026
631 Ga0373945_0002402
632 Ga0373953_0005465
633 Ga0373954_0000123
634 Ga0373956_0032155
635 Ga0373956_0111163
636 Ga0373956_0112913
637 Ga0373956_0168386
638 Ga0373943_0003767
639 Ga0373943_0070197
640 Ga0373946_0064009
641 Ga0373955_0000328
642 Ga0373924_0011308
643 Ga0373924_0053826
644 Ga0373935_0008245
645 Ga0373935_0087670
646 Ga0373935_0173880
647 Ga0373927_0002459
648 Ga0373927_0024716
649 Ga0373927_0051480
650 Ga0373927_0174429
651 Ga0373927_0217666
652 Ga0373933_0001026
653 Ga0373933_0064146
654 Ga0373933_0222445
655 Ga0373947_0017726
656 Ga0373947_0094764
657 Ga0373947_0200273
658 Ga0373947_0300314
659 Ga0373937_0000484
660 Ga0373937_0002671
661 Ga0373937_0130021
662 Ga0373937_0300619
663 Ga0373937_0317102
664 Ga0373925_0004986
665 Ga0373925_0013643
666 Ga0373925_0027524
667 Ga0373925_0093079
668 Ga0373925_0107335
669 Ga0436364_0274913
670 Ga0436364_0275743
671 Ga0436364_0795669
672 Ga0436364_1009930
673 Ga0395901_0137475
674 Ga0436365_1544070
675 Ga0436363_1062809
676 Ga0451791_1073183
677 Ga0450908_028866
678 Ga0450918_007130
679 Ga0466957_0000173
680 Ga0466959_0004734
681 Ga0451576_0314868
682 Ga0466967_0008287
683 Ga0495592_0077129
684 Ga0495651_0025802
685 Ga0495651_0057802
686 Ga0495653_0098101
687 Ga0495580_0001613
688 Ga0495580_0048940
689 Ga0495580_0324498
690 Ga0495594_0008549
691 Ga0495608_0039226
692 Ga0495628_0202598
693 Ga0495663_0026319
694 Ga0495652_0059586
695 Ga0495665_0010073
696 Ga0495665_0030018
697 Ga0495587_0004339
698 Ga0495599_0167901
699 Ga0495623_0010485
700 Ga0495604_0000257
701 Ga0495604_0036197
702 Ga0495675_0097964
703 Ga0495684_0001093
704 Ga0495602_0004292
705 Ga0495602_0381401
706 Ga0496102_0019529
707 Ga0496102_0114747
708 Ga0496102_0524230
709 Ga0496103_0036626
710 Ga0496104_0014621
711 Ga0496104_0240332
712 Ga0496104_0348259
713 Ga0496105_0017277
714 Ga0496111_0003341
715 Ga0496112_0010251
716 Ga0496112_0223270
717 Ga0496113_0012257
718 Ga0496113_0098007
719 Ga0496115_0044123
720 Ga0496115_0167709
721 Ga0501031_0002524
722 Ga0501031_0042766
723 Ga0501032_0038975
724 Ga0501033_0018983
725 Ga0501033_0019173
726 Ga0501033_0034939
727 Ga0501033_0060263
728 Ga0501033_0278984
729 Ga0501034_0355096
730 Ga0501036_0000076
731 Ga0501036_0007328
732 Ga0501036_0041960
733 Ga0501037_0002759
734 Ga0501037_0127055
735 Ga0501038_0005397
736 Ga0501038_0018333
737 Ga0501038_0041658
738 Ga0501038_0158072
739 Ga0501038_0364678
740 Ga0501039_0005957
741 Ga0501039_0025123
742 Ga0501039_0032505
743 Ga0501039_0087210
744 Ga0501039_0112458
745 Ga0501040_0016765
746 Ga0501040_0058911
747 Ga0501040_0062979
748 Ga0501040_0366680
749 Ga0501041_0002279
750 Ga0501041_0006575
751 Ga0501041_0010037
752 Ga0501041_0023770
753 Ga0501041_0095312
754 Ga0501041_0096360
755 Ga0501042_0015943
756 Ga0501042_0264777
757 Ga0501043_0026638
758 Ga0501043_0127224
759 Ga0501043_0181495
760 Ga0501046_0000757
761 Ga0501046_0015694
762 Ga0501046_0016680
763 Ga0501046_0066895
764 Ga0501047_0014410
765 Ga0501047_0018297
766 Ga0501047_0221083
767 Ga0501048_0002408
768 Ga0501048_0004072
769 Ga0501048_0009083
770 Ga0501048_0161805
771 Ga0501067_0003817
772 Ga0501068_0003338
773 Ga0501068_0021376
774 Ga0501068_0059933
775 Ga0501069_0007228
776 Ga0501069_0039836
777 Ga0501070_0002074
778 Ga0501071_0006539
779 Ga0501071_0013098
780 Ga0501071_0016714
781 Ga0501071_0094487
782 Ga0501071_0173418
783 Ga0501072_0001332
784 Ga0501072_0014040
785 Ga0501072_0018110
786 Ga0501072_0030332
787 Ga0501072_0112988
788 Ga0501074_0007236
789 Ga0501074_0013377
790 Ga0501075_0002402
791 Ga0501075_0007652
792 Ga0501075_0024981
793 Ga0501075_0085094
794 Ga0501075_0239157
795 Ga0501076_0000781
796 Ga0501076_0001304
797 Ga0501076_0021113
798 Ga0501076_0028521
799 Ga0501076_0082725
800 Ga0501076_0236859
801 Ga0501077_0001586
802 Ga0501077_0017234
803 Ga0501077_0068817
804 Ga0501077_0079350
805 Ga0501079_0003060
806 Ga0501079_0004748
807 Ga0501079_0009517
808 Ga0501079_0046126
809 Ga0501079_0091170
810 Ga0501079_0197818
811 Ga0501079_0235501
812 Ga0501079_0328300
813 Ga0501080_0000049
814 Ga0501080_0046600
815 Ga0501080_0123122
816 Ga0501081_0000240
817 Ga0501081_0017232
818 Ga0501081_0018077
819 Ga0501081_0030931
820 Ga0501081_0103382
821 Ga0501081_0152070
822 Ga0501035_0012443
823 Ga0501035_0013125
824 Ga0501035_0022632
825 Ga0501044_0004617
826 Ga0501045_0000066
827 Ga0501045_0021173
828 Ga0501045_0055824
829 Ga0501045_0057365
830 nmdc:mga0k408_93097_c1
831 nmdc:mga05p37_112_c1
832 nmdc:mga0n895_124476_c1
833 nmdc:mga0n895_238471_c1
834 nmdc:mga0a205_36495_c1
835 Ga0495619_0019463
836 Ga0500568_0055175
837 Ga0501084_0005002
838 Ga0501084_0005325
839 Ga0501084_0030646
840 Ga0501084_0047353
841 Ga0501084_0057116
842 Ga0501084_0575742
843 Ga0501082_0003569
844 Ga0501082_0003717
845 Ga0501082_0023330
846 Ga0501082_0111080
847 Ga0501082_0134260
848 Ga0501082_0216350
849 Ga0501082_0376984
850 Ga0466962_0140490
851 Ga0530510_0000772
852 Ga0530510_0020380
853 Ga0530510_0132439
854 Ga0530510_0237394

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

281

310

0.97

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

173

263

0.92

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

42

158

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pcz-assembly1.cif.gz_A crystal structure of a complex between r247g llfpg mutant and a thf containing dna 0.8478 2 250
6rok-assembly1.cif.gz_A the crystal structure of a complex between the llfpg protein, a thf-dna and an inhibitor 0.8462 2 250
1nnj-assembly1.cif.gz_A crystal structure complex between the lactococcus lactis fpg and an abasic site containing dna 0.842 3 250
2xzu-assembly1.cif.gz_A crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and an oxidized pyrimidine containing dna at 310k 0.8414 2 250
6fl1-assembly1.cif.gz_A crystal structure of the complex between the lactococcus lactis fpg mutant t221p and a fapy-dg containing dna 0.8408 2 250
ID Description Score Start End Superfamily
3sarA02 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8888 141 249 1.10.8.50
1kfvB01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8755 3 132 3.20.190.10
af_L0T864_10_149_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.8689 141 256 1.10.8.50
af_P05523_2_128_3.20.190.10 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8628 2 123 3.20.190.10
1ee8B01 Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal 0.8472 2 123 3.20.190.10
ID Description Score Start End GO Terms
AF-A0A2V8FV99-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9557 1 130 GO:0003906
GO:0006284
GO:0008270
GO:0019104
AF-A0A521KCW9-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9354 1 109 GO:0003906
GO:0006284
GO:0008270
GO:0019104
AF-A0A2V6TE40-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9345 148 278 GO:0003684
GO:0003906
GO:0006284
GO:0008270
GO:0034039
AF-A0A2V8FV99-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9344 1 130 GO:0003906
GO:0006284
GO:0008270
GO:0019104
AF-A0A536XPJ5-F1-model_v4 Formamidopyrimidine-DNA glycosylase 0.9316 173 276 GO:0003906
GO:0006284
GO:0008270
GO:0016799

Map