F441461
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 427 | 206 | 854 | 299 |
Family's Representative Sequence
| Representative Sequence | 3300025916|Ga0207663_10014708|Ga0207663_100147083 |
| Length | 340 |
| Sequence | VKQHIAVEGEADLRAEPTDVGLTNPTTSNLCKRFGAKRQRKMPELPDIVVYMEALEQRVVGHVLENLEVRGPSLLRTADPPVYSVQGQRVTALRRIGKRIAFGFDNDLWLVFHLMIAGRLHWSQKKKTADGRRTLAAFDFDNGTLTLTEAGTRKRASLHLVRGEAGLAALDPGGVDVFAVSLDQFSAVLTSANHTLKRALTDPRLFSGIGNAYSDEILFHAQLSPVLLTQRMKPEEIKRLYEATKQTLTLWTENLRKESGTKFPEKVTAFRDEMAVHGRYGKPCPRCGAKVQRIRYASNETDYCPHCQTGGKLLADRSLSRLLRQDWPRTPEELEERRRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 39 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 40 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 41 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 46 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 47 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 48 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 49 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 50 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 51 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 72 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 73 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 112 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 116 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 117 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 118 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 119 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 120 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 122 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 123 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 124 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 125 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 126 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 127 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 128 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 130 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 133 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 134 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 135 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 136 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 137 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 159 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 160 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 161 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 162 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 163 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 164 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 165 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 166 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 192 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 203 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 206 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 3.75 |
| Rhizosphere | 92.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207663_10014708 | 3300025916 | Bacteria | 4295 |
| 2 | MBSR1b_contig_10062352 | 2162886012 | Bacteria | 1268 |
| 3 | Ga0058861_11992058 | 3300004800 | Unclassified | 1163 |
| 4 | Ga0070658_10019953 | 3300005327 | Bacteria | 5369 |
| 5 | Ga0068869_100098978 | 3300005334 | Bacteria | 2204 |
| 6 | Ga0070666_10056437 | 3300005335 | Bacteria | 2652 |
| 7 | Ga0070680_100010286 | 3300005336 | Bacteria | 7211 |
| 8 | Ga0070680_100059231 | 3300005336 | Unclassified | 3132 |
| 9 | Ga0068868_100346709 | 3300005338 | Bacteria | 1271 |
| 10 | Ga0070660_100051598 | 3300005339 | Bacteria | 3168 |
| 11 | Ga0070660_100115924 | 3300005339 | Bacteria | 2136 |
| 12 | Ga0070675_100001345 | 3300005354 | Bacteria | 18013 |
| 13 | Ga0070674_100001329 | 3300005356 | Bacteria | 13027 |
| 14 | Ga0070674_100195751 | 3300005356 | Unclassified | 1557 |
| 15 | Ga0070659_100064591 | 3300005366 | Bacteria | 2897 |
| 16 | Ga0070659_100066729 | 3300005366 | Bacteria | 2852 |
| 17 | Ga0070703_10012385 | 3300005406 | Bacteria | 2416 |
| 18 | Ga0070709_10009465 | 3300005434 | Bacteria | 5378 |
| 19 | Ga0070709_10025918 | 3300005434 | Bacteria | 3469 |
| 20 | Ga0070709_10322153 | 3300005434 | Unclassified | 1135 |
| 21 | Ga0070713_100212257 | 3300005436 | Bacteria | 1753 |
| 22 | Ga0070710_10242161 | 3300005437 | Bacteria | 1156 |
| 23 | Ga0070711_100015198 | 3300005439 | Bacteria | 4868 |
| 24 | Ga0070711_100088212 | 3300005439 | Bacteria | 2228 |
| 25 | Ga0070711_100164531 | 3300005439 | Bacteria | 1685 |
| 26 | Ga0070705_100007876 | 3300005440 | Bacteria | 5262 |
| 27 | Ga0070694_100021655 | 3300005444 | Bacteria | 4111 |
| 28 | Ga0070708_100017395 | 3300005445 | Bacteria | 5995 |
| 29 | Ga0070662_100152230 | 3300005457 | Unclassified | 1802 |
| 30 | Ga0070681_10044528 | 3300005458 | Bacteria | 4442 |
| 31 | Ga0070681_10044601 | 3300005458 | Bacteria | 4439 |
| 32 | Ga0070681_10056938 | 3300005458 | Bacteria | 3889 |
| 33 | Ga0070681_10106959 | 3300005458 | Bacteria | 2739 |
| 34 | Ga0070681_10206646 | 3300005458 | Bacteria | 1881 |
| 35 | Ga0070681_10209560 | 3300005458 | Unclassified | 1865 |
| 36 | Ga0070706_100014925 | 3300005467 | Bacteria | 7176 |
| 37 | Ga0070706_100299475 | 3300005467 | Bacteria | 1501 |
| 38 | Ga0070698_100395187 | 3300005471 | Bacteria | 1316 |
| 39 | Ga0070699_100009693 | 3300005518 | Bacteria | 8339 |
| 40 | Ga0070699_100099008 | 3300005518 | Unclassified | 2555 |
| 41 | Ga0070679_100004784 | 3300005530 | Bacteria | 12486 |
| 42 | Ga0070679_100006710 | 3300005530 | Bacteria | 10735 |
| 43 | Ga0070684_100082939 | 3300005535 | Unclassified | 2840 |
| 44 | Ga0070684_100111017 | 3300005535 | Bacteria | 2459 |
| 45 | Ga0070684_100206938 | 3300005535 | Bacteria | 1788 |
| 46 | Ga0070697_100000335 | 3300005536 | Bacteria | 37062 |
| 47 | Ga0068853_100101439 | 3300005539 | Unclassified | 2545 |
| 48 | Ga0070686_100012734 | 3300005544 | Bacteria | 4801 |
| 49 | Ga0070686_100199265 | 3300005544 | Bacteria | 1434 |
| 50 | Ga0070695_100006165 | 3300005545 | Bacteria | 7087 |
| 51 | Ga0070693_100008341 | 3300005547 | Bacteria | 5102 |
| 52 | Ga0070693_100024020 | 3300005547 | Bacteria | 3265 |
| 53 | Ga0070665_100179794 | 3300005548 | Bacteria | 2116 |
| 54 | Ga0070704_100002936 | 3300005549 | Bacteria | 9687 |
| 55 | Ga0068855_100005945 | 3300005563 | Bacteria | 14877 |
| 56 | Ga0068855_100028134 | 3300005563 | Bacteria | 6723 |
| 57 | Ga0068855_100078935 | 3300005563 | Bacteria | 3818 |
| 58 | Ga0068855_100449141 | 3300005563 | Unclassified | 1407 |
| 59 | Ga0070664_100223564 | 3300005564 | Bacteria | 1685 |
| 60 | Ga0068856_100012972 | 3300005614 | Bacteria | 8068 |
| 61 | Ga0068856_100563347 | 3300005614 | Bacteria | 1161 |
| 62 | Ga0068852_100029211 | 3300005616 | Bacteria | 4526 |
| 63 | Ga0068852_100047949 | 3300005616 | Bacteria | 3648 |
| 64 | Ga0068859_100126896 | 3300005617 | Unclassified | 2621 |
| 65 | Ga0068861_100141115 | 3300005719 | Bacteria | 1966 |
| 66 | Ga0068862_100072947 | 3300005844 | Bacteria | 2966 |
| 67 | Ga0068862_100095782 | 3300005844 | Bacteria | 2590 |
| 68 | Ga0070717_10000072 | 3300006028 | Bacteria | 84584 |
| 69 | Ga0070717_10062690 | 3300006028 | Unclassified | 3084 |
| 70 | Ga0070716_100104517 | 3300006173 | Bacteria | 1743 |
| 71 | Ga0070712_100069202 | 3300006175 | Bacteria | 2517 |
| 72 | Ga0070712_100099968 | 3300006175 | Bacteria | 2142 |
| 73 | Ga0075367_10009773 | 3300006178 | Bacteria | 5025 |
| 74 | Ga0075366_10076022 | 3300006195 | Bacteria | 2004 |
| 75 | Ga0068871_100116528 | 3300006358 | Bacteria | 2252 |
| 76 | Ga0075428_100134051 | 3300006844 | Bacteria | 2693 |
| 77 | Ga0075430_100051061 | 3300006846 | Bacteria | 3486 |
| 78 | Ga0075430_100420409 | 3300006846 | Bacteria | 1103 |
| 79 | Ga0075434_100443808 | 3300006871 | Bacteria | 1319 |
| 80 | Ga0075436_100121883 | 3300006914 | Bacteria | 1825 |
| 81 | Ga0097620_100126898 | 3300006931 | Unclassified | 2621 |
| 82 | Ga0105240_10001445 | 3300009093 | Bacteria | 40579 |
| 83 | Ga0105240_10159935 | 3300009093 | Bacteria | 2676 |
| 84 | Ga0105240_10296193 | 3300009093 | Bacteria | 1852 |
| 85 | Ga0105240_10351815 | 3300009093 | Unclassified | 1671 |
| 86 | Ga0105240_10469990 | 3300009093 | Bacteria | 1404 |
| 87 | Ga0105245_10001277 | 3300009098 | Bacteria | 22704 |
| 88 | Ga0105245_10144536 | 3300009098 | Bacteria | 2243 |
| 89 | Ga0114129_10171312 | 3300009147 | Bacteria | 2960 |
| 90 | Ga0105241_10131415 | 3300009174 | Bacteria | 2028 |
| 91 | Ga0105241_10163994 | 3300009174 | Bacteria | 1829 |
| 92 | Ga0105242_10071782 | 3300009176 | Bacteria | 2874 |
| 93 | Ga0105242_10231703 | 3300009176 | Bacteria | 1655 |
| 94 | Ga0105248_10010725 | 3300009177 | Bacteria | 10115 |
| 95 | Ga0105248_10088424 | 3300009177 | Bacteria | 3487 |
| 96 | Ga0105248_10184694 | 3300009177 | Bacteria | 2350 |
| 97 | Ga0105237_10002642 | 3300009545 | Bacteria | 22062 |
| 98 | Ga0105238_10027037 | 3300009551 | Bacteria | 5848 |
| 99 | Ga0105238_10080059 | 3300009551 | Bacteria | 3256 |
| 100 | Ga0105238_10160037 | 3300009551 | Bacteria | 2227 |
| 101 | Ga0105239_10003562 | 3300010375 | Bacteria | 19042 |
| 102 | Ga0105239_10005855 | 3300010375 | Bacteria | 14331 |
| 103 | Ga0105239_10046289 | 3300010375 | Bacteria | 4767 |
| 104 | Ga0105239_10051245 | 3300010375 | Bacteria | 4525 |
| 105 | Ga0105239_10234107 | 3300010375 | Bacteria | 2061 |
| 106 | Ga0105239_10320036 | 3300010375 | Unclassified | 1749 |
| 107 | Ga0157370_10014291 | 3300013104 | Bacteria | 8125 |
| 108 | Ga0157370_10047273 | 3300013104 | Bacteria | 4126 |
| 109 | Ga0157370_10123299 | 3300013104 | Unclassified | 2419 |
| 110 | Ga0157370_10271386 | 3300013104 | Bacteria | 1567 |
| 111 | Ga0157369_10021520 | 3300013105 | Bacteria | 7213 |
| 112 | Ga0157369_10024109 | 3300013105 | Bacteria | 6772 |
| 113 | Ga0157369_10270436 | 3300013105 | Unclassified | 1771 |
| 114 | Ga0157369_10289359 | 3300013105 | Bacteria | 1706 |
| 115 | Ga0157369_10374880 | 3300013105 | Bacteria | 1477 |
| 116 | Ga0157369_10570209 | 3300013105 | Unclassified | 1169 |
| 117 | Ga0157369_10718900 | 3300013105 | Bacteria | 1028 |
| 118 | Ga0157374_10045955 | 3300013296 | Bacteria | 4042 |
| 119 | Ga0157374_10065756 | 3300013296 | Bacteria | 3406 |
| 120 | Ga0157374_10099802 | 3300013296 | Bacteria | 2782 |
| 121 | Ga0157378_10049950 | 3300013297 | Bacteria | 3722 |
| 122 | Ga0157378_10127698 | 3300013297 | Bacteria | 2351 |
| 123 | Ga0163162_10003010 | 3300013306 | Bacteria | 16108 |
| 124 | Ga0157372_10038756 | 3300013307 | Bacteria | 5259 |
| 125 | Ga0157372_10085203 | 3300013307 | Bacteria | 3584 |
| 126 | Ga0163163_10000059 | 3300014325 | Bacteria | 123393 |
| 127 | Ga0163163_10191333 | 3300014325 | Bacteria | 2095 |
| 128 | Ga0157380_10649422 | 3300014326 | Bacteria | 1052 |
| 129 | Ga0157379_10253128 | 3300014968 | Bacteria | 1599 |
| 130 | Ga0213876_10049008 | 3300021384 | Unclassified | 2231 |
| 131 | Ga0213875_10003491 | 3300021388 | Bacteria | 8945 |
| 132 | Ga0213875_10067197 | 3300021388 | Bacteria | 1675 |
| 133 | Ga0213875_10106903 | 3300021388 | Bacteria | 1306 |
| 134 | Ga0224712_10104244 | 3300022467 | Unclassified | 1208 |
| 135 | Ga0207713_1090403 | 3300025735 | Bacteria | 1077 |
| 136 | Ga0207653_10018979 | 3300025885 | Bacteria | 2167 |
| 137 | Ga0207705_10060519 | 3300025909 | Bacteria | 2735 |
| 138 | Ga0207684_10002645 | 3300025910 | Bacteria | 17926 |
| 139 | Ga0207654_10181545 | 3300025911 | Bacteria | 1373 |
| 140 | Ga0207707_10012251 | 3300025912 | Bacteria | 7455 |
| 141 | Ga0207707_10056277 | 3300025912 | Unclassified | 3422 |
| 142 | Ga0207707_10065494 | 3300025912 | Bacteria | 3165 |
| 143 | Ga0207707_10204265 | 3300025912 | Bacteria | 1722 |
| 144 | Ga0207707_10288357 | 3300025912 | Bacteria | 1420 |
| 145 | Ga0207695_10008516 | 3300025913 | Bacteria | 12824 |
| 146 | Ga0207695_10084534 | 3300025913 | Unclassified | 3204 |
| 147 | Ga0207695_10273399 | 3300025913 | Bacteria | 1585 |
| 148 | Ga0207693_10009746 | 3300025915 | Bacteria | 7822 |
| 149 | Ga0207660_10003127 | 3300025917 | Bacteria | 10823 |
| 150 | Ga0207660_10289505 | 3300025917 | Bacteria | 1302 |
| 151 | Ga0207657_10001616 | 3300025919 | Bacteria | 24238 |
| 152 | Ga0207652_10204369 | 3300025921 | Bacteria | 1778 |
| 153 | Ga0207694_10080675 | 3300025924 | Bacteria | 2554 |
| 154 | Ga0207659_10148599 | 3300025926 | Unclassified | 1827 |
| 155 | Ga0207687_10001897 | 3300025927 | Bacteria | 14374 |
| 156 | Ga0207687_10028905 | 3300025927 | Bacteria | 3726 |
| 157 | Ga0207700_10005732 | 3300025928 | Bacteria | 7461 |
| 158 | Ga0207700_10440680 | 3300025928 | Bacteria | 1147 |
| 159 | Ga0207664_10425437 | 3300025929 | Unclassified | 1183 |
| 160 | Ga0207690_10045589 | 3300025932 | Bacteria | 2897 |
| 161 | Ga0207690_10077369 | 3300025932 | Bacteria | 2312 |
| 162 | Ga0207706_10029633 | 3300025933 | Bacteria | 4885 |
| 163 | Ga0207706_10090023 | 3300025933 | Unclassified | 2698 |
| 164 | Ga0207669_10002440 | 3300025937 | Bacteria | 7928 |
| 165 | Ga0207704_10181662 | 3300025938 | Bacteria | 1521 |
| 166 | Ga0207704_10615599 | 3300025938 | Unclassified | 891 |
| 167 | Ga0207665_10032127 | 3300025939 | Bacteria | 3475 |
| 168 | Ga0207711_10119885 | 3300025941 | Bacteria | 2348 |
| 169 | Ga0207711_10128947 | 3300025941 | Bacteria | 2266 |
| 170 | Ga0207661_10136929 | 3300025944 | Bacteria | 2104 |
| 171 | Ga0207661_10228052 | 3300025944 | Bacteria | 1648 |
| 172 | Ga0207667_10004072 | 3300025949 | Bacteria | 17963 |
| 173 | Ga0207667_10010423 | 3300025949 | Bacteria | 10866 |
| 174 | Ga0207667_10036360 | 3300025949 | Bacteria | 5279 |
| 175 | Ga0207667_10346505 | 3300025949 | Bacteria | 1515 |
| 176 | Ga0207703_10117857 | 3300026035 | Unclassified | 2275 |
| 177 | Ga0207639_10012271 | 3300026041 | Bacteria | 5967 |
| 178 | Ga0207702_10095774 | 3300026078 | Bacteria | 2609 |
| 179 | Ga0207702_10115002 | 3300026078 | Unclassified | 2399 |
| 180 | Ga0207702_10116749 | 3300026078 | Bacteria | 2382 |
| 181 | Ga0207702_10520968 | 3300026078 | Bacteria | 1161 |
| 182 | Ga0207641_10334410 | 3300026088 | Bacteria | 1440 |
| 183 | Ga0207674_10051969 | 3300026116 | Bacteria | 4180 |
| 184 | Ga0207675_100031575 | 3300026118 | Bacteria | 4934 |
| 185 | Ga0207698_10082262 | 3300026142 | Bacteria | 2602 |
| 186 | Ga0207698_10249915 | 3300026142 | Bacteria | 1622 |
| 187 | Ga0268266_10258632 | 3300028379 | Bacteria | 1613 |
| 188 | Ga0268264_10616201 | 3300028381 | Bacteria | 1071 |
| 189 | Ga0265338_10000750 | 3300028800 | Bacteria | 55295 |
| 190 | Ga0265338_10205347 | 3300028800 | Bacteria | 1483 |
| 191 | Ga0265339_10049447 | 3300031249 | Bacteria | 2302 |
| 192 | Ga0265339_10072608 | 3300031249 | Bacteria | 1831 |
| 193 | Ga0265316_10005797 | 3300031344 | Bacteria | 11917 |
| 194 | Ga0265314_10002993 | 3300031711 | Bacteria | 16724 |
| 195 | Ga0265314_10013053 | 3300031711 | Bacteria | 6741 |
| 196 | Ga0373926_0001607 | 3300035083 | Bacteria | 6956 |
| 197 | Ga0373926_0063939 | 3300035083 | Bacteria | 1344 |
| 198 | Ga0373934_0000303 | 3300035086 | Bacteria | 17350 |
| 199 | Ga0373923_0003177 | 3300035111 | Bacteria | 5221 |
| 200 | Ga0373923_0034829 | 3300035111 | Bacteria | 2046 |
| 201 | Ga0373923_0068876 | 3300035111 | Bacteria | 1516 |
| 202 | Ga0373936_0025425 | 3300035113 | Bacteria | 2315 |
| 203 | Ga0373941_0122026 | 3300035115 | Bacteria | 930 |
| 204 | Ga0373945_0002402 | 3300035116 | Bacteria | 5872 |
| 205 | Ga0373953_0005465 | 3300035117 | Bacteria | 4128 |
| 206 | Ga0373954_0000123 | 3300035118 | Bacteria | 26172 |
| 207 | Ga0373956_0032155 | 3300035119 | Bacteria | 2301 |
| 208 | Ga0373956_0111163 | 3300035119 | Bacteria | 1276 |
| 209 | Ga0373956_0112913 | 3300035119 | Bacteria | 1265 |
| 210 | Ga0373956_0168386 | 3300035119 | Bacteria | 1034 |
| 211 | Ga0373943_0003767 | 3300035170 | Bacteria | 6888 |
| 212 | Ga0373943_0070197 | 3300035170 | Bacteria | 1772 |
| 213 | Ga0373946_0064009 | 3300035171 | Unclassified | 1572 |
| 214 | Ga0373955_0000328 | 3300035172 | Bacteria | 19745 |
| 215 | Ga0373924_0011308 | 3300035410 | Bacteria | 3312 |
| 216 | Ga0373924_0053826 | 3300035410 | Bacteria | 1672 |
| 217 | Ga0373935_0008245 | 3300035692 | Bacteria | 6236 |
| 218 | Ga0373935_0087670 | 3300035692 | Bacteria | 2032 |
| 219 | Ga0373935_0173880 | 3300035692 | Bacteria | 1475 |
| 220 | Ga0373927_0002459 | 3300035695 | Bacteria | 13514 |
| 221 | Ga0373927_0024716 | 3300035695 | Bacteria | 3925 |
| 222 | Ga0373927_0051480 | 3300035695 | Bacteria | 2663 |
| 223 | Ga0373927_0174429 | 3300035695 | Unclassified | 1410 |
| 224 | Ga0373927_0217666 | 3300035695 | Bacteria | 1254 |
| 225 | Ga0373933_0001026 | 3300035724 | Bacteria | 16986 |
| 226 | Ga0373933_0064146 | 3300035724 | Bacteria | 2222 |
| 227 | Ga0373933_0222445 | 3300035724 | Bacteria | 1211 |
| 228 | Ga0373947_0017726 | 3300035725 | Bacteria | 4096 |
| 229 | Ga0373947_0094764 | 3300035725 | Bacteria | 1867 |
| 230 | Ga0373947_0200273 | 3300035725 | Bacteria | 1306 |
| 231 | Ga0373947_0300314 | 3300035725 | Bacteria | 1070 |
| 232 | Ga0373937_0000484 | 3300036401 | Bacteria | 36426 |
| 233 | Ga0373937_0002671 | 3300036401 | Bacteria | 14863 |
| 234 | Ga0373937_0130021 | 3300036401 | Bacteria | 2351 |
| 235 | Ga0373937_0300619 | 3300036401 | Bacteria | 1517 |
| 236 | Ga0373937_0317102 | 3300036401 | Unclassified | 1475 |
| 237 | Ga0373925_0004986 | 3300037068 | Bacteria | 9969 |
| 238 | Ga0373925_0013643 | 3300037068 | Bacteria | 5883 |
| 239 | Ga0373925_0027524 | 3300037068 | Bacteria | 4160 |
| 240 | Ga0373925_0093079 | 3300037068 | Bacteria | 2306 |
| 241 | Ga0373925_0107335 | 3300037068 | Bacteria | 2153 |
| 242 | Ga0436364_0274913 | 3300037853 | Bacteria | 5531 |
| 243 | Ga0436364_0275743 | 3300037853 | Bacteria | 7064 |
| 244 | Ga0436364_0795669 | 3300037853 | Bacteria | 5102 |
| 245 | Ga0436364_1009930 | 3300037853 | Bacteria | 1310 |
| 246 | Ga0395901_0137475 | 3300038443 | Bacteria | 2568 |
| 247 | Ga0436365_1544070 | 3300039437 | Bacteria | 7409 |
| 248 | Ga0436363_1062809 | 3300039450 | Bacteria | 3800 |
| 249 | Ga0451791_1073183 | 3300041451 | Bacteria | 1073 |
| 250 | Ga0450908_028866 | 3300042184 | Bacteria | 965 |
| 251 | Ga0450918_007130 | 3300042531 | Bacteria | 1987 |
| 252 | Ga0466957_0000173 | 3300044842 | Bacteria | 28668 |
| 253 | Ga0466959_0004734 | 3300045049 | Bacteria | 9165 |
| 254 | Ga0451576_0314868 | 3300045051 | Bacteria | 1637 |
| 255 | Ga0466967_0008287 | 3300045976 | Bacteria | 7596 |
| 256 | Ga0495592_0077129 | 3300046454 | Unclassified | 2417 |
| 257 | Ga0495651_0025802 | 3300046462 | Bacteria | 4576 |
| 258 | Ga0495651_0057802 | 3300046462 | Bacteria | 2977 |
| 259 | Ga0495653_0098101 | 3300046463 | Bacteria | 2128 |
| 260 | Ga0495580_0001613 | 3300046472 | Bacteria | 19841 |
| 261 | Ga0495580_0048940 | 3300046472 | Bacteria | 2991 |
| 262 | Ga0495580_0324498 | 3300046472 | Bacteria | 1046 |
| 263 | Ga0495594_0008549 | 3300046499 | Bacteria | 5278 |
| 264 | Ga0495608_0039226 | 3300046511 | Bacteria | 3176 |
| 265 | Ga0495628_0202598 | 3300046516 | Bacteria | 1495 |
| 266 | Ga0495663_0026319 | 3300046525 | Unclassified | 1702 |
| 267 | Ga0495652_0059586 | 3300046529 | Bacteria | 3230 |
| 268 | Ga0495665_0010073 | 3300046531 | Bacteria | 5121 |
| 269 | Ga0495665_0030018 | 3300046531 | Bacteria | 2910 |
| 270 | Ga0495587_0004339 | 3300046536 | Bacteria | 9360 |
| 271 | Ga0495599_0167901 | 3300046678 | Bacteria | 1355 |
| 272 | Ga0495623_0010485 | 3300046679 | Bacteria | 5998 |
| 273 | Ga0495604_0000257 | 3300047317 | Bacteria | 47142 |
| 274 | Ga0495604_0036197 | 3300047317 | Unclassified | 3892 |
| 275 | Ga0495675_0097964 | 3300047444 | Bacteria | 1837 |
| 276 | Ga0495684_0001093 | 3300047471 | Bacteria | 21862 |
| 277 | Ga0495602_0004292 | 3300048088 | Bacteria | 14846 |
| 278 | Ga0495602_0381401 | 3300048088 | Unclassified | 1010 |
| 279 | Ga0496102_0019529 | 3300048905 | Bacteria | 5970 |
| 280 | Ga0496102_0114747 | 3300048905 | Bacteria | 2513 |
| 281 | Ga0496102_0524230 | 3300048905 | Bacteria | 1107 |
| 282 | Ga0496103_0036626 | 3300048906 | Bacteria | 3005 |
| 283 | Ga0496104_0014621 | 3300048907 | Bacteria | 7091 |
| 284 | Ga0496104_0240332 | 3300048907 | Bacteria | 1723 |
| 285 | Ga0496104_0348259 | 3300048907 | Bacteria | 1394 |
| 286 | Ga0496105_0017277 | 3300048908 | Bacteria | 5780 |
| 287 | Ga0496111_0003341 | 3300048914 | Bacteria | 9919 |
| 288 | Ga0496112_0010251 | 3300048915 | Bacteria | 8495 |
| 289 | Ga0496112_0223270 | 3300048915 | Bacteria | 1840 |
| 290 | Ga0496113_0012257 | 3300048916 | Bacteria | 5755 |
| 291 | Ga0496113_0098007 | 3300048916 | Bacteria | 2269 |
| 292 | Ga0496115_0044123 | 3300048918 | Bacteria | 3555 |
| 293 | Ga0496115_0167709 | 3300048918 | Bacteria | 1816 |
| 294 | Ga0501031_0002524 | 3300049568 | Bacteria | 11651 |
| 295 | Ga0501031_0042766 | 3300049568 | Bacteria | 2957 |
| 296 | Ga0501032_0038975 | 3300049569 | Bacteria | 3234 |
| 297 | Ga0501033_0018983 | 3300049570 | Bacteria | 5198 |
| 298 | Ga0501033_0019173 | 3300049570 | Bacteria | 5172 |
| 299 | Ga0501033_0034939 | 3300049570 | Bacteria | 3768 |
| 300 | Ga0501033_0060263 | 3300049570 | Bacteria | 2801 |
| 301 | Ga0501033_0278984 | 3300049570 | Bacteria | 1180 |
| 302 | Ga0501034_0355096 | 3300049571 | Unclassified | 1393 |
| 303 | Ga0501036_0000076 | 3300049572 | Bacteria | 60845 |
| 304 | Ga0501036_0007328 | 3300049572 | Bacteria | 8986 |
| 305 | Ga0501036_0041960 | 3300049572 | Bacteria | 3873 |
| 306 | Ga0501037_0002759 | 3300049573 | Bacteria | 12708 |
| 307 | Ga0501037_0127055 | 3300049573 | Bacteria | 1830 |
| 308 | Ga0501038_0005397 | 3300049574 | Bacteria | 11882 |
| 309 | Ga0501038_0018333 | 3300049574 | Bacteria | 6319 |
| 310 | Ga0501038_0041658 | 3300049574 | Bacteria | 4004 |
| 311 | Ga0501038_0158072 | 3300049574 | Bacteria | 1844 |
| 312 | Ga0501038_0364678 | 3300049574 | Bacteria | 1123 |
| 313 | Ga0501039_0005957 | 3300049575 | Bacteria | 9237 |
| 314 | Ga0501039_0025123 | 3300049575 | Bacteria | 4576 |
| 315 | Ga0501039_0032505 | 3300049575 | Bacteria | 4023 |
| 316 | Ga0501039_0087210 | 3300049575 | Bacteria | 2431 |
| 317 | Ga0501039_0112458 | 3300049575 | Bacteria | 2129 |
| 318 | Ga0501040_0016765 | 3300049576 | Bacteria | 4856 |
| 319 | Ga0501040_0058911 | 3300049576 | Bacteria | 2638 |
| 320 | Ga0501040_0062979 | 3300049576 | Bacteria | 2551 |
| 321 | Ga0501040_0366680 | 3300049576 | Bacteria | 1032 |
| 322 | Ga0501041_0002279 | 3300049577 | Bacteria | 10860 |
| 323 | Ga0501041_0006575 | 3300049577 | Bacteria | 6808 |
| 324 | Ga0501041_0010037 | 3300049577 | Bacteria | 5579 |
| 325 | Ga0501041_0023770 | 3300049577 | Bacteria | 3675 |
| 326 | Ga0501041_0095312 | 3300049577 | Bacteria | 1839 |
| 327 | Ga0501041_0096360 | 3300049577 | Unclassified | 1829 |
| 328 | Ga0501042_0015943 | 3300049578 | Bacteria | 5153 |
| 329 | Ga0501042_0264777 | 3300049578 | Unclassified | 1241 |
| 330 | Ga0501043_0026638 | 3300049579 | Unclassified | 4536 |
| 331 | Ga0501043_0127224 | 3300049579 | Unclassified | 1998 |
| 332 | Ga0501043_0181495 | 3300049579 | Bacteria | 1640 |
| 333 | Ga0501046_0000757 | 3300049580 | Bacteria | 31241 |
| 334 | Ga0501046_0015694 | 3300049580 | Bacteria | 6358 |
| 335 | Ga0501046_0016680 | 3300049580 | Bacteria | 6145 |
| 336 | Ga0501046_0066895 | 3300049580 | Bacteria | 2799 |
| 337 | Ga0501047_0014410 | 3300049581 | Bacteria | 7517 |
| 338 | Ga0501047_0018297 | 3300049581 | Bacteria | 6714 |
| 339 | Ga0501047_0221083 | 3300049581 | Bacteria | 1750 |
| 340 | Ga0501048_0002408 | 3300049582 | Bacteria | 14275 |
| 341 | Ga0501048_0004072 | 3300049582 | Bacteria | 11126 |
| 342 | Ga0501048_0009083 | 3300049582 | Bacteria | 7482 |
| 343 | Ga0501048_0161805 | 3300049582 | Bacteria | 1584 |
| 344 | Ga0501067_0003817 | 3300049583 | Bacteria | 8313 |
| 345 | Ga0501068_0003338 | 3300049584 | Bacteria | 8612 |
| 346 | Ga0501068_0021376 | 3300049584 | Bacteria | 3778 |
| 347 | Ga0501068_0059933 | 3300049584 | Bacteria | 2311 |
| 348 | Ga0501069_0007228 | 3300049585 | Bacteria | 5821 |
| 349 | Ga0501069_0039836 | 3300049585 | Bacteria | 2596 |
| 350 | Ga0501070_0002074 | 3300049586 | Bacteria | 17596 |
| 351 | Ga0501071_0006539 | 3300049587 | Bacteria | 7567 |
| 352 | Ga0501071_0013098 | 3300049587 | Bacteria | 5646 |
| 353 | Ga0501071_0016714 | 3300049587 | Bacteria | 5046 |
| 354 | Ga0501071_0094487 | 3300049587 | Bacteria | 2199 |
| 355 | Ga0501071_0173418 | 3300049587 | Bacteria | 1615 |
| 356 | Ga0501072_0001332 | 3300049588 | Bacteria | 18500 |
| 357 | Ga0501072_0014040 | 3300049588 | Bacteria | 6138 |
| 358 | Ga0501072_0018110 | 3300049588 | Bacteria | 5416 |
| 359 | Ga0501072_0030332 | 3300049588 | Bacteria | 4228 |
| 360 | Ga0501072_0112988 | 3300049588 | Bacteria | 2162 |
| 361 | Ga0501074_0007236 | 3300049590 | Bacteria | 8017 |
| 362 | Ga0501074_0013377 | 3300049590 | Bacteria | 5966 |
| 363 | Ga0501075_0002402 | 3300049591 | Bacteria | 12442 |
| 364 | Ga0501075_0007652 | 3300049591 | Bacteria | 7497 |
| 365 | Ga0501075_0024981 | 3300049591 | Unclassified | 4387 |
| 366 | Ga0501075_0085094 | 3300049591 | Bacteria | 2395 |
| 367 | Ga0501075_0239157 | 3300049591 | Bacteria | 1384 |
| 368 | Ga0501076_0000781 | 3300049592 | Bacteria | 20543 |
| 369 | Ga0501076_0001304 | 3300049592 | Bacteria | 16640 |
| 370 | Ga0501076_0021113 | 3300049592 | Bacteria | 4990 |
| 371 | Ga0501076_0028521 | 3300049592 | Bacteria | 4335 |
| 372 | Ga0501076_0082725 | 3300049592 | Bacteria | 2577 |
| 373 | Ga0501076_0236859 | 3300049592 | Bacteria | 1493 |
| 374 | Ga0501077_0001586 | 3300049593 | Bacteria | 13692 |
| 375 | Ga0501077_0017234 | 3300049593 | Bacteria | 4557 |
| 376 | Ga0501077_0068817 | 3300049593 | Bacteria | 2244 |
| 377 | Ga0501077_0079350 | 3300049593 | Bacteria | 2080 |
| 378 | Ga0501079_0003060 | 3300049741 | Bacteria | 12238 |
| 379 | Ga0501079_0004748 | 3300049741 | Bacteria | 10068 |
| 380 | Ga0501079_0009517 | 3300049741 | Bacteria | 7366 |
| 381 | Ga0501079_0046126 | 3300049741 | Bacteria | 3362 |
| 382 | Ga0501079_0091170 | 3300049741 | Bacteria | 2361 |
| 383 | Ga0501079_0197818 | 3300049741 | Bacteria | 1569 |
| 384 | Ga0501079_0235501 | 3300049741 | Bacteria | 1430 |
| 385 | Ga0501079_0328300 | 3300049741 | Bacteria | 1198 |
| 386 | Ga0501080_0000049 | 3300049742 | Bacteria | 76472 |
| 387 | Ga0501080_0046600 | 3300049742 | Bacteria | 4035 |
| 388 | Ga0501080_0123122 | 3300049742 | Bacteria | 2402 |
| 389 | Ga0501081_0000240 | 3300049743 | Bacteria | 28015 |
| 390 | Ga0501081_0017232 | 3300049743 | Unclassified | 4779 |
| 391 | Ga0501081_0018077 | 3300049743 | Bacteria | 4677 |
| 392 | Ga0501081_0030931 | 3300049743 | Bacteria | 3627 |
| 393 | Ga0501081_0103382 | 3300049743 | Unclassified | 2016 |
| 394 | Ga0501081_0152070 | 3300049743 | Bacteria | 1663 |
| 395 | Ga0501035_0012443 | 3300049822 | Bacteria | 7864 |
| 396 | Ga0501035_0013125 | 3300049822 | Bacteria | 7645 |
| 397 | Ga0501035_0022632 | 3300049822 | Bacteria | 5773 |
| 398 | Ga0501044_0004617 | 3300049823 | Bacteria | 15411 |
| 399 | Ga0501045_0000066 | 3300049824 | Bacteria | 48342 |
| 400 | Ga0501045_0021173 | 3300049824 | Bacteria | 4649 |
| 401 | Ga0501045_0055824 | 3300049824 | Bacteria | 2888 |
| 402 | Ga0501045_0057365 | 3300049824 | Bacteria | 2849 |
| 403 | nmdc:mga0k408_93097_c1 | 3300050493 | Bacteria | 1772 |
| 404 | nmdc:mga05p37_112_c1 | 3300050507 | Bacteria | 73572 |
| 405 | nmdc:mga0n895_124476_c1 | 3300050512 | Bacteria | 2601 |
| 406 | nmdc:mga0n895_238471_c1 | 3300050512 | Unclassified | 1845 |
| 407 | nmdc:mga0a205_36495_c1 | 3300050515 | Bacteria | 4722 |
| 408 | Ga0495619_0019463 | 3300053085 | Bacteria | 4317 |
| 409 | Ga0500568_0055175 | 3300053139 | Unclassified | 1551 |
| 410 | Ga0501084_0005002 | 3300054114 | Bacteria | 10842 |
| 411 | Ga0501084_0005325 | 3300054114 | Bacteria | 10535 |
| 412 | Ga0501084_0030646 | 3300054114 | Bacteria | 4497 |
| 413 | Ga0501084_0047353 | 3300054114 | Bacteria | 3601 |
| 414 | Ga0501084_0057116 | 3300054114 | Bacteria | 3266 |
| 415 | Ga0501084_0575742 | 3300054114 | Bacteria | 951 |
| 416 | Ga0501082_0003569 | 3300060353 | Bacteria | 13580 |
| 417 | Ga0501082_0003717 | 3300060353 | Bacteria | 13332 |
| 418 | Ga0501082_0023330 | 3300060353 | Bacteria | 5337 |
| 419 | Ga0501082_0111080 | 3300060353 | Bacteria | 2372 |
| 420 | Ga0501082_0134260 | 3300060353 | Bacteria | 2147 |
| 421 | Ga0501082_0216350 | 3300060353 | Unclassified | 1667 |
| 422 | Ga0501082_0376984 | 3300060353 | Bacteria | 1238 |
| 423 | Ga0466962_0140490 | 3300061719 | Bacteria | 1170 |
| 424 | Ga0530510_0000772 | 3300061734 | Bacteria | 20824 |
| 425 | Ga0530510_0020380 | 3300061734 | Unclassified | 4714 |
| 426 | Ga0530510_0132439 | 3300061734 | Unclassified | 1835 |
| 427 | Ga0530510_0237394 | 3300061734 | Bacteria | 1357 |
| 428 | Ga0207663_10014708 | |||
| 429 | MBSR1b_contig_10062352 | |||
| 430 | Ga0058861_11992058 | |||
| 431 | Ga0070658_10019953 | |||
| 432 | Ga0068869_100098978 | |||
| 433 | Ga0070666_10056437 | |||
| 434 | Ga0070680_100010286 | |||
| 435 | Ga0070680_100059231 | |||
| 436 | Ga0068868_100346709 | |||
| 437 | Ga0070660_100051598 | |||
| 438 | Ga0070660_100115924 | |||
| 439 | Ga0070675_100001345 | |||
| 440 | Ga0070674_100001329 | |||
| 441 | Ga0070674_100195751 | |||
| 442 | Ga0070659_100064591 | |||
| 443 | Ga0070659_100066729 | |||
| 444 | Ga0070703_10012385 | |||
| 445 | Ga0070709_10009465 | |||
| 446 | Ga0070709_10025918 | |||
| 447 | Ga0070709_10322153 | |||
| 448 | Ga0070713_100212257 | |||
| 449 | Ga0070710_10242161 | |||
| 450 | Ga0070711_100015198 | |||
| 451 | Ga0070711_100088212 | |||
| 452 | Ga0070711_100164531 | |||
| 453 | Ga0070705_100007876 | |||
| 454 | Ga0070694_100021655 | |||
| 455 | Ga0070708_100017395 | |||
| 456 | Ga0070662_100152230 | |||
| 457 | Ga0070681_10044528 | |||
| 458 | Ga0070681_10044601 | |||
| 459 | Ga0070681_10056938 | |||
| 460 | Ga0070681_10106959 | |||
| 461 | Ga0070681_10206646 | |||
| 462 | Ga0070681_10209560 | |||
| 463 | Ga0070706_100014925 | |||
| 464 | Ga0070706_100299475 | |||
| 465 | Ga0070698_100395187 | |||
| 466 | Ga0070699_100009693 | |||
| 467 | Ga0070699_100099008 | |||
| 468 | Ga0070679_100004784 | |||
| 469 | Ga0070679_100006710 | |||
| 470 | Ga0070684_100082939 | |||
| 471 | Ga0070684_100111017 | |||
| 472 | Ga0070684_100206938 | |||
| 473 | Ga0070697_100000335 | |||
| 474 | Ga0068853_100101439 | |||
| 475 | Ga0070686_100012734 | |||
| 476 | Ga0070686_100199265 | |||
| 477 | Ga0070695_100006165 | |||
| 478 | Ga0070693_100008341 | |||
| 479 | Ga0070693_100024020 | |||
| 480 | Ga0070665_100179794 | |||
| 481 | Ga0070704_100002936 | |||
| 482 | Ga0068855_100005945 | |||
| 483 | Ga0068855_100028134 | |||
| 484 | Ga0068855_100078935 | |||
| 485 | Ga0068855_100449141 | |||
| 486 | Ga0070664_100223564 | |||
| 487 | Ga0068856_100012972 | |||
| 488 | Ga0068856_100563347 | |||
| 489 | Ga0068852_100029211 | |||
| 490 | Ga0068852_100047949 | |||
| 491 | Ga0068859_100126896 | |||
| 492 | Ga0068861_100141115 | |||
| 493 | Ga0068862_100072947 | |||
| 494 | Ga0068862_100095782 | |||
| 495 | Ga0070717_10000072 | |||
| 496 | Ga0070717_10062690 | |||
| 497 | Ga0070716_100104517 | |||
| 498 | Ga0070712_100069202 | |||
| 499 | Ga0070712_100099968 | |||
| 500 | Ga0075367_10009773 | |||
| 501 | Ga0075366_10076022 | |||
| 502 | Ga0068871_100116528 | |||
| 503 | Ga0075428_100134051 | |||
| 504 | Ga0075430_100051061 | |||
| 505 | Ga0075430_100420409 | |||
| 506 | Ga0075434_100443808 | |||
| 507 | Ga0075436_100121883 | |||
| 508 | Ga0097620_100126898 | |||
| 509 | Ga0105240_10001445 | |||
| 510 | Ga0105240_10159935 | |||
| 511 | Ga0105240_10296193 | |||
| 512 | Ga0105240_10351815 | |||
| 513 | Ga0105240_10469990 | |||
| 514 | Ga0105245_10001277 | |||
| 515 | Ga0105245_10144536 | |||
| 516 | Ga0114129_10171312 | |||
| 517 | Ga0105241_10131415 | |||
| 518 | Ga0105241_10163994 | |||
| 519 | Ga0105242_10071782 | |||
| 520 | Ga0105242_10231703 | |||
| 521 | Ga0105248_10010725 | |||
| 522 | Ga0105248_10088424 | |||
| 523 | Ga0105248_10184694 | |||
| 524 | Ga0105237_10002642 | |||
| 525 | Ga0105238_10027037 | |||
| 526 | Ga0105238_10080059 | |||
| 527 | Ga0105238_10160037 | |||
| 528 | Ga0105239_10003562 | |||
| 529 | Ga0105239_10005855 | |||
| 530 | Ga0105239_10046289 | |||
| 531 | Ga0105239_10051245 | |||
| 532 | Ga0105239_10234107 | |||
| 533 | Ga0105239_10320036 | |||
| 534 | Ga0157370_10014291 | |||
| 535 | Ga0157370_10047273 | |||
| 536 | Ga0157370_10123299 | |||
| 537 | Ga0157370_10271386 | |||
| 538 | Ga0157369_10021520 | |||
| 539 | Ga0157369_10024109 | |||
| 540 | Ga0157369_10270436 | |||
| 541 | Ga0157369_10289359 | |||
| 542 | Ga0157369_10374880 | |||
| 543 | Ga0157369_10570209 | |||
| 544 | Ga0157369_10718900 | |||
| 545 | Ga0157374_10045955 | |||
| 546 | Ga0157374_10065756 | |||
| 547 | Ga0157374_10099802 | |||
| 548 | Ga0157378_10049950 | |||
| 549 | Ga0157378_10127698 | |||
| 550 | Ga0163162_10003010 | |||
| 551 | Ga0157372_10038756 | |||
| 552 | Ga0157372_10085203 | |||
| 553 | Ga0163163_10000059 | |||
| 554 | Ga0163163_10191333 | |||
| 555 | Ga0157380_10649422 | |||
| 556 | Ga0157379_10253128 | |||
| 557 | Ga0213876_10049008 | |||
| 558 | Ga0213875_10003491 | |||
| 559 | Ga0213875_10067197 | |||
| 560 | Ga0213875_10106903 | |||
| 561 | Ga0224712_10104244 | |||
| 562 | Ga0207713_1090403 | |||
| 563 | Ga0207653_10018979 | |||
| 564 | Ga0207705_10060519 | |||
| 565 | Ga0207684_10002645 | |||
| 566 | Ga0207654_10181545 | |||
| 567 | Ga0207707_10012251 | |||
| 568 | Ga0207707_10056277 | |||
| 569 | Ga0207707_10065494 | |||
| 570 | Ga0207707_10204265 | |||
| 571 | Ga0207707_10288357 | |||
| 572 | Ga0207695_10008516 | |||
| 573 | Ga0207695_10084534 | |||
| 574 | Ga0207695_10273399 | |||
| 575 | Ga0207693_10009746 | |||
| 576 | Ga0207660_10003127 | |||
| 577 | Ga0207660_10289505 | |||
| 578 | Ga0207657_10001616 | |||
| 579 | Ga0207652_10204369 | |||
| 580 | Ga0207694_10080675 | |||
| 581 | Ga0207659_10148599 | |||
| 582 | Ga0207687_10001897 | |||
| 583 | Ga0207687_10028905 | |||
| 584 | Ga0207700_10005732 | |||
| 585 | Ga0207700_10440680 | |||
| 586 | Ga0207664_10425437 | |||
| 587 | Ga0207690_10045589 | |||
| 588 | Ga0207690_10077369 | |||
| 589 | Ga0207706_10029633 | |||
| 590 | Ga0207706_10090023 | |||
| 591 | Ga0207669_10002440 | |||
| 592 | Ga0207704_10181662 | |||
| 593 | Ga0207704_10615599 | |||
| 594 | Ga0207665_10032127 | |||
| 595 | Ga0207711_10119885 | |||
| 596 | Ga0207711_10128947 | |||
| 597 | Ga0207661_10136929 | |||
| 598 | Ga0207661_10228052 | |||
| 599 | Ga0207667_10004072 | |||
| 600 | Ga0207667_10010423 | |||
| 601 | Ga0207667_10036360 | |||
| 602 | Ga0207667_10346505 | |||
| 603 | Ga0207703_10117857 | |||
| 604 | Ga0207639_10012271 | |||
| 605 | Ga0207702_10095774 | |||
| 606 | Ga0207702_10115002 | |||
| 607 | Ga0207702_10116749 | |||
| 608 | Ga0207702_10520968 | |||
| 609 | Ga0207641_10334410 | |||
| 610 | Ga0207674_10051969 | |||
| 611 | Ga0207675_100031575 | |||
| 612 | Ga0207698_10082262 | |||
| 613 | Ga0207698_10249915 | |||
| 614 | Ga0268266_10258632 | |||
| 615 | Ga0268264_10616201 | |||
| 616 | Ga0265338_10000750 | |||
| 617 | Ga0265338_10205347 | |||
| 618 | Ga0265339_10049447 | |||
| 619 | Ga0265339_10072608 | |||
| 620 | Ga0265316_10005797 | |||
| 621 | Ga0265314_10002993 | |||
| 622 | Ga0265314_10013053 | |||
| 623 | Ga0373926_0001607 | |||
| 624 | Ga0373926_0063939 | |||
| 625 | Ga0373934_0000303 | |||
| 626 | Ga0373923_0003177 | |||
| 627 | Ga0373923_0034829 | |||
| 628 | Ga0373923_0068876 | |||
| 629 | Ga0373936_0025425 | |||
| 630 | Ga0373941_0122026 | |||
| 631 | Ga0373945_0002402 | |||
| 632 | Ga0373953_0005465 | |||
| 633 | Ga0373954_0000123 | |||
| 634 | Ga0373956_0032155 | |||
| 635 | Ga0373956_0111163 | |||
| 636 | Ga0373956_0112913 | |||
| 637 | Ga0373956_0168386 | |||
| 638 | Ga0373943_0003767 | |||
| 639 | Ga0373943_0070197 | |||
| 640 | Ga0373946_0064009 | |||
| 641 | Ga0373955_0000328 | |||
| 642 | Ga0373924_0011308 | |||
| 643 | Ga0373924_0053826 | |||
| 644 | Ga0373935_0008245 | |||
| 645 | Ga0373935_0087670 | |||
| 646 | Ga0373935_0173880 | |||
| 647 | Ga0373927_0002459 | |||
| 648 | Ga0373927_0024716 | |||
| 649 | Ga0373927_0051480 | |||
| 650 | Ga0373927_0174429 | |||
| 651 | Ga0373927_0217666 | |||
| 652 | Ga0373933_0001026 | |||
| 653 | Ga0373933_0064146 | |||
| 654 | Ga0373933_0222445 | |||
| 655 | Ga0373947_0017726 | |||
| 656 | Ga0373947_0094764 | |||
| 657 | Ga0373947_0200273 | |||
| 658 | Ga0373947_0300314 | |||
| 659 | Ga0373937_0000484 | |||
| 660 | Ga0373937_0002671 | |||
| 661 | Ga0373937_0130021 | |||
| 662 | Ga0373937_0300619 | |||
| 663 | Ga0373937_0317102 | |||
| 664 | Ga0373925_0004986 | |||
| 665 | Ga0373925_0013643 | |||
| 666 | Ga0373925_0027524 | |||
| 667 | Ga0373925_0093079 | |||
| 668 | Ga0373925_0107335 | |||
| 669 | Ga0436364_0274913 | |||
| 670 | Ga0436364_0275743 | |||
| 671 | Ga0436364_0795669 | |||
| 672 | Ga0436364_1009930 | |||
| 673 | Ga0395901_0137475 | |||
| 674 | Ga0436365_1544070 | |||
| 675 | Ga0436363_1062809 | |||
| 676 | Ga0451791_1073183 | |||
| 677 | Ga0450908_028866 | |||
| 678 | Ga0450918_007130 | |||
| 679 | Ga0466957_0000173 | |||
| 680 | Ga0466959_0004734 | |||
| 681 | Ga0451576_0314868 | |||
| 682 | Ga0466967_0008287 | |||
| 683 | Ga0495592_0077129 | |||
| 684 | Ga0495651_0025802 | |||
| 685 | Ga0495651_0057802 | |||
| 686 | Ga0495653_0098101 | |||
| 687 | Ga0495580_0001613 | |||
| 688 | Ga0495580_0048940 | |||
| 689 | Ga0495580_0324498 | |||
| 690 | Ga0495594_0008549 | |||
| 691 | Ga0495608_0039226 | |||
| 692 | Ga0495628_0202598 | |||
| 693 | Ga0495663_0026319 | |||
| 694 | Ga0495652_0059586 | |||
| 695 | Ga0495665_0010073 | |||
| 696 | Ga0495665_0030018 | |||
| 697 | Ga0495587_0004339 | |||
| 698 | Ga0495599_0167901 | |||
| 699 | Ga0495623_0010485 | |||
| 700 | Ga0495604_0000257 | |||
| 701 | Ga0495604_0036197 | |||
| 702 | Ga0495675_0097964 | |||
| 703 | Ga0495684_0001093 | |||
| 704 | Ga0495602_0004292 | |||
| 705 | Ga0495602_0381401 | |||
| 706 | Ga0496102_0019529 | |||
| 707 | Ga0496102_0114747 | |||
| 708 | Ga0496102_0524230 | |||
| 709 | Ga0496103_0036626 | |||
| 710 | Ga0496104_0014621 | |||
| 711 | Ga0496104_0240332 | |||
| 712 | Ga0496104_0348259 | |||
| 713 | Ga0496105_0017277 | |||
| 714 | Ga0496111_0003341 | |||
| 715 | Ga0496112_0010251 | |||
| 716 | Ga0496112_0223270 | |||
| 717 | Ga0496113_0012257 | |||
| 718 | Ga0496113_0098007 | |||
| 719 | Ga0496115_0044123 | |||
| 720 | Ga0496115_0167709 | |||
| 721 | Ga0501031_0002524 | |||
| 722 | Ga0501031_0042766 | |||
| 723 | Ga0501032_0038975 | |||
| 724 | Ga0501033_0018983 | |||
| 725 | Ga0501033_0019173 | |||
| 726 | Ga0501033_0034939 | |||
| 727 | Ga0501033_0060263 | |||
| 728 | Ga0501033_0278984 | |||
| 729 | Ga0501034_0355096 | |||
| 730 | Ga0501036_0000076 | |||
| 731 | Ga0501036_0007328 | |||
| 732 | Ga0501036_0041960 | |||
| 733 | Ga0501037_0002759 | |||
| 734 | Ga0501037_0127055 | |||
| 735 | Ga0501038_0005397 | |||
| 736 | Ga0501038_0018333 | |||
| 737 | Ga0501038_0041658 | |||
| 738 | Ga0501038_0158072 | |||
| 739 | Ga0501038_0364678 | |||
| 740 | Ga0501039_0005957 | |||
| 741 | Ga0501039_0025123 | |||
| 742 | Ga0501039_0032505 | |||
| 743 | Ga0501039_0087210 | |||
| 744 | Ga0501039_0112458 | |||
| 745 | Ga0501040_0016765 | |||
| 746 | Ga0501040_0058911 | |||
| 747 | Ga0501040_0062979 | |||
| 748 | Ga0501040_0366680 | |||
| 749 | Ga0501041_0002279 | |||
| 750 | Ga0501041_0006575 | |||
| 751 | Ga0501041_0010037 | |||
| 752 | Ga0501041_0023770 | |||
| 753 | Ga0501041_0095312 | |||
| 754 | Ga0501041_0096360 | |||
| 755 | Ga0501042_0015943 | |||
| 756 | Ga0501042_0264777 | |||
| 757 | Ga0501043_0026638 | |||
| 758 | Ga0501043_0127224 | |||
| 759 | Ga0501043_0181495 | |||
| 760 | Ga0501046_0000757 | |||
| 761 | Ga0501046_0015694 | |||
| 762 | Ga0501046_0016680 | |||
| 763 | Ga0501046_0066895 | |||
| 764 | Ga0501047_0014410 | |||
| 765 | Ga0501047_0018297 | |||
| 766 | Ga0501047_0221083 | |||
| 767 | Ga0501048_0002408 | |||
| 768 | Ga0501048_0004072 | |||
| 769 | Ga0501048_0009083 | |||
| 770 | Ga0501048_0161805 | |||
| 771 | Ga0501067_0003817 | |||
| 772 | Ga0501068_0003338 | |||
| 773 | Ga0501068_0021376 | |||
| 774 | Ga0501068_0059933 | |||
| 775 | Ga0501069_0007228 | |||
| 776 | Ga0501069_0039836 | |||
| 777 | Ga0501070_0002074 | |||
| 778 | Ga0501071_0006539 | |||
| 779 | Ga0501071_0013098 | |||
| 780 | Ga0501071_0016714 | |||
| 781 | Ga0501071_0094487 | |||
| 782 | Ga0501071_0173418 | |||
| 783 | Ga0501072_0001332 | |||
| 784 | Ga0501072_0014040 | |||
| 785 | Ga0501072_0018110 | |||
| 786 | Ga0501072_0030332 | |||
| 787 | Ga0501072_0112988 | |||
| 788 | Ga0501074_0007236 | |||
| 789 | Ga0501074_0013377 | |||
| 790 | Ga0501075_0002402 | |||
| 791 | Ga0501075_0007652 | |||
| 792 | Ga0501075_0024981 | |||
| 793 | Ga0501075_0085094 | |||
| 794 | Ga0501075_0239157 | |||
| 795 | Ga0501076_0000781 | |||
| 796 | Ga0501076_0001304 | |||
| 797 | Ga0501076_0021113 | |||
| 798 | Ga0501076_0028521 | |||
| 799 | Ga0501076_0082725 | |||
| 800 | Ga0501076_0236859 | |||
| 801 | Ga0501077_0001586 | |||
| 802 | Ga0501077_0017234 | |||
| 803 | Ga0501077_0068817 | |||
| 804 | Ga0501077_0079350 | |||
| 805 | Ga0501079_0003060 | |||
| 806 | Ga0501079_0004748 | |||
| 807 | Ga0501079_0009517 | |||
| 808 | Ga0501079_0046126 | |||
| 809 | Ga0501079_0091170 | |||
| 810 | Ga0501079_0197818 | |||
| 811 | Ga0501079_0235501 | |||
| 812 | Ga0501079_0328300 | |||
| 813 | Ga0501080_0000049 | |||
| 814 | Ga0501080_0046600 | |||
| 815 | Ga0501080_0123122 | |||
| 816 | Ga0501081_0000240 | |||
| 817 | Ga0501081_0017232 | |||
| 818 | Ga0501081_0018077 | |||
| 819 | Ga0501081_0030931 | |||
| 820 | Ga0501081_0103382 | |||
| 821 | Ga0501081_0152070 | |||
| 822 | Ga0501035_0012443 | |||
| 823 | Ga0501035_0013125 | |||
| 824 | Ga0501035_0022632 | |||
| 825 | Ga0501044_0004617 | |||
| 826 | Ga0501045_0000066 | |||
| 827 | Ga0501045_0021173 | |||
| 828 | Ga0501045_0055824 | |||
| 829 | Ga0501045_0057365 | |||
| 830 | nmdc:mga0k408_93097_c1 | |||
| 831 | nmdc:mga05p37_112_c1 | |||
| 832 | nmdc:mga0n895_124476_c1 | |||
| 833 | nmdc:mga0n895_238471_c1 | |||
| 834 | nmdc:mga0a205_36495_c1 | |||
| 835 | Ga0495619_0019463 | |||
| 836 | Ga0500568_0055175 | |||
| 837 | Ga0501084_0005002 | |||
| 838 | Ga0501084_0005325 | |||
| 839 | Ga0501084_0030646 | |||
| 840 | Ga0501084_0047353 | |||
| 841 | Ga0501084_0057116 | |||
| 842 | Ga0501084_0575742 | |||
| 843 | Ga0501082_0003569 | |||
| 844 | Ga0501082_0003717 | |||
| 845 | Ga0501082_0023330 | |||
| 846 | Ga0501082_0111080 | |||
| 847 | Ga0501082_0134260 | |||
| 848 | Ga0501082_0216350 | |||
| 849 | Ga0501082_0376984 | |||
| 850 | Ga0466962_0140490 | |||
| 851 | Ga0530510_0000772 | |||
| 852 | Ga0530510_0020380 | |||
| 853 | Ga0530510_0132439 | |||
| 854 | Ga0530510_0237394 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pcz-assembly1.cif.gz_A | crystal structure of a complex between r247g llfpg mutant and a thf containing dna | 0.8478 | 2 | 250 |
| 6rok-assembly1.cif.gz_A | the crystal structure of a complex between the llfpg protein, a thf-dna and an inhibitor | 0.8462 | 2 | 250 |
| 1nnj-assembly1.cif.gz_A | crystal structure complex between the lactococcus lactis fpg and an abasic site containing dna | 0.842 | 3 | 250 |
| 2xzu-assembly1.cif.gz_A | crystal structure of a complex between the wild-type lactococcus lactis fpg (mutm) and an oxidized pyrimidine containing dna at 310k | 0.8414 | 2 | 250 |
| 6fl1-assembly1.cif.gz_A | crystal structure of the complex between the lactococcus lactis fpg mutant t221p and a fapy-dg containing dna | 0.8408 | 2 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3sarA02 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8888 | 141 | 249 | 1.10.8.50 |
| 1kfvB01 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.8755 | 3 | 132 | 3.20.190.10 |
| af_L0T864_10_149_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.8689 | 141 | 256 | 1.10.8.50 |
| af_P05523_2_128_3.20.190.10 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.8628 | 2 | 123 | 3.20.190.10 |
| 1ee8B01 | Alpha Beta;Alpha-Beta Barrel;N-terminal domain of MutM-like DNA repair proteins;MutM-like, N-terminal | 0.8472 | 2 | 123 | 3.20.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8FV99-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9557 | 1 | 130 |
GO:0003906
GO:0006284 GO:0008270 GO:0019104 |
| AF-A0A521KCW9-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9354 | 1 | 109 |
GO:0003906
GO:0006284 GO:0008270 GO:0019104 |
| AF-A0A2V6TE40-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9345 | 148 | 278 |
GO:0003684
GO:0003906 GO:0006284 GO:0008270 GO:0034039 |
| AF-A0A2V8FV99-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9344 | 1 | 130 |
GO:0003906
GO:0006284 GO:0008270 GO:0019104 |
| AF-A0A536XPJ5-F1-model_v4 | Formamidopyrimidine-DNA glycosylase | 0.9316 | 173 | 276 |
GO:0003906
GO:0006284 GO:0008270 GO:0016799 |