F441446

General Info

Members Datasets Scaffolds Average Seq Length
427 226 854 208

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10089097|Ga0157370_100890976
Length 246
Sequence MTQRVAHRRPFSFDAVRRNLYALGEHTFDSMFPDPPEERTTVELTGRQQEIWEFLADYVDRHGYPPTVREIGEAVGLASPSTVHAHLANLERAGLLRRDPTKPRALELVGREKAAGQSVASLPKLPLLGQIAAGGPLLADQNVEDELAVPENLRGDFLLRVKGDSMIEAGILEGDLVVVRRAQDARNGDVVVALAGDDESADEATVKTFYREKGRVRLQPENASLEPIYAQHVQILGKVVGVFREL

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
39 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
40 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
74 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
82 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
83 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
84 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
85 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
86 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
87 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
94 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
95 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
105 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
149 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
163 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
170 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
171 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.48
Rhizosphere 88.06
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10089097 3300013104 Bacteria 2898
2 Ga0070658_10009371 3300005327 Bacteria 7867
3 Ga0070658_10205580 3300005327 Bacteria 1662
4 Ga0070658_10272509 3300005327 Bacteria 1439
5 Ga0070683_100125306 3300005329 Bacteria 2428
6 Ga0070680_100043803 3300005336 Unclassified 3635
7 Ga0070680_100186095 3300005336 Bacteria 1749
8 Ga0070680_100475128 3300005336 Bacteria 1068
9 Ga0070682_100599383 3300005337 Bacteria 870
10 Ga0070660_100005060 3300005339 Bacteria 9109
11 Ga0070660_100051349 3300005339 Bacteria 3175
12 Ga0070660_100076510 3300005339 Bacteria 2621
13 Ga0070660_101009846 3300005339 Bacteria 703
14 Ga0070691_10047668 3300005341 Bacteria 2038
15 Ga0070691_10132646 3300005341 Bacteria 1263
16 Ga0070692_10119777 3300005345 Bacteria 1467
17 Ga0070673_100627758 3300005364 Bacteria 982
18 Ga0070714_100027244 3300005435 Bacteria 4730
19 Ga0070714_100083493 3300005435 Bacteria 2785
20 Ga0070714_100189350 3300005435 Bacteria 1876
21 Ga0070713_100030069 3300005436 Bacteria 4309
22 Ga0070713_100802128 3300005436 Bacteria 902
23 Ga0070710_10004617 3300005437 Bacteria 6511
24 Ga0070711_100020816 3300005439 Bacteria 4233
25 Ga0070705_100033820 3300005440 Bacteria 2852
26 Ga0070705_100143722 3300005440 Bacteria 1574
27 Ga0070694_100880610 3300005444 Bacteria 738
28 Ga0070681_10149111 3300005458 Bacteria 2266
29 Ga0070706_100205864 3300005467 Bacteria 1837
30 Ga0070706_100506818 3300005467 Bacteria 1123
31 Ga0070707_100407103 3300005468 Bacteria 1320
32 Ga0070698_100070413 3300005471 Bacteria 3510
33 Ga0070698_100244237 3300005471 Bacteria 1728
34 Ga0070698_100585741 3300005471 Bacteria 1056
35 Ga0070699_100747023 3300005518 Bacteria 895
36 Ga0070679_100005683 3300005530 Bacteria 11566
37 Ga0070679_100466309 3300005530 Bacteria 1207
38 Ga0070679_100841532 3300005530 Bacteria 861
39 Ga0070684_100195733 3300005535 Bacteria 1841
40 Ga0070684_100289167 3300005535 Bacteria 1502
41 Ga0070684_100377433 3300005535 Bacteria 1305
42 Ga0070696_100443864 3300005546 Bacteria 1023
43 Ga0068855_100394959 3300005563 Bacteria 1516
44 Ga0068857_100125573 3300005577 Bacteria 2312
45 Ga0068856_100146004 3300005614 Bacteria 2373
46 Ga0070702_100190656 3300005615 Bacteria 1349
47 Ga0068852_100595451 3300005616 Bacteria 1109
48 Ga0070717_10009169 3300006028 Bacteria 7435
49 Ga0070717_10110387 3300006028 Bacteria 2345
50 Ga0070712_100000003 3300006175 Bacteria 253696
51 Ga0070712_100112988 3300006175 Bacteria 2030
52 Ga0070712_100644503 3300006175 Bacteria 900
53 Ga0075433_10444463 3300006852 Bacteria 1143
54 Ga0075434_100273137 3300006871 Bacteria 1709
55 Ga0105245_10166864 3300009098 Bacteria 2093
56 Ga0105245_10550500 3300009098 Bacteria 1176
57 Ga0105248_10793856 3300009177 Bacteria 1068
58 Ga0105248_11219415 3300009177 Bacteria 851
59 Ga0105237_10285759 3300009545 Bacteria 1652
60 Ga0105238_10022277 3300009551 Bacteria 6458
61 Ga0105238_10192832 3300009551 Bacteria 2013
62 Ga0105239_10329337 3300010375 Bacteria 1723
63 Ga0105246_10087391 3300011119 Bacteria 2238
64 Ga0157371_10190363 3300013102 Bacteria 1469
65 Ga0157369_10012226 3300013105 Bacteria 9747
66 Ga0157369_10067895 3300013105 Bacteria 3831
67 Ga0157369_10151133 3300013105 Bacteria 2454
68 Ga0157369_10552968 3300013105 Bacteria 1189
69 Ga0157372_10325576 3300013307 Bacteria 1789
70 Ga0157372_10984431 3300013307 Bacteria 977
71 Ga0157375_10737722 3300013308 Bacteria 1137
72 Ga0157375_11003276 3300013308 Bacteria 974
73 Ga0157379_10394430 3300014968 Bacteria 1271
74 Ga0157376_10503052 3300014969 Bacteria 1191
75 Ga0157376_10823656 3300014969 Bacteria 942
76 Ga0197907_10153662 3300020069 Bacteria 1151
77 Ga0197907_10550878 3300020069 Bacteria 707
78 Ga0197907_11393107 3300020069 Bacteria 1299
79 Ga0206356_11194992 3300020070 Bacteria 3221
80 Ga0206353_11070135 3300020082 Bacteria 1143
81 Ga0224712_10100853 3300022467 Bacteria 1224
82 Ga0224712_10205311 3300022467 Bacteria 897
83 Ga0207692_10013586 3300025898 Bacteria 3535
84 Ga0207705_10140332 3300025909 Bacteria 1804
85 Ga0207705_10152466 3300025909 Bacteria 1732
86 Ga0207705_10354217 3300025909 Bacteria 1131
87 Ga0207684_10181672 3300025910 Bacteria 1814
88 Ga0207684_10426340 3300025910 Bacteria 1139
89 Ga0207695_10025698 3300025913 Bacteria 6587
90 Ga0207693_10000028 3300025915 Bacteria 120041
91 Ga0207693_10015258 3300025915 Bacteria 6165
92 Ga0207693_10540011 3300025915 Bacteria 909
93 Ga0207693_10718621 3300025915 Bacteria 773
94 Ga0207663_10288674 3300025916 Bacteria 1221
95 Ga0207660_10085875 3300025917 Unclassified 2322
96 Ga0207657_10016939 3300025919 Bacteria 7012
97 Ga0207657_10134129 3300025919 Bacteria 2027
98 Ga0207657_10184267 3300025919 Bacteria 1687
99 Ga0207657_10847529 3300025919 Bacteria 705
100 Ga0207649_10054538 3300025920 Bacteria 2488
101 Ga0207652_10295483 3300025921 Bacteria 1462
102 Ga0207652_10338949 3300025921 Bacteria 1357
103 Ga0207646_10805609 3300025922 Bacteria 836
104 Ga0207646_11010338 3300025922 Bacteria 735
105 Ga0207694_10078400 3300025924 Bacteria 2589
106 Ga0207687_10018169 3300025927 Bacteria 4638
107 Ga0207687_10046917 3300025927 Bacteria 2993
108 Ga0207687_10421065 3300025927 Bacteria 1102
109 Ga0207700_10252407 3300025928 Bacteria 1507
110 Ga0207664_10105788 3300025929 Bacteria 2332
111 Ga0207664_10212958 3300025929 Bacteria 1673
112 Ga0207664_10381306 3300025929 Bacteria 1251
113 Ga0207711_10071146 3300025941 Bacteria 3018
114 Ga0207711_10535097 3300025941 Bacteria 1093
115 Ga0207667_10132972 3300025949 Bacteria 2562
116 Ga0207667_10164501 3300025949 Bacteria 2281
117 Ga0207667_10351928 3300025949 Bacteria 1502
118 Ga0207677_10952420 3300026023 Bacteria 776
119 Ga0207639_10169078 3300026041 Bacteria 1850
120 Ga0207702_10859683 3300026078 Bacteria 898
121 Ga0207674_10076650 3300026116 Bacteria 3351
122 Ga0207675_100839291 3300026118 Bacteria 933
123 Ga0207683_10741590 3300026121 Bacteria 911
124 Ga0207698_10664734 3300026142 Bacteria 1033
125 Ga0265319_1002212 3300028563 Bacteria 10824
126 Ga0265319_1002625 3300028563 Bacteria 9682
127 Ga0265334_10110189 3300028573 Bacteria 990
128 Ga0265318_10000756 3300028577 Bacteria 21559
129 Ga0265318_10013819 3300028577 Bacteria 3401
130 Ga0265318_10101975 3300028577 Bacteria 1056
131 Ga0265322_10056457 3300028654 Bacteria 1114
132 Ga0265338_10016635 3300028800 Bacteria 7979
133 Ga0265338_10017960 3300028800 Bacteria 7595
134 Ga0265338_10086110 3300028800 Bacteria 2617
135 Ga0265330_10001396 3300031235 Bacteria 14126
136 Ga0265332_10001704 3300031238 Bacteria 11977
137 Ga0265328_10031614 3300031239 Bacteria 1967
138 Ga0265320_10149914 3300031240 Bacteria 1053
139 Ga0265325_10069626 3300031241 Bacteria 1769
140 Ga0265339_10183841 3300031249 Bacteria 1039
141 Ga0265339_10230717 3300031249 Bacteria 902
142 Ga0265331_10059720 3300031250 Bacteria 1803
143 Ga0265327_10004069 3300031251 Bacteria 13239
144 Ga0265316_10021655 3300031344 Bacteria 5438
145 Ga0265313_10003337 3300031595 Bacteria 13120
146 Ga0265314_10105533 3300031711 Bacteria 1801
147 Ga0265314_10261264 3300031711 Bacteria 988
148 Ga0265342_10281455 3300031712 Bacteria 880
149 Ga0265342_10291016 3300031712 Bacteria 862
150 Ga0307409_100788418 3300031995 Bacteria 957
151 Ga0307409_101025634 3300031995 Bacteria 844
152 Ga0373958_0058136 3300034819 Bacteria 832
153 Ga0373934_0182428 3300035086 Bacteria 863
154 Ga0373953_0297014 3300035117 Bacteria 705
155 Ga0373960_0227412 3300035121 Bacteria 670
156 Ga0373924_0246198 3300035410 Bacteria 791
157 Ga0373933_0263506 3300035724 Bacteria 1111
158 Ga0373937_0027022 3300036401 Bacteria 5187
159 Ga0373937_0723204 3300036401 Bacteria 942
160 Ga0395899_0023680 3300037312 Bacteria 4647
161 Ga0395899_0046990 3300037312 Bacteria 3214
162 Ga0395899_0082290 3300037312 Bacteria 2341
163 Ga0395899_0197572 3300037312 Bacteria 1404
164 Ga0395899_0300292 3300037312 Bacteria 1087
165 Ga0395900_0034957 3300037418 Bacteria 5176
166 Ga0395900_0140374 3300037418 Bacteria 2474
167 Ga0395900_0350495 3300037418 Bacteria 1450
168 Ga0395900_0631533 3300037418 Bacteria 1009
169 Ga0395898_0005913 3300037466 Bacteria 13148
170 Ga0395898_0020536 3300037466 Bacteria 6708
171 Ga0395898_0061448 3300037466 Bacteria 3649
172 Ga0395898_0071220 3300037466 Bacteria 3360
173 Ga0395898_0125617 3300037466 Bacteria 2458
174 Ga0395898_0182667 3300037466 Bacteria 2004
175 Ga0395898_0219533 3300037466 Bacteria 1814
176 Ga0395898_0394216 3300037466 Bacteria 1320
177 Ga0395898_0705342 3300037466 Bacteria 951
178 Ga0395905_0146459 3300037471 Bacteria 2222
179 Ga0395905_0153596 3300037471 Bacteria 2165
180 Ga0395901_0035501 3300038443 Bacteria 5151
181 Ga0395901_0043954 3300038443 Bacteria 4633
182 Ga0395901_0066623 3300038443 Bacteria 3750
183 Ga0395901_0073606 3300038443 Bacteria 3563
184 Ga0395901_0161264 3300038443 Bacteria 2355
185 Ga0395901_0191636 3300038443 Bacteria 2144
186 Ga0451837_0977187 3300041494 Bacteria 765
187 Ga0451853_2340026 3300041512 Bacteria 942
188 Ga0466969_0186352 3300044656 Bacteria 949
189 Ga0466965_0034257 3300044683 Bacteria 2484
190 Ga0466966_0048751 3300044684 Bacteria 2698
191 Ga0466966_0082321 3300044684 Bacteria 2003
192 Ga0466966_0477676 3300044684 Bacteria 749
193 Ga0466961_0015431 3300044693 Bacteria 4904
194 Ga0466961_0032195 3300044693 Bacteria 3368
195 Ga0466963_0004119 3300044694 Bacteria 8408
196 Ga0466963_0004401 3300044694 Bacteria 8182
197 Ga0466963_0017665 3300044694 Bacteria 4448
198 Ga0466963_0043704 3300044694 Bacteria 2948
199 Ga0466963_0076828 3300044694 Bacteria 2255
200 Ga0466963_0195332 3300044694 Bacteria 1414
201 Ga0466964_0002374 3300044706 Bacteria 6690
202 Ga0466964_0006795 3300044706 Bacteria 4266
203 Ga0466964_0077998 3300044706 Bacteria 1415
204 Ga0466964_0237558 3300044706 Bacteria 892
205 Ga0466971_0001478 3300044719 Bacteria 9925
206 Ga0466971_0026376 3300044719 Bacteria 2596
207 Ga0466971_0103037 3300044719 Bacteria 1313
208 Ga0466968_0027809 3300044735 Bacteria 2328
209 Ga0466968_0063978 3300044735 Bacteria 1590
210 Ga0466968_0087963 3300044735 Bacteria 1373
211 Ga0466968_0113435 3300044735 Bacteria 1220
212 Ga0466957_0025960 3300044842 Bacteria 3473
213 Ga0466957_0038088 3300044842 Bacteria 2896
214 Ga0466957_0074462 3300044842 Bacteria 2105
215 Ga0466957_0078991 3300044842 Bacteria 2047
216 Ga0466960_0015853 3300044901 Bacteria 3258
217 Ga0466960_0432217 3300044901 Bacteria 763
218 Ga0451576_0677173 3300045051 Bacteria 1084
219 Ga0466958_0002089 3300045836 Bacteria 9888
220 Ga0466958_0003304 3300045836 Bacteria 8347
221 Ga0466958_0009005 3300045836 Bacteria 5543
222 Ga0466958_0069070 3300045836 Bacteria 2160
223 Ga0466967_0014571 3300045976 Bacteria 6130
224 Ga0466967_0016937 3300045976 Bacteria 5764
225 Ga0466967_0028052 3300045976 Bacteria 4694
226 Ga0466967_0113435 3300045976 Bacteria 2493
227 Ga0466967_0135165 3300045976 Bacteria 2292
228 Ga0466967_0141069 3300045976 Bacteria 2244
229 Ga0466967_0163544 3300045976 Bacteria 2090
230 Ga0466967_0193645 3300045976 Bacteria 1922
231 Ga0466967_0481886 3300045976 Bacteria 1215
232 Ga0466967_0792897 3300045976 Bacteria 940
233 Ga0466967_0983168 3300045976 Bacteria 840
234 Ga0495617_147499 3300046452 Bacteria 749
235 Ga0495592_0382308 3300046454 Bacteria 895
236 Ga0495603_0054245 3300046455 Bacteria 2376
237 Ga0495629_0050717 3300046459 Bacteria 2906
238 Ga0495629_0257759 3300046459 Bacteria 1199
239 Ga0495641_0011489 3300046461 Bacteria 5039
240 Ga0495641_0055142 3300046461 Bacteria 1805
241 Ga0495641_0171777 3300046461 Bacteria 970
242 Ga0495651_0024786 3300046462 Bacteria 4667
243 Ga0495653_0323365 3300046463 Bacteria 999
244 Ga0495653_0405545 3300046463 Bacteria 866
245 Ga0495605_0030413 3300046474 Bacteria 2770
246 Ga0495605_0081673 3300046474 Bacteria 1511
247 Ga0495662_0064267 3300046476 Bacteria 1773
248 Ga0495664_0042566 3300046477 Bacteria 2690
249 Ga0495584_0039724 3300046491 Bacteria 2377
250 Ga0495584_0126007 3300046491 Bacteria 1298
251 Ga0495584_0405945 3300046491 Bacteria 692
252 Ga0495596_0124119 3300046500 Bacteria 1002
253 Ga0495596_0206404 3300046500 Bacteria 763
254 Ga0495607_0067178 3300046501 Bacteria 2015
255 Ga0495583_0177460 3300046506 Bacteria 873
256 Ga0495608_0014571 3300046511 Bacteria 5455
257 Ga0495608_0274407 3300046511 Bacteria 1048
258 Ga0495608_0283016 3300046511 Bacteria 1029
259 Ga0495618_0113134 3300046514 Bacteria 1738
260 Ga0495628_0284706 3300046516 Bacteria 1226
261 Ga0495630_0117428 3300046517 Bacteria 2017
262 Ga0495630_0222942 3300046517 Bacteria 1439
263 Ga0495630_0453426 3300046517 Bacteria 983
264 Ga0495637_0213692 3300046520 Bacteria 704
265 Ga0495644_0017190 3300046523 Bacteria 2766
266 Ga0495663_0033202 3300046525 Bacteria 1540
267 Ga0495663_0042637 3300046525 Bacteria 1383
268 Ga0495642_0097865 3300046528 Bacteria 1246
269 Ga0495642_0113808 3300046528 Bacteria 1158
270 Ga0495652_0036350 3300046529 Bacteria 4284
271 Ga0495652_0181634 3300046529 Bacteria 1614
272 Ga0495665_0366576 3300046531 Bacteria 733
273 Ga0495640_0159281 3300046533 Bacteria 1447
274 Ga0495586_0059965 3300046535 Bacteria 2068
275 Ga0495587_0269778 3300046536 Bacteria 955
276 Ga0495598_0050719 3300046537 Bacteria 1248
277 Ga0495621_0142349 3300046539 Unclassified 939
278 Ga0495645_0282308 3300046543 Bacteria 1091
279 Ga0495667_0211482 3300046559 Bacteria 1239
280 Ga0495656_0007989 3300046615 Bacteria 3763
281 Ga0495656_0251718 3300046615 Bacteria 892
282 Ga0495668_0092916 3300046616 Bacteria 1652
283 Ga0495634_0047254 3300046642 Bacteria 2901
284 Ga0495634_0073907 3300046642 Bacteria 2241
285 Ga0495634_0099146 3300046642 Bacteria 1884
286 Ga0495635_0036914 3300046663 Bacteria 3384
287 Ga0495635_0299882 3300046663 Bacteria 1077
288 Ga0495659_0009516 3300046664 Bacteria 3104
289 Ga0495659_0017400 3300046664 Bacteria 2382
290 Ga0495657_0253695 3300046675 Bacteria 1058
291 Ga0495599_0116437 3300046678 Bacteria 1662
292 Ga0495623_0105891 3300046679 Bacteria 1709
293 Ga0495669_0240902 3300046684 Bacteria 868
294 Ga0495613_0013632 3300046689 Bacteria 6033
295 Ga0495624_0025741 3300046690 Bacteria 3860
296 Ga0495589_0055667 3300046794 Bacteria 1948
297 Ga0495589_0069648 3300046794 Bacteria 1720
298 Ga0495600_0481595 3300046809 Bacteria 764
299 Ga0495600_0579648 3300046809 Bacteria 683
300 Ga0495660_0215347 3300046810 Bacteria 909
301 Ga0495604_0110255 3300047317 Bacteria 2008
302 Ga0495636_0326574 3300047318 Unclassified 721
303 Ga0495674_0008466 3300047319 Bacteria 9800
304 Ga0495674_0087509 3300047319 Bacteria 2666
305 Ga0495674_0177261 3300047319 Bacteria 1776
306 Ga0495674_0430914 3300047319 Bacteria 1061
307 Ga0495676_0249490 3300047321 Bacteria 1211
308 Ga0495676_0272718 3300047321 Bacteria 1147
309 Ga0495676_0307709 3300047321 Bacteria 1067
310 Ga0495680_0089919 3300047322 Bacteria 2304
311 Ga0495680_0101121 3300047322 Bacteria 2147
312 Ga0495680_0140879 3300047322 Bacteria 1764
313 Ga0495680_0309502 3300047322 Bacteria 1107
314 Ga0495683_0230386 3300047323 Bacteria 822
315 Ga0495677_0116399 3300047445 Bacteria 1018
316 Ga0495679_056700 3300047446 Bacteria 1160
317 Ga0495685_026420 3300047447 Bacteria 1998
318 Ga0495684_0000896 3300047471 Bacteria 24097
319 Ga0495684_0051988 3300047471 Bacteria 3126
320 Ga0495602_0302394 3300048088 Bacteria 1170
321 Ga0496100_0129128 3300048903 Bacteria 1778
322 Ga0496101_0296164 3300048904 Bacteria 1266
323 Ga0496101_0328956 3300048904 Bacteria 1199
324 Ga0496101_0412378 3300048904 Bacteria 1064
325 Ga0496102_0130610 3300048905 Bacteria 2351
326 Ga0496102_0669421 3300048905 Bacteria 961
327 Ga0496103_0111455 3300048906 Bacteria 1738
328 Ga0496104_0127054 3300048907 Bacteria 2448
329 Ga0496104_0127926 3300048907 Bacteria 2439
330 Ga0496104_0145083 3300048907 Bacteria 2279
331 Ga0496104_0597194 3300048907 Bacteria 1014
332 Ga0496105_0003127 3300048908 Bacteria 12182
333 Ga0496105_0006934 3300048908 Bacteria 8725
334 Ga0496105_0177375 3300048908 Bacteria 1745
335 Ga0496105_0186113 3300048908 Bacteria 1699
336 Ga0496106_0073629 3300048909 Bacteria 2613
337 Ga0496106_0152146 3300048909 Bacteria 1826
338 Ga0496107_0023213 3300048910 Bacteria 4385
339 Ga0496107_0434669 3300048910 Bacteria 976
340 Ga0496107_0709541 3300048910 Bacteria 739
341 Ga0496108_0015562 3300048911 Bacteria 6203
342 Ga0496108_0090100 3300048911 Bacteria 2607
343 Ga0496108_0093834 3300048911 Bacteria 2553
344 Ga0496108_0106316 3300048911 Bacteria 2396
345 Ga0496108_0422486 3300048911 Bacteria 1164
346 Ga0496109_0001773 3300048912 Bacteria 17931
347 Ga0496109_0033104 3300048912 Bacteria 4649
348 Ga0496109_0045891 3300048912 Bacteria 3967
349 Ga0496109_0068802 3300048912 Bacteria 3245
350 Ga0496110_0019976 3300048913 Bacteria 5647
351 Ga0496110_0094549 3300048913 Bacteria 2676
352 Ga0496110_0699240 3300048913 Bacteria 915
353 Ga0496110_0725416 3300048913 Bacteria 896
354 Ga0496111_0012196 3300048914 Bacteria 5812
355 Ga0496111_0018272 3300048914 Bacteria 4855
356 Ga0496111_0591774 3300048914 Bacteria 812
357 Ga0496112_0006174 3300048915 Bacteria 10479
358 Ga0496112_0081534 3300048915 Bacteria 3199
359 Ga0496112_0226856 3300048915 Bacteria 1823
360 Ga0496112_0338819 3300048915 Bacteria 1447
361 Ga0496113_0019926 3300048916 Bacteria 4704
362 Ga0496113_0042268 3300048916 Bacteria 3367
363 Ga0496114_0055341 3300048917 Bacteria 3309
364 Ga0496115_0042978 3300048918 Bacteria 3602
365 Ga0496115_0074439 3300048918 Bacteria 2757
366 Ga0496115_0178495 3300048918 Bacteria 1756
367 Ga0496115_0189935 3300048918 Bacteria 1697
368 Ga0496115_0285679 3300048918 Bacteria 1354
369 Ga0496115_0437717 3300048918 Bacteria 1057
370 Ga0501032_0017324 3300049569 Bacteria 5057
371 Ga0501033_0008450 3300049570 Bacteria 7974
372 Ga0501034_0131668 3300049571 Bacteria 2484
373 Ga0501034_0809873 3300049571 Bacteria 829
374 Ga0501036_0003232 3300049572 Bacteria 12993
375 Ga0501037_0015741 3300049573 Bacteria 5565
376 Ga0501038_0000608 3300049574 Bacteria 31822
377 Ga0501038_0906053 3300049574 Bacteria 651
378 Ga0501039_0037733 3300049575 Bacteria 3730
379 Ga0501039_0770161 3300049575 Bacteria 751
380 Ga0501040_0004638 3300049576 Bacteria 8918
381 Ga0501040_0349332 3300049576 Bacteria 1059
382 Ga0501041_0000025 3300049577 Bacteria 48816
383 Ga0501041_0131204 3300049577 Bacteria 1561
384 Ga0501042_0188068 3300049578 Bacteria 1489
385 Ga0501043_0015487 3300049579 Bacteria 5973
386 Ga0501046_0000122 3300049580 Bacteria 82617
387 Ga0501047_0072209 3300049581 Bacteria 3322
388 Ga0501047_0150995 3300049581 Bacteria 2199
389 Ga0501047_0297702 3300049581 Bacteria 1456
390 Ga0501048_0001618 3300049582 Bacteria 17141
391 Ga0501067_0013350 3300049583 Bacteria 4549
392 Ga0501067_0017229 3300049583 Bacteria 3993
393 Ga0501068_0006274 3300049584 Bacteria 6543
394 Ga0501068_0082135 3300049584 Bacteria 1979
395 Ga0501068_0105683 3300049584 Bacteria 1747
396 Ga0501069_0006088 3300049585 Bacteria 6296
397 Ga0501070_0005391 3300049586 Bacteria 10906
398 Ga0501070_0627053 3300049586 Bacteria 855
399 Ga0501071_0108495 3300049587 Bacteria 2050
400 Ga0501071_0591616 3300049587 Bacteria 853
401 Ga0501073_0008113 3300049589 Bacteria 7790
402 Ga0501074_0324228 3300049590 Bacteria 1094
403 Ga0501074_0351201 3300049590 Bacteria 1046
404 Ga0501074_0541199 3300049590 Bacteria 824
405 Ga0501076_0027292 3300049592 Bacteria 4427
406 Ga0501080_0000157 3300049742 Bacteria 48711
407 Ga0501080_0191469 3300049742 Bacteria 1879
408 Ga0501081_0533962 3300049743 Bacteria 875
409 Ga0501083_0001412 3300049744 Bacteria 16364
410 Ga0501035_0017565 3300049822 Bacteria 6601
411 Ga0501035_0409607 3300049822 Bacteria 1127
412 Ga0501044_0008263 3300049823 Bacteria 11414
413 Ga0501045_0000040 3300049824 Bacteria 55360
414 nmdc:mga0n895_6853_c1 3300050512 Bacteria 9728
415 nmdc:mga0a205_190155_c1 3300050515 Bacteria 1945
416 Ga0495601_0105560 3300053077 Bacteria 1821
417 Ga0495612_0214499 3300053078 Bacteria 851
418 Ga0495655_0011092 3300053083 Bacteria 1801
419 Ga0495619_0026041 3300053085 Bacteria 3761
420 Ga0495619_0163135 3300053085 Bacteria 1539
421 Ga0495619_0316492 3300053085 Bacteria 1080
422 Ga0501082_0000240 3300060353 Bacteria 47856
423 Ga0466962_0002804 3300061719 Bacteria 8290
424 Ga0466962_0015157 3300061719 Bacteria 3717
425 Ga0530510_0000090 3300061734 Bacteria 48654
426 Ga0530510_0192737 3300061734 Bacteria 1513
427 Ga0530510_0602343 3300061734 Bacteria 836
428 Ga0157370_10089097
429 Ga0070658_10009371
430 Ga0070658_10205580
431 Ga0070658_10272509
432 Ga0070683_100125306
433 Ga0070680_100043803
434 Ga0070680_100186095
435 Ga0070680_100475128
436 Ga0070682_100599383
437 Ga0070660_100005060
438 Ga0070660_100051349
439 Ga0070660_100076510
440 Ga0070660_101009846
441 Ga0070691_10047668
442 Ga0070691_10132646
443 Ga0070692_10119777
444 Ga0070673_100627758
445 Ga0070714_100027244
446 Ga0070714_100083493
447 Ga0070714_100189350
448 Ga0070713_100030069
449 Ga0070713_100802128
450 Ga0070710_10004617
451 Ga0070711_100020816
452 Ga0070705_100033820
453 Ga0070705_100143722
454 Ga0070694_100880610
455 Ga0070681_10149111
456 Ga0070706_100205864
457 Ga0070706_100506818
458 Ga0070707_100407103
459 Ga0070698_100070413
460 Ga0070698_100244237
461 Ga0070698_100585741
462 Ga0070699_100747023
463 Ga0070679_100005683
464 Ga0070679_100466309
465 Ga0070679_100841532
466 Ga0070684_100195733
467 Ga0070684_100289167
468 Ga0070684_100377433
469 Ga0070696_100443864
470 Ga0068855_100394959
471 Ga0068857_100125573
472 Ga0068856_100146004
473 Ga0070702_100190656
474 Ga0068852_100595451
475 Ga0070717_10009169
476 Ga0070717_10110387
477 Ga0070712_100000003
478 Ga0070712_100112988
479 Ga0070712_100644503
480 Ga0075433_10444463
481 Ga0075434_100273137
482 Ga0105245_10166864
483 Ga0105245_10550500
484 Ga0105248_10793856
485 Ga0105248_11219415
486 Ga0105237_10285759
487 Ga0105238_10022277
488 Ga0105238_10192832
489 Ga0105239_10329337
490 Ga0105246_10087391
491 Ga0157371_10190363
492 Ga0157369_10012226
493 Ga0157369_10067895
494 Ga0157369_10151133
495 Ga0157369_10552968
496 Ga0157372_10325576
497 Ga0157372_10984431
498 Ga0157375_10737722
499 Ga0157375_11003276
500 Ga0157379_10394430
501 Ga0157376_10503052
502 Ga0157376_10823656
503 Ga0197907_10153662
504 Ga0197907_10550878
505 Ga0197907_11393107
506 Ga0206356_11194992
507 Ga0206353_11070135
508 Ga0224712_10100853
509 Ga0224712_10205311
510 Ga0207692_10013586
511 Ga0207705_10140332
512 Ga0207705_10152466
513 Ga0207705_10354217
514 Ga0207684_10181672
515 Ga0207684_10426340
516 Ga0207695_10025698
517 Ga0207693_10000028
518 Ga0207693_10015258
519 Ga0207693_10540011
520 Ga0207693_10718621
521 Ga0207663_10288674
522 Ga0207660_10085875
523 Ga0207657_10016939
524 Ga0207657_10134129
525 Ga0207657_10184267
526 Ga0207657_10847529
527 Ga0207649_10054538
528 Ga0207652_10295483
529 Ga0207652_10338949
530 Ga0207646_10805609
531 Ga0207646_11010338
532 Ga0207694_10078400
533 Ga0207687_10018169
534 Ga0207687_10046917
535 Ga0207687_10421065
536 Ga0207700_10252407
537 Ga0207664_10105788
538 Ga0207664_10212958
539 Ga0207664_10381306
540 Ga0207711_10071146
541 Ga0207711_10535097
542 Ga0207667_10132972
543 Ga0207667_10164501
544 Ga0207667_10351928
545 Ga0207677_10952420
546 Ga0207639_10169078
547 Ga0207702_10859683
548 Ga0207674_10076650
549 Ga0207675_100839291
550 Ga0207683_10741590
551 Ga0207698_10664734
552 Ga0265319_1002212
553 Ga0265319_1002625
554 Ga0265334_10110189
555 Ga0265318_10000756
556 Ga0265318_10013819
557 Ga0265318_10101975
558 Ga0265322_10056457
559 Ga0265338_10016635
560 Ga0265338_10017960
561 Ga0265338_10086110
562 Ga0265330_10001396
563 Ga0265332_10001704
564 Ga0265328_10031614
565 Ga0265320_10149914
566 Ga0265325_10069626
567 Ga0265339_10183841
568 Ga0265339_10230717
569 Ga0265331_10059720
570 Ga0265327_10004069
571 Ga0265316_10021655
572 Ga0265313_10003337
573 Ga0265314_10105533
574 Ga0265314_10261264
575 Ga0265342_10281455
576 Ga0265342_10291016
577 Ga0307409_100788418
578 Ga0307409_101025634
579 Ga0373958_0058136
580 Ga0373934_0182428
581 Ga0373953_0297014
582 Ga0373960_0227412
583 Ga0373924_0246198
584 Ga0373933_0263506
585 Ga0373937_0027022
586 Ga0373937_0723204
587 Ga0395899_0023680
588 Ga0395899_0046990
589 Ga0395899_0082290
590 Ga0395899_0197572
591 Ga0395899_0300292
592 Ga0395900_0034957
593 Ga0395900_0140374
594 Ga0395900_0350495
595 Ga0395900_0631533
596 Ga0395898_0005913
597 Ga0395898_0020536
598 Ga0395898_0061448
599 Ga0395898_0071220
600 Ga0395898_0125617
601 Ga0395898_0182667
602 Ga0395898_0219533
603 Ga0395898_0394216
604 Ga0395898_0705342
605 Ga0395905_0146459
606 Ga0395905_0153596
607 Ga0395901_0035501
608 Ga0395901_0043954
609 Ga0395901_0066623
610 Ga0395901_0073606
611 Ga0395901_0161264
612 Ga0395901_0191636
613 Ga0451837_0977187
614 Ga0451853_2340026
615 Ga0466969_0186352
616 Ga0466965_0034257
617 Ga0466966_0048751
618 Ga0466966_0082321
619 Ga0466966_0477676
620 Ga0466961_0015431
621 Ga0466961_0032195
622 Ga0466963_0004119
623 Ga0466963_0004401
624 Ga0466963_0017665
625 Ga0466963_0043704
626 Ga0466963_0076828
627 Ga0466963_0195332
628 Ga0466964_0002374
629 Ga0466964_0006795
630 Ga0466964_0077998
631 Ga0466964_0237558
632 Ga0466971_0001478
633 Ga0466971_0026376
634 Ga0466971_0103037
635 Ga0466968_0027809
636 Ga0466968_0063978
637 Ga0466968_0087963
638 Ga0466968_0113435
639 Ga0466957_0025960
640 Ga0466957_0038088
641 Ga0466957_0074462
642 Ga0466957_0078991
643 Ga0466960_0015853
644 Ga0466960_0432217
645 Ga0451576_0677173
646 Ga0466958_0002089
647 Ga0466958_0003304
648 Ga0466958_0009005
649 Ga0466958_0069070
650 Ga0466967_0014571
651 Ga0466967_0016937
652 Ga0466967_0028052
653 Ga0466967_0113435
654 Ga0466967_0135165
655 Ga0466967_0141069
656 Ga0466967_0163544
657 Ga0466967_0193645
658 Ga0466967_0481886
659 Ga0466967_0792897
660 Ga0466967_0983168
661 Ga0495617_147499
662 Ga0495592_0382308
663 Ga0495603_0054245
664 Ga0495629_0050717
665 Ga0495629_0257759
666 Ga0495641_0011489
667 Ga0495641_0055142
668 Ga0495641_0171777
669 Ga0495651_0024786
670 Ga0495653_0323365
671 Ga0495653_0405545
672 Ga0495605_0030413
673 Ga0495605_0081673
674 Ga0495662_0064267
675 Ga0495664_0042566
676 Ga0495584_0039724
677 Ga0495584_0126007
678 Ga0495584_0405945
679 Ga0495596_0124119
680 Ga0495596_0206404
681 Ga0495607_0067178
682 Ga0495583_0177460
683 Ga0495608_0014571
684 Ga0495608_0274407
685 Ga0495608_0283016
686 Ga0495618_0113134
687 Ga0495628_0284706
688 Ga0495630_0117428
689 Ga0495630_0222942
690 Ga0495630_0453426
691 Ga0495637_0213692
692 Ga0495644_0017190
693 Ga0495663_0033202
694 Ga0495663_0042637
695 Ga0495642_0097865
696 Ga0495642_0113808
697 Ga0495652_0036350
698 Ga0495652_0181634
699 Ga0495665_0366576
700 Ga0495640_0159281
701 Ga0495586_0059965
702 Ga0495587_0269778
703 Ga0495598_0050719
704 Ga0495621_0142349
705 Ga0495645_0282308
706 Ga0495667_0211482
707 Ga0495656_0007989
708 Ga0495656_0251718
709 Ga0495668_0092916
710 Ga0495634_0047254
711 Ga0495634_0073907
712 Ga0495634_0099146
713 Ga0495635_0036914
714 Ga0495635_0299882
715 Ga0495659_0009516
716 Ga0495659_0017400
717 Ga0495657_0253695
718 Ga0495599_0116437
719 Ga0495623_0105891
720 Ga0495669_0240902
721 Ga0495613_0013632
722 Ga0495624_0025741
723 Ga0495589_0055667
724 Ga0495589_0069648
725 Ga0495600_0481595
726 Ga0495600_0579648
727 Ga0495660_0215347
728 Ga0495604_0110255
729 Ga0495636_0326574
730 Ga0495674_0008466
731 Ga0495674_0087509
732 Ga0495674_0177261
733 Ga0495674_0430914
734 Ga0495676_0249490
735 Ga0495676_0272718
736 Ga0495676_0307709
737 Ga0495680_0089919
738 Ga0495680_0101121
739 Ga0495680_0140879
740 Ga0495680_0309502
741 Ga0495683_0230386
742 Ga0495677_0116399
743 Ga0495679_056700
744 Ga0495685_026420
745 Ga0495684_0000896
746 Ga0495684_0051988
747 Ga0495602_0302394
748 Ga0496100_0129128
749 Ga0496101_0296164
750 Ga0496101_0328956
751 Ga0496101_0412378
752 Ga0496102_0130610
753 Ga0496102_0669421
754 Ga0496103_0111455
755 Ga0496104_0127054
756 Ga0496104_0127926
757 Ga0496104_0145083
758 Ga0496104_0597194
759 Ga0496105_0003127
760 Ga0496105_0006934
761 Ga0496105_0177375
762 Ga0496105_0186113
763 Ga0496106_0073629
764 Ga0496106_0152146
765 Ga0496107_0023213
766 Ga0496107_0434669
767 Ga0496107_0709541
768 Ga0496108_0015562
769 Ga0496108_0090100
770 Ga0496108_0093834
771 Ga0496108_0106316
772 Ga0496108_0422486
773 Ga0496109_0001773
774 Ga0496109_0033104
775 Ga0496109_0045891
776 Ga0496109_0068802
777 Ga0496110_0019976
778 Ga0496110_0094549
779 Ga0496110_0699240
780 Ga0496110_0725416
781 Ga0496111_0012196
782 Ga0496111_0018272
783 Ga0496111_0591774
784 Ga0496112_0006174
785 Ga0496112_0081534
786 Ga0496112_0226856
787 Ga0496112_0338819
788 Ga0496113_0019926
789 Ga0496113_0042268
790 Ga0496114_0055341
791 Ga0496115_0042978
792 Ga0496115_0074439
793 Ga0496115_0178495
794 Ga0496115_0189935
795 Ga0496115_0285679
796 Ga0496115_0437717
797 Ga0501032_0017324
798 Ga0501033_0008450
799 Ga0501034_0131668
800 Ga0501034_0809873
801 Ga0501036_0003232
802 Ga0501037_0015741
803 Ga0501038_0000608
804 Ga0501038_0906053
805 Ga0501039_0037733
806 Ga0501039_0770161
807 Ga0501040_0004638
808 Ga0501040_0349332
809 Ga0501041_0000025
810 Ga0501041_0131204
811 Ga0501042_0188068
812 Ga0501043_0015487
813 Ga0501046_0000122
814 Ga0501047_0072209
815 Ga0501047_0150995
816 Ga0501047_0297702
817 Ga0501048_0001618
818 Ga0501067_0013350
819 Ga0501067_0017229
820 Ga0501068_0006274
821 Ga0501068_0082135
822 Ga0501068_0105683
823 Ga0501069_0006088
824 Ga0501070_0005391
825 Ga0501070_0627053
826 Ga0501071_0108495
827 Ga0501071_0591616
828 Ga0501073_0008113
829 Ga0501074_0324228
830 Ga0501074_0351201
831 Ga0501074_0541199
832 Ga0501076_0027292
833 Ga0501080_0000157
834 Ga0501080_0191469
835 Ga0501081_0533962
836 Ga0501083_0001412
837 Ga0501035_0017565
838 Ga0501035_0409607
839 Ga0501044_0008263
840 Ga0501045_0000040
841 nmdc:mga0n895_6853_c1
842 nmdc:mga0a205_190155_c1
843 Ga0495601_0105560
844 Ga0495612_0214499
845 Ga0495655_0011092
846 Ga0495619_0026041
847 Ga0495619_0163135
848 Ga0495619_0316492
849 Ga0501082_0000240
850 Ga0466962_0002804
851 Ga0466962_0015157
852 Ga0530510_0000090
853 Ga0530510_0192737
854 Ga0530510_0602343

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01726

LexA_DNA_bind

LexA DNA binding domain

41

105

0.98

PF00717

Peptidase_S24

Peptidase S24-like

126

240

0.97

PF09339

HTH_IclR

IclR helix-turn-helix domain

57

100

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xsj-assembly1.cif.gz_F structure of desulforubidin from desulfomicrobium norvegicum 0.9626 2 35
3or1-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase i (dsri) 0.9549 4 37
3or2-assembly1.cif.gz_F crystal structure of dissimilatory sulfite reductase ii (dsrii) 0.9315 1 36
1lea-assembly1.cif.gz_A solution structure of the lexa repressor dna binding determined by 1h nmr spectroscopy 0.9219 2 67
2a5w-assembly2.cif.gz_B crystal structure of the oxidized gamma-subunit of the dissimilatory sulfite reductase (dsrc) from archaeoglobus fulgidus 0.9178 1 33
ID Description Score Start End Superfamily
3k2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9665 2 67 1.10.10.10
2a5wC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.9592 3 33 1.10.10.370
1jhhA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9568 1 67 1.10.10.10
2v4jF02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;DsrC protein, C-terminal domain 0.9554 3 37 1.10.10.370
3k2zA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9517 2 67 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1C4B6R4-F1-model_v4 LexA DNA binding domain protein (EC 3.4.21.88) 0.9944 1 67 GO:0004252
GO:0006508
AF-A0A1G9AK63-F1-model_v4 LexA DNA binding domain-containing protein 0.9929 2 67 GO:0004252
GO:0006508
AF-A0A3N5SKC3-F1-model_v4 Repressor LexA 0.9899 2 68 GO:0004252
GO:0006508
AF-U1X8K5-F1-model_v4 LexA DNA binding domain protein 0.9871 2 67 GO:0004252
GO:0006508
AF-A0A544TAC9-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9824 2 67 GO:0004252
GO:0006508

Map