F441185

General Info

Members Datasets Scaffolds Average Seq Length
426 220 852 256

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10758120|Ga0114129_107581201
Length 284
Sequence MRSRKRLRRFARSLPERLNGIPSFGVAVAFAVAWLMAASVNAQPAPPADWKPEGPVPRATDGKPDLTGVWWLGTEPALAGGRVGSVRSGPVPDPPAGSTFASLYQPWAKEKAKTLSDKDDPSLRCVASVGGPPNTNIFQLVQTPKVVVLLQETYHGFRIIPTEPGRRHSEEQPAAYWGDSVGKWDGDTLVVDVTTFNDRNWISPQGVVSFHSDALHVTERYRRVAANAMDVEKTYDDPKVLIRPWVSKKTYRLAPFDQIMEAMCTNTDTAALMDAAAKQNYGKK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
165 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
197 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
198 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
204 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
205 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
208 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.94
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 15.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10758120 3300009147 Bacteria 1242
2 SwRhRL2b_contig_2398844 2162886007 Bacteria 950
3 SwRhRL2b_contig_313575 2162886007 Unclassified 917
4 JGI25406J46586_10000079 3300003203 Bacteria 43904
5 JGI25406J46586_10000206 3300003203 Bacteria 26191
6 Ga0058862_11967608 3300004803 Bacteria 1345
7 Ga0065704_10002347 3300005289 Bacteria 6766
8 Ga0065704_10327463 3300005289 Unclassified 843
9 Ga0065715_10125106 3300005293 Bacteria 2111
10 Ga0065707_10001650 3300005295 Bacteria 6791
11 Ga0065707_10281020 3300005295 Unclassified 1047
12 Ga0070676_10194944 3300005328 Bacteria 1325
13 Ga0070683_100008852 3300005329 Bacteria 8568
14 Ga0070683_100016107 3300005329 Bacteria 6581
15 Ga0070683_100023384 3300005329 Bacteria 5527
16 Ga0070683_100446230 3300005329 Bacteria 1234
17 Ga0070670_100177817 3300005331 Bacteria 1847
18 Ga0068869_100056203 3300005334 Bacteria 2870
19 Ga0068869_100150410 3300005334 Unclassified 1805
20 Ga0070666_10165650 3300005335 Bacteria 1546
21 Ga0070666_10320397 3300005335 Bacteria 1106
22 Ga0070680_100038331 3300005336 Bacteria 3876
23 Ga0068868_100268028 3300005338 Bacteria 1442
24 Ga0070660_100093144 3300005339 Bacteria 2379
25 Ga0070689_100020976 3300005340 Unclassified 4856
26 Ga0070691_10000025 3300005341 Bacteria 41015
27 Ga0070692_10011494 3300005345 Bacteria 4067
28 Ga0070669_100000732 3300005353 Bacteria 23931
29 Ga0070675_100013256 3300005354 Bacteria 6477
30 Ga0070675_100013829 3300005354 Bacteria 6353
31 Ga0070675_100026767 3300005354 Bacteria 4628
32 Ga0070675_100186613 3300005354 Bacteria 1795
33 Ga0070671_100090190 3300005355 Bacteria 2566
34 Ga0070671_100188146 3300005355 Bacteria 1749
35 Ga0070674_100072362 3300005356 Bacteria 2441
36 Ga0070673_100004593 3300005364 Bacteria 8753
37 Ga0070673_100008570 3300005364 Bacteria 6806
38 Ga0070673_100211412 3300005364 Unclassified 1675
39 Ga0070673_100233020 3300005364 Bacteria 1598
40 Ga0070688_100027102 3300005365 Bacteria 3411
41 Ga0070688_100080670 3300005365 Bacteria 2105
42 Ga0070667_100075004 3300005367 Unclassified 2887
43 Ga0070709_10183227 3300005434 Unclassified 1472
44 Ga0070701_10001258 3300005438 Bacteria 9296
45 Ga0070701_10005816 3300005438 Bacteria 5136
46 Ga0070705_100000959 3300005440 Bacteria 16160
47 Ga0070705_100004146 3300005440 Bacteria 7081
48 Ga0070700_100003075 3300005441 Bacteria 8557
49 Ga0070700_100340874 3300005441 Bacteria 1108
50 Ga0070694_100123542 3300005444 Unclassified 1860
51 Ga0070694_100154588 3300005444 Bacteria 1678
52 Ga0070694_100209927 3300005444 Unclassified 1456
53 Ga0070708_100474667 3300005445 Bacteria 1180
54 Ga0070708_100555459 3300005445 Bacteria 1083
55 Ga0070678_100127601 3300005456 Bacteria 2016
56 Ga0070678_100229100 3300005456 Bacteria 1548
57 Ga0070662_100027643 3300005457 Bacteria 3940
58 Ga0070662_100052527 3300005457 Bacteria 2947
59 Ga0070681_10001329 3300005458 Bacteria 21604
60 Ga0070681_10196333 3300005458 Bacteria 1937
61 Ga0068867_100006458 3300005459 Bacteria 8279
62 Ga0068867_100055524 3300005459 Bacteria 2929
63 Ga0068867_100079246 3300005459 Bacteria 2472
64 Ga0068867_100566959 3300005459 Bacteria 986
65 Ga0070707_100217286 3300005468 Bacteria 1863
66 Ga0070698_100006793 3300005471 Bacteria 12402
67 Ga0070698_100024171 3300005471 Bacteria 6340
68 Ga0070698_100133395 3300005471 Bacteria 2438
69 Ga0070699_100002432 3300005518 Bacteria 16705
70 Ga0070699_100009902 3300005518 Bacteria 8254
71 Ga0070699_100011500 3300005518 Bacteria 7641
72 Ga0070699_100030071 3300005518 Bacteria 4687
73 Ga0070699_100111498 3300005518 Bacteria 2402
74 Ga0070699_100277140 3300005518 Unclassified 1502
75 Ga0070699_100382444 3300005518 Bacteria 1271
76 Ga0070679_100002806 3300005530 Bacteria 15824
77 Ga0070679_100067639 3300005530 Bacteria 3563
78 Ga0070684_100047706 3300005535 Bacteria 3712
79 Ga0070684_100064449 3300005535 Bacteria 3214
80 Ga0070684_100079900 3300005535 Bacteria 2892
81 Ga0070684_100105646 3300005535 Bacteria 2520
82 Ga0070684_100161485 3300005535 Bacteria 2033
83 Ga0070697_100312580 3300005536 Bacteria 1352
84 Ga0068853_100033006 3300005539 Bacteria 4389
85 Ga0068853_100106413 3300005539 Bacteria 2486
86 Ga0070672_100062132 3300005543 Unclassified 2947
87 Ga0070672_100222686 3300005543 Bacteria 1583
88 Ga0070695_100000008 3300005545 Bacteria 88588
89 Ga0070695_100080619 3300005545 Bacteria 2152
90 Ga0070695_100490780 3300005545 Unclassified 948
91 Ga0070696_100000399 3300005546 Bacteria 26916
92 Ga0070696_100009620 3300005546 Bacteria 6465
93 Ga0070696_100013032 3300005546 Bacteria 5579
94 Ga0070696_100058433 3300005546 Unclassified 2693
95 Ga0070696_100063630 3300005546 Bacteria 2584
96 Ga0070696_100439826 3300005546 Unclassified 1027
97 Ga0070704_100677450 3300005549 Bacteria 913
98 Ga0068855_100002727 3300005563 Bacteria 21764
99 Ga0068855_100144524 3300005563 Bacteria 2709
100 Ga0070664_100556001 3300005564 Bacteria 1061
101 Ga0068857_100006026 3300005577 Bacteria 10352
102 Ga0068857_100019393 3300005577 Bacteria 5971
103 Ga0068857_100153275 3300005577 Bacteria 2089
104 Ga0068857_100169472 3300005577 Unclassified 1984
105 Ga0068854_100229456 3300005578 Bacteria 1473
106 Ga0068856_100010994 3300005614 Bacteria 8789
107 Ga0068856_100031674 3300005614 Bacteria 5175
108 Ga0068856_100280838 3300005614 Bacteria 1682
109 Ga0068852_100005439 3300005616 Bacteria 9105
110 Ga0068852_100113971 3300005616 Bacteria 2463
111 Ga0068859_100008107 3300005617 Bacteria 10654
112 Ga0068859_100013036 3300005617 Bacteria 8352
113 Ga0068859_100161336 3300005617 Bacteria 2321
114 Ga0068859_100312315 3300005617 Bacteria 1665
115 Ga0068864_100014288 3300005618 Bacteria 6594
116 Ga0068864_100184844 3300005618 Unclassified 1907
117 Ga0068864_100203761 3300005618 Unclassified 1819
118 Ga0068864_100442086 3300005618 Bacteria 1242
119 Ga0068861_100023804 3300005719 Bacteria 4421
120 Ga0068861_100377844 3300005719 Bacteria 1251
121 Ga0068861_101026205 3300005719 Bacteria 789
122 Ga0068870_10015152 3300005840 Bacteria 3652
123 Ga0068870_10215570 3300005840 Bacteria 1172
124 Ga0068863_100043116 3300005841 Bacteria 4284
125 Ga0068858_100106507 3300005842 Unclassified 2617
126 Ga0068858_100208762 3300005842 Bacteria 1848
127 Ga0068858_100381766 3300005842 Unclassified 1352
128 Ga0068858_100694253 3300005842 Bacteria 990
129 Ga0068860_100109215 3300005843 Unclassified 2644
130 Ga0068860_100208573 3300005843 Bacteria 1895
131 Ga0068860_100418578 3300005843 Bacteria 1328
132 Ga0068862_100002079 3300005844 Bacteria 18051
133 Ga0068862_100426058 3300005844 Bacteria 1246
134 Ga0081539_10000025 3300005985 Bacteria 340255
135 Ga0081539_10000089 3300005985 Bacteria 212146
136 Ga0081539_10002585 3300005985 Bacteria 24951
137 Ga0097621_100027255 3300006237 Bacteria 4491
138 Ga0097621_100049744 3300006237 Bacteria 3407
139 Ga0097621_100056801 3300006237 Bacteria 3198
140 Ga0068871_100002885 3300006358 Bacteria 11792
141 Ga0068871_100041089 3300006358 Bacteria 3707
142 Ga0068871_100148529 3300006358 Bacteria 1998
143 Ga0075428_100001219 3300006844 Bacteria 27541
144 Ga0075428_100004123 3300006844 Bacteria 15994
145 Ga0075428_100005129 3300006844 Bacteria 14559
146 Ga0075430_100030852 3300006846 Bacteria 4552
147 Ga0075431_100010456 3300006847 Bacteria 9331
148 Ga0075431_100016981 3300006847 Bacteria 7391
149 Ga0075433_10005818 3300006852 Bacteria 9709
150 Ga0075433_10006696 3300006852 Bacteria 9126
151 Ga0075433_10032473 3300006852 Bacteria 4472
152 Ga0075433_10106541 3300006852 Bacteria 2485
153 Ga0075433_10190705 3300006852 Bacteria 1823
154 Ga0075433_10194868 3300006852 Unclassified 1802
155 Ga0075434_100008265 3300006871 Bacteria 9666
156 Ga0075434_100008589 3300006871 Bacteria 9506
157 Ga0075434_100686260 3300006871 Bacteria 1042
158 Ga0075429_100012613 3300006880 Bacteria 7328
159 Ga0075429_100115042 3300006880 Archaea 2351
160 Ga0068865_100080649 3300006881 Bacteria 2334
161 Ga0068865_100203715 3300006881 Bacteria 1537
162 Ga0097620_100008108 3300006931 Bacteria 10654
163 Ga0097620_100013036 3300006931 Bacteria 8352
164 Ga0097620_100161346 3300006931 Bacteria 2321
165 Ga0097620_100312310 3300006931 Bacteria 1665
166 Ga0075435_100026042 3300007076 Unclassified 4560
167 Ga0075435_100098260 3300007076 Bacteria 2423
168 Ga0105240_10002487 3300009093 Bacteria 29604
169 Ga0111539_10006287 3300009094 Bacteria 15334
170 Ga0111539_10009827 3300009094 Bacteria 12075
171 Ga0111539_10009960 3300009094 Bacteria 11985
172 Ga0111539_10020861 3300009094 Bacteria 8067
173 Ga0111539_10024748 3300009094 Bacteria 7362
174 Ga0105245_10000428 3300009098 Bacteria 39167
175 Ga0105245_10011520 3300009098 Bacteria 7701
176 Ga0105245_10036657 3300009098 Bacteria 4357
177 Ga0114129_10000028 3300009147 Bacteria 112185
178 Ga0114129_10002936 3300009147 Bacteria 23856
179 Ga0114129_10017645 3300009147 Bacteria 10161
180 Ga0114129_10024341 3300009147 Bacteria 8578
181 Ga0114129_10031979 3300009147 Bacteria 7438
182 Ga0105243_10013344 3300009148 Bacteria 6213
183 Ga0105243_10289771 3300009148 Bacteria 1478
184 Ga0105243_10793823 3300009148 Unclassified 932
185 Ga0105241_10014635 3300009174 Bacteria 5744
186 Ga0105242_10007430 3300009176 Bacteria 8436
187 Ga0105242_10128170 3300009176 Bacteria 2187
188 Ga0105248_10006673 3300009177 Bacteria 12666
189 Ga0105248_10025213 3300009177 Bacteria 6610
190 Ga0105237_10068458 3300009545 Bacteria 3543
191 Ga0105238_10024043 3300009551 Bacteria 6212
192 Ga0105238_10025133 3300009551 Bacteria 6070
193 Ga0105238_10095088 3300009551 Bacteria 2967
194 Ga0105249_10087348 3300009553 Unclassified 2909
195 Ga0105249_10262825 3300009553 Unclassified 1716
196 Ga0105249_10524539 3300009553 Bacteria 1232
197 Ga0105239_10006385 3300010375 Bacteria 13697
198 Ga0105246_10001182 3300011119 Bacteria 15176
199 Ga0105246_10244775 3300011119 Bacteria 1420
200 Ga0157370_10005766 3300013104 Bacteria 13840
201 Ga0157369_10017489 3300013105 Bacteria 8057
202 Ga0157369_10371579 3300013105 Bacteria 1484
203 Ga0157374_10043802 3300013296 Bacteria 4135
204 Ga0157374_10383016 3300013296 Bacteria 1401
205 Ga0157378_10000890 3300013297 Bacteria 27558
206 Ga0157378_10127343 3300013297 Bacteria 2354
207 Ga0163162_10051280 3300013306 Bacteria 4140
208 Ga0157372_10090162 3300013307 Bacteria 3485
209 Ga0157372_10122255 3300013307 Unclassified 2991
210 Ga0157372_10276024 3300013307 Bacteria 1954
211 Ga0157372_10638464 3300013307 Unclassified 1240
212 Ga0157375_10019064 3300013308 Bacteria 6230
213 Ga0157375_10055772 3300013308 Bacteria 3897
214 Ga0157375_10435679 3300013308 Bacteria 1477
215 Ga0163163_10062979 3300014325 Bacteria 3676
216 Ga0163163_10102339 3300014325 Bacteria 2888
217 Ga0163163_10210587 3300014325 Bacteria 1993
218 Ga0157380_10248655 3300014326 Bacteria 1608
219 Ga0157377_10001298 3300014745 Bacteria 10712
220 Ga0157377_10009690 3300014745 Unclassified 4738
221 Ga0157379_10093708 3300014968 Bacteria 2694
222 Ga0157376_10052598 3300014969 Bacteria 3387
223 Ga0157376_10264756 3300014969 Bacteria 1612
224 Ga0157376_10559578 3300014969 Bacteria 1133
225 Ga0157376_10614242 3300014969 Bacteria 1083
226 Ga0197907_10653354 3300020069 Bacteria 1408
227 Ga0206356_10005544 3300020070 Unclassified 1487
228 Ga0206352_10543391 3300020078 Bacteria 1316
229 Ga0207682_10068621 3300025893 Unclassified 1498
230 Ga0207699_10121673 3300025906 Unclassified 1689
231 Ga0207645_10093523 3300025907 Bacteria 1934
232 Ga0207643_10002887 3300025908 Bacteria 9275
233 Ga0207643_10065515 3300025908 Unclassified 2081
234 Ga0207705_10264096 3300025909 Unclassified 1315
235 Ga0207654_10023845 3300025911 Bacteria 3283
236 Ga0207707_10001181 3300025912 Bacteria 24586
237 Ga0207707_10477876 3300025912 Bacteria 1065
238 Ga0207695_10000808 3300025913 Bacteria 58272
239 Ga0207695_10005259 3300025913 Bacteria 17272
240 Ga0207671_10010883 3300025914 Bacteria 7458
241 Ga0207660_10042145 3300025917 Bacteria 3202
242 Ga0207662_10321492 3300025918 Bacteria 1033
243 Ga0207657_10104446 3300025919 Bacteria 2347
244 Ga0207681_10012653 3300025923 Bacteria 5209
245 Ga0207694_10005318 3300025924 Bacteria 9920
246 Ga0207694_10020826 3300025924 Bacteria 4963
247 Ga0207694_10060646 3300025924 Bacteria 2944
248 Ga0207659_10004959 3300025926 Bacteria 8069
249 Ga0207659_10034725 3300025926 Bacteria 3480
250 Ga0207687_10021860 3300025927 Bacteria 4252
251 Ga0207687_10071158 3300025927 Unclassified 2485
252 Ga0207700_10027774 3300025928 Bacteria 3969
253 Ga0207644_10096157 3300025931 Bacteria 2216
254 Ga0207706_10006371 3300025933 Bacteria 10964
255 Ga0207706_10073542 3300025933 Bacteria 3006
256 Ga0207686_10107177 3300025934 Bacteria 1877
257 Ga0207670_10065973 3300025936 Unclassified 2485
258 Ga0207670_10264903 3300025936 Bacteria 1334
259 Ga0207704_10141016 3300025938 Bacteria 1686
260 Ga0207691_10101886 3300025940 Bacteria 2562
261 Ga0207691_10153014 3300025940 Bacteria 2027
262 Ga0207711_10001566 3300025941 Bacteria 21136
263 Ga0207711_10214474 3300025941 Unclassified 1759
264 Ga0207711_10464360 3300025941 Unclassified 1179
265 Ga0207689_10029298 3300025942 Bacteria 4598
266 Ga0207689_10146309 3300025942 Bacteria 1947
267 Ga0207689_10220156 3300025942 Bacteria 1568
268 Ga0207661_10012167 3300025944 Bacteria 6248
269 Ga0207661_10434720 3300025944 Bacteria 1193
270 Ga0207667_10000673 3300025949 Bacteria 44277
271 Ga0207667_10002992 3300025949 Bacteria 20996
272 Ga0207651_10126170 3300025960 Bacteria 1950
273 Ga0207651_10149846 3300025960 Bacteria 1814
274 Ga0207651_10179947 3300025960 Unclassified 1676
275 Ga0207651_10476555 3300025960 Unclassified 1075
276 Ga0207668_10073038 3300025972 Bacteria 2457
277 Ga0207668_10229566 3300025972 Bacteria 1496
278 Ga0207640_10173577 3300025981 Bacteria 1609
279 Ga0207658_10082941 3300025986 Unclassified 2463
280 Ga0207703_10067327 3300026035 Bacteria 2947
281 Ga0207703_10145356 3300026035 Bacteria 2062
282 Ga0207703_10240712 3300026035 Unclassified 1627
283 Ga0207639_10019077 3300026041 Bacteria 4884
284 Ga0207708_10025403 3300026075 Bacteria 4480
285 Ga0207708_10108421 3300026075 Bacteria 2154
286 Ga0207702_10088623 3300026078 Bacteria 2704
287 Ga0207702_10141105 3300026078 Bacteria 2180
288 Ga0207702_10197005 3300026078 Bacteria 1865
289 Ga0207648_10006038 3300026089 Bacteria 12080
290 Ga0207676_10010666 3300026095 Bacteria 6554
291 Ga0207676_10197048 3300026095 Unclassified 1777
292 Ga0207676_10379632 3300026095 Bacteria 1315
293 Ga0207676_10425903 3300026095 Bacteria 1246
294 Ga0207674_10011373 3300026116 Bacteria 10002
295 Ga0207674_10025173 3300026116 Bacteria 6350
296 Ga0207674_10096868 3300026116 Bacteria 2934
297 Ga0207675_100000826 3300026118 Bacteria 30859
298 Ga0207675_100381272 3300026118 Bacteria 1386
299 Ga0207675_100474848 3300026118 Bacteria 1242
300 Ga0207683_10173554 3300026121 Bacteria 1953
301 Ga0207683_10196606 3300026121 Bacteria 1832
302 Ga0207683_10424334 3300026121 Unclassified 1225
303 Ga0207698_10004976 3300026142 Bacteria 8147
304 Ga0207698_10104893 3300026142 Bacteria 2353
305 Ga0207428_10002028 3300027907 Bacteria 20463
306 Ga0268266_10305316 3300028379 Bacteria 1486
307 Ga0268265_10006123 3300028380 Bacteria 8161
308 Ga0268265_10169160 3300028380 Bacteria 1866
309 Ga0268264_10019941 3300028381 Bacteria 5477
310 Ga0268264_10061247 3300028381 Bacteria 3156
311 Ga0268264_10290415 3300028381 Bacteria 1535
312 Ga0268264_10547238 3300028381 Bacteria 1135
313 Ga0265340_10006447 3300031247 Bacteria 6459
314 Ga0307408_100299371 3300031548 Bacteria 1347
315 Ga0265313_10015385 3300031595 Unclassified 4457
316 Ga0265314_10043514 3300031711 Bacteria 3192
317 Ga0307405_10034846 3300031731 Bacteria 3000
318 Ga0307406_10056165 3300031901 Bacteria 2520
319 Ga0307416_100001290 3300032002 Bacteria 13512
320 Ga0307416_100820074 3300032002 Unclassified 1027
321 Ga0307414_10578864 3300032004 Bacteria 1004
322 Ga0373936_0002048 3300035113 Bacteria 7470
323 Ga0373956_0131311 3300035119 Bacteria 1172
324 Ga0373943_0005676 3300035170 Bacteria 5597
325 Ga0373955_0003766 3300035172 Bacteria 6682
326 Ga0373961_0012047 3300035241 Bacteria 2158
327 Ga0373924_0011505 3300035410 Bacteria 3287
328 Ga0373935_0055769 3300035692 Unclassified 2518
329 Ga0373935_0177160 3300035692 Bacteria 1462
330 Ga0373927_0046496 3300035695 Unclassified 2808
331 Ga0373933_0017079 3300035724 Bacteria 4069
332 Ga0373933_0290977 3300035724 Bacteria 1056
333 Ga0373937_0001838 3300036401 Bacteria 17833
334 Ga0373937_0016755 3300036401 Bacteria 6513
335 Ga0373937_0022295 3300036401 Bacteria 5694
336 Ga0373937_0182987 3300036401 Bacteria 1968
337 Ga0373937_0231155 3300036401 Unclassified 1742
338 Ga0373937_0444932 3300036401 Bacteria 1230
339 Ga0373925_0002049 3300037068 Bacteria 16609
340 Ga0373925_0176492 3300037068 Bacteria 1689
341 Ga0373925_0400776 3300037068 Bacteria 1119
342 Ga0436363_0930035 3300039450 Bacteria 889
343 Ga0439453_0052562 3300041408 Bacteria 827
344 Ga0451576_0005960 3300045051 Bacteria 15094
345 Ga0451576_0073459 3300045051 Bacteria 3559
346 Ga0451576_0650287 3300045051 Unclassified 1108
347 Ga0495592_0134848 3300046454 Bacteria 1723
348 Ga0495629_0350331 3300046459 Bacteria 1007
349 Ga0495580_0054206 3300046472 Bacteria 2829
350 Ga0495580_0106434 3300046472 Bacteria 1948
351 Ga0495580_0402911 3300046472 Bacteria 922
352 Ga0495582_0005958 3300046473 Bacteria 6796
353 Ga0495618_0137929 3300046514 Bacteria 1560
354 Ga0495630_0003772 3300046517 Bacteria 10583
355 Ga0495663_0003104 3300046525 Bacteria 4852
356 Ga0495663_0013039 3300046525 Unclassified 2322
357 Ga0495652_0070646 3300046529 Bacteria 2917
358 Ga0495652_0106629 3300046529 Bacteria 2262
359 Ga0495665_0030540 3300046531 Bacteria 2884
360 Ga0495665_0163015 3300046531 Bacteria 1162
361 Ga0495586_0016182 3300046535 Bacteria 3968
362 Ga0495587_0000977 3300046536 Bacteria 18741
363 Ga0495587_0029142 3300046536 Bacteria 3352
364 Ga0495587_0062357 3300046536 Bacteria 2183
365 Ga0495656_0075864 3300046615 Bacteria 1505
366 Ga0495659_0022108 3300046664 Unclassified 2148
367 Ga0495659_0041512 3300046664 Unclassified 1643
368 Ga0495659_0078217 3300046664 Unclassified 1251
369 Ga0495599_0012686 3300046678 Bacteria 5197
370 Ga0495623_0144566 3300046679 Unclassified 1411
371 Ga0495658_0022654 3300046683 Bacteria 3325
372 Ga0495658_0041210 3300046683 Bacteria 2571
373 Ga0495669_0088628 3300046684 Bacteria 1427
374 Ga0495613_0000186 3300046689 Bacteria 60855
375 Ga0495600_0271417 3300046809 Bacteria 1076
376 Ga0495581_0218612 3300047315 Bacteria 1114
377 Ga0495604_0107169 3300047317 Bacteria 2043
378 Ga0495674_0027250 3300047319 Bacteria 5223
379 Ga0495680_0293173 3300047322 Unclassified 1144
380 Ga0495677_0050730 3300047445 Bacteria 1527
381 Ga0495685_022043 3300047447 Unclassified 2192
382 Ga0495684_0000099 3300047471 Bacteria 60765
383 Ga0495684_0116107 3300047471 Bacteria 2018
384 Ga0495602_0274427 3300048088 Bacteria 1245
385 Ga0496106_0328496 3300048909 Bacteria 1228
386 Ga0496112_0128255 3300048915 Bacteria 2508
387 Ga0496114_0000558 3300048917 Bacteria 27652
388 Ga0496115_0188925 3300048918 Bacteria 1702
389 Ga0501039_0004523 3300049575 Bacteria 10503
390 Ga0501041_0012162 3300049577 Bacteria 5097
391 Ga0501046_0010927 3300049580 Bacteria 7783
392 Ga0501071_0124020 3300049587 Unclassified 1916
393 Ga0501072_0030155 3300049588 Bacteria 4240
394 Ga0501072_0762628 3300049588 Bacteria 759
395 Ga0501075_0034991 3300049591 Bacteria 3744
396 Ga0501076_0019746 3300049592 Bacteria 5154
397 Ga0501077_0036440 3300049593 Bacteria 3134
398 Ga0501079_0010669 3300049741 Bacteria 6995
399 Ga0501081_0037184 3300049743 Bacteria 3321
400 Ga0501045_0040417 3300049824 Bacteria 3394
401 nmdc:mga05p37_12791_c1 3300050507 Bacteria 10031
402 nmdc:mga05p37_15857_c1 3300050507 Bacteria 9063
403 nmdc:mga05p37_33112_c1 3300050507 Bacteria 6329
404 nmdc:mga05p37_43363_c1 3300050507 Bacteria 5534
405 nmdc:mga05p37_89097_c1 3300050507 Unclassified 3802
406 nmdc:mga05p37_900295_c1 3300050507 Bacteria 954
407 nmdc:mga09592_11810_c1 3300050508 Bacteria 7103
408 nmdc:mga09592_520697_c1 3300050508 Unclassified 1023
409 nmdc:mga09592_98155_c1 3300050508 Bacteria 2507
410 nmdc:mga0qj67_561629_c1 3300050509 Bacteria 915
411 nmdc:mga06r32_115273_c1 3300050510 Bacteria 2646
412 nmdc:mga06r32_8613_c1 3300050510 Bacteria 9196
413 nmdc:mga08y16_107297_c1 3300050511 Bacteria 2907
414 nmdc:mga08y16_16388_c1 3300050511 Bacteria 7792
415 nmdc:mga08y16_68173_c1 3300050511 Bacteria 3710
416 nmdc:mga0n895_29715_c1 3300050512 Bacteria 5216
417 nmdc:mga0n895_460466_c1 3300050512 Unclassified 1284
418 nmdc:mga0rr50_189234_c1 3300050513 Unclassified 1686
419 nmdc:mga0rr50_221277_c1 3300050513 Unclassified 1563
420 nmdc:mga0a205_4054_c1 3300050515 Bacteria 13094
421 nmdc:mga0a205_80580_c1 3300050515 Bacteria 3145
422 nmdc:mga0a205_9105_c1 3300050515 Bacteria 9060
423 Ga0495601_0117303 3300053077 Bacteria 1727
424 Ga0495619_0001935 3300053085 Bacteria 13808
425 Ga0500568_0000292 3300053139 Bacteria 40978
426 Ga0501084_0470380 3300054114 Unclassified 1062
427 Ga0114129_10758120
428 SwRhRL2b_contig_2398844
429 SwRhRL2b_contig_313575
430 JGI25406J46586_10000079
431 JGI25406J46586_10000206
432 Ga0058862_11967608
433 Ga0065704_10002347
434 Ga0065704_10327463
435 Ga0065715_10125106
436 Ga0065707_10001650
437 Ga0065707_10281020
438 Ga0070676_10194944
439 Ga0070683_100008852
440 Ga0070683_100016107
441 Ga0070683_100023384
442 Ga0070683_100446230
443 Ga0070670_100177817
444 Ga0068869_100056203
445 Ga0068869_100150410
446 Ga0070666_10165650
447 Ga0070666_10320397
448 Ga0070680_100038331
449 Ga0068868_100268028
450 Ga0070660_100093144
451 Ga0070689_100020976
452 Ga0070691_10000025
453 Ga0070692_10011494
454 Ga0070669_100000732
455 Ga0070675_100013256
456 Ga0070675_100013829
457 Ga0070675_100026767
458 Ga0070675_100186613
459 Ga0070671_100090190
460 Ga0070671_100188146
461 Ga0070674_100072362
462 Ga0070673_100004593
463 Ga0070673_100008570
464 Ga0070673_100211412
465 Ga0070673_100233020
466 Ga0070688_100027102
467 Ga0070688_100080670
468 Ga0070667_100075004
469 Ga0070709_10183227
470 Ga0070701_10001258
471 Ga0070701_10005816
472 Ga0070705_100000959
473 Ga0070705_100004146
474 Ga0070700_100003075
475 Ga0070700_100340874
476 Ga0070694_100123542
477 Ga0070694_100154588
478 Ga0070694_100209927
479 Ga0070708_100474667
480 Ga0070708_100555459
481 Ga0070678_100127601
482 Ga0070678_100229100
483 Ga0070662_100027643
484 Ga0070662_100052527
485 Ga0070681_10001329
486 Ga0070681_10196333
487 Ga0068867_100006458
488 Ga0068867_100055524
489 Ga0068867_100079246
490 Ga0068867_100566959
491 Ga0070707_100217286
492 Ga0070698_100006793
493 Ga0070698_100024171
494 Ga0070698_100133395
495 Ga0070699_100002432
496 Ga0070699_100009902
497 Ga0070699_100011500
498 Ga0070699_100030071
499 Ga0070699_100111498
500 Ga0070699_100277140
501 Ga0070699_100382444
502 Ga0070679_100002806
503 Ga0070679_100067639
504 Ga0070684_100047706
505 Ga0070684_100064449
506 Ga0070684_100079900
507 Ga0070684_100105646
508 Ga0070684_100161485
509 Ga0070697_100312580
510 Ga0068853_100033006
511 Ga0068853_100106413
512 Ga0070672_100062132
513 Ga0070672_100222686
514 Ga0070695_100000008
515 Ga0070695_100080619
516 Ga0070695_100490780
517 Ga0070696_100000399
518 Ga0070696_100009620
519 Ga0070696_100013032
520 Ga0070696_100058433
521 Ga0070696_100063630
522 Ga0070696_100439826
523 Ga0070704_100677450
524 Ga0068855_100002727
525 Ga0068855_100144524
526 Ga0070664_100556001
527 Ga0068857_100006026
528 Ga0068857_100019393
529 Ga0068857_100153275
530 Ga0068857_100169472
531 Ga0068854_100229456
532 Ga0068856_100010994
533 Ga0068856_100031674
534 Ga0068856_100280838
535 Ga0068852_100005439
536 Ga0068852_100113971
537 Ga0068859_100008107
538 Ga0068859_100013036
539 Ga0068859_100161336
540 Ga0068859_100312315
541 Ga0068864_100014288
542 Ga0068864_100184844
543 Ga0068864_100203761
544 Ga0068864_100442086
545 Ga0068861_100023804
546 Ga0068861_100377844
547 Ga0068861_101026205
548 Ga0068870_10015152
549 Ga0068870_10215570
550 Ga0068863_100043116
551 Ga0068858_100106507
552 Ga0068858_100208762
553 Ga0068858_100381766
554 Ga0068858_100694253
555 Ga0068860_100109215
556 Ga0068860_100208573
557 Ga0068860_100418578
558 Ga0068862_100002079
559 Ga0068862_100426058
560 Ga0081539_10000025
561 Ga0081539_10000089
562 Ga0081539_10002585
563 Ga0097621_100027255
564 Ga0097621_100049744
565 Ga0097621_100056801
566 Ga0068871_100002885
567 Ga0068871_100041089
568 Ga0068871_100148529
569 Ga0075428_100001219
570 Ga0075428_100004123
571 Ga0075428_100005129
572 Ga0075430_100030852
573 Ga0075431_100010456
574 Ga0075431_100016981
575 Ga0075433_10005818
576 Ga0075433_10006696
577 Ga0075433_10032473
578 Ga0075433_10106541
579 Ga0075433_10190705
580 Ga0075433_10194868
581 Ga0075434_100008265
582 Ga0075434_100008589
583 Ga0075434_100686260
584 Ga0075429_100012613
585 Ga0075429_100115042
586 Ga0068865_100080649
587 Ga0068865_100203715
588 Ga0097620_100008108
589 Ga0097620_100013036
590 Ga0097620_100161346
591 Ga0097620_100312310
592 Ga0075435_100026042
593 Ga0075435_100098260
594 Ga0105240_10002487
595 Ga0111539_10006287
596 Ga0111539_10009827
597 Ga0111539_10009960
598 Ga0111539_10020861
599 Ga0111539_10024748
600 Ga0105245_10000428
601 Ga0105245_10011520
602 Ga0105245_10036657
603 Ga0114129_10000028
604 Ga0114129_10002936
605 Ga0114129_10017645
606 Ga0114129_10024341
607 Ga0114129_10031979
608 Ga0105243_10013344
609 Ga0105243_10289771
610 Ga0105243_10793823
611 Ga0105241_10014635
612 Ga0105242_10007430
613 Ga0105242_10128170
614 Ga0105248_10006673
615 Ga0105248_10025213
616 Ga0105237_10068458
617 Ga0105238_10024043
618 Ga0105238_10025133
619 Ga0105238_10095088
620 Ga0105249_10087348
621 Ga0105249_10262825
622 Ga0105249_10524539
623 Ga0105239_10006385
624 Ga0105246_10001182
625 Ga0105246_10244775
626 Ga0157370_10005766
627 Ga0157369_10017489
628 Ga0157369_10371579
629 Ga0157374_10043802
630 Ga0157374_10383016
631 Ga0157378_10000890
632 Ga0157378_10127343
633 Ga0163162_10051280
634 Ga0157372_10090162
635 Ga0157372_10122255
636 Ga0157372_10276024
637 Ga0157372_10638464
638 Ga0157375_10019064
639 Ga0157375_10055772
640 Ga0157375_10435679
641 Ga0163163_10062979
642 Ga0163163_10102339
643 Ga0163163_10210587
644 Ga0157380_10248655
645 Ga0157377_10001298
646 Ga0157377_10009690
647 Ga0157379_10093708
648 Ga0157376_10052598
649 Ga0157376_10264756
650 Ga0157376_10559578
651 Ga0157376_10614242
652 Ga0197907_10653354
653 Ga0206356_10005544
654 Ga0206352_10543391
655 Ga0207682_10068621
656 Ga0207699_10121673
657 Ga0207645_10093523
658 Ga0207643_10002887
659 Ga0207643_10065515
660 Ga0207705_10264096
661 Ga0207654_10023845
662 Ga0207707_10001181
663 Ga0207707_10477876
664 Ga0207695_10000808
665 Ga0207695_10005259
666 Ga0207671_10010883
667 Ga0207660_10042145
668 Ga0207662_10321492
669 Ga0207657_10104446
670 Ga0207681_10012653
671 Ga0207694_10005318
672 Ga0207694_10020826
673 Ga0207694_10060646
674 Ga0207659_10004959
675 Ga0207659_10034725
676 Ga0207687_10021860
677 Ga0207687_10071158
678 Ga0207700_10027774
679 Ga0207644_10096157
680 Ga0207706_10006371
681 Ga0207706_10073542
682 Ga0207686_10107177
683 Ga0207670_10065973
684 Ga0207670_10264903
685 Ga0207704_10141016
686 Ga0207691_10101886
687 Ga0207691_10153014
688 Ga0207711_10001566
689 Ga0207711_10214474
690 Ga0207711_10464360
691 Ga0207689_10029298
692 Ga0207689_10146309
693 Ga0207689_10220156
694 Ga0207661_10012167
695 Ga0207661_10434720
696 Ga0207667_10000673
697 Ga0207667_10002992
698 Ga0207651_10126170
699 Ga0207651_10149846
700 Ga0207651_10179947
701 Ga0207651_10476555
702 Ga0207668_10073038
703 Ga0207668_10229566
704 Ga0207640_10173577
705 Ga0207658_10082941
706 Ga0207703_10067327
707 Ga0207703_10145356
708 Ga0207703_10240712
709 Ga0207639_10019077
710 Ga0207708_10025403
711 Ga0207708_10108421
712 Ga0207702_10088623
713 Ga0207702_10141105
714 Ga0207702_10197005
715 Ga0207648_10006038
716 Ga0207676_10010666
717 Ga0207676_10197048
718 Ga0207676_10379632
719 Ga0207676_10425903
720 Ga0207674_10011373
721 Ga0207674_10025173
722 Ga0207674_10096868
723 Ga0207675_100000826
724 Ga0207675_100381272
725 Ga0207675_100474848
726 Ga0207683_10173554
727 Ga0207683_10196606
728 Ga0207683_10424334
729 Ga0207698_10004976
730 Ga0207698_10104893
731 Ga0207428_10002028
732 Ga0268266_10305316
733 Ga0268265_10006123
734 Ga0268265_10169160
735 Ga0268264_10019941
736 Ga0268264_10061247
737 Ga0268264_10290415
738 Ga0268264_10547238
739 Ga0265340_10006447
740 Ga0307408_100299371
741 Ga0265313_10015385
742 Ga0265314_10043514
743 Ga0307405_10034846
744 Ga0307406_10056165
745 Ga0307416_100001290
746 Ga0307416_100820074
747 Ga0307414_10578864
748 Ga0373936_0002048
749 Ga0373956_0131311
750 Ga0373943_0005676
751 Ga0373955_0003766
752 Ga0373961_0012047
753 Ga0373924_0011505
754 Ga0373935_0055769
755 Ga0373935_0177160
756 Ga0373927_0046496
757 Ga0373933_0017079
758 Ga0373933_0290977
759 Ga0373937_0001838
760 Ga0373937_0016755
761 Ga0373937_0022295
762 Ga0373937_0182987
763 Ga0373937_0231155
764 Ga0373937_0444932
765 Ga0373925_0002049
766 Ga0373925_0176492
767 Ga0373925_0400776
768 Ga0436363_0930035
769 Ga0439453_0052562
770 Ga0451576_0005960
771 Ga0451576_0073459
772 Ga0451576_0650287
773 Ga0495592_0134848
774 Ga0495629_0350331
775 Ga0495580_0054206
776 Ga0495580_0106434
777 Ga0495580_0402911
778 Ga0495582_0005958
779 Ga0495618_0137929
780 Ga0495630_0003772
781 Ga0495663_0003104
782 Ga0495663_0013039
783 Ga0495652_0070646
784 Ga0495652_0106629
785 Ga0495665_0030540
786 Ga0495665_0163015
787 Ga0495586_0016182
788 Ga0495587_0000977
789 Ga0495587_0029142
790 Ga0495587_0062357
791 Ga0495656_0075864
792 Ga0495659_0022108
793 Ga0495659_0041512
794 Ga0495659_0078217
795 Ga0495599_0012686
796 Ga0495623_0144566
797 Ga0495658_0022654
798 Ga0495658_0041210
799 Ga0495669_0088628
800 Ga0495613_0000186
801 Ga0495600_0271417
802 Ga0495581_0218612
803 Ga0495604_0107169
804 Ga0495674_0027250
805 Ga0495680_0293173
806 Ga0495677_0050730
807 Ga0495685_022043
808 Ga0495684_0000099
809 Ga0495684_0116107
810 Ga0495602_0274427
811 Ga0496106_0328496
812 Ga0496112_0128255
813 Ga0496114_0000558
814 Ga0496115_0188925
815 Ga0501039_0004523
816 Ga0501041_0012162
817 Ga0501046_0010927
818 Ga0501071_0124020
819 Ga0501072_0030155
820 Ga0501072_0762628
821 Ga0501075_0034991
822 Ga0501076_0019746
823 Ga0501077_0036440
824 Ga0501079_0010669
825 Ga0501081_0037184
826 Ga0501045_0040417
827 nmdc:mga05p37_12791_c1
828 nmdc:mga05p37_15857_c1
829 nmdc:mga05p37_33112_c1
830 nmdc:mga05p37_43363_c1
831 nmdc:mga05p37_89097_c1
832 nmdc:mga05p37_900295_c1
833 nmdc:mga09592_11810_c1
834 nmdc:mga09592_520697_c1
835 nmdc:mga09592_98155_c1
836 nmdc:mga0qj67_561629_c1
837 nmdc:mga06r32_115273_c1
838 nmdc:mga06r32_8613_c1
839 nmdc:mga08y16_107297_c1
840 nmdc:mga08y16_16388_c1
841 nmdc:mga08y16_68173_c1
842 nmdc:mga0n895_29715_c1
843 nmdc:mga0n895_460466_c1
844 nmdc:mga0rr50_189234_c1
845 nmdc:mga0rr50_221277_c1
846 nmdc:mga0a205_4054_c1
847 nmdc:mga0a205_80580_c1
848 nmdc:mga0a205_9105_c1
849 Ga0495601_0117303
850 Ga0495619_0001935
851 Ga0500568_0000292
852 Ga0501084_0470380

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r87-assembly1.cif.gz_A crystal structure of orf6 protein from photobacterium profundum 0.7582 182 220
1tbu-assembly1.cif.gz_C crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.7424 182 222
4tq2-assembly1.cif.gz_A-2 structure of s-type phycobiliprotein lyase cpes from guillardia theta 0.7394 154 225
2e46-assembly1.cif.gz_A crystal structure analysis of the clock protein ea4 0.7316 179 204
1tbu-assembly1.cif.gz_D crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1 0.7298 182 222
ID Description Score Start End Superfamily
af_Q7XTY9_163_289_2.60.40.200 Mainly Beta;Sandwich;Immunoglobulin-like;Superoxide dismutase, copper/zinc binding domain 0.7467 177 204 2.60.40.200
1tbuC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.7424 182 222 3.10.129.10
4tq2A00 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.7391 154 225 2.40.128.20
af_Q54GB1_564_1983_2.160.20.20 Mainly Beta;3 Solenoid;Pectate Lyase C-like; 0.7297 195 220 2.160.20.20
af_O34090_221_303_3.30.160.40 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Porphobilinogen deaminase, C-terminal domain 0.7159 179 218 3.30.160.40
ID Description Score Start End GO Terms
AF-A0A2D8P1M8-F1-model_v4 deleted 0.8966 67 215
AF-A0A523L9R7-F1-model_v4 deleted 0.8909 85 236
AF-A0A2V8Y1Z9-F1-model_v4 Uncharacterized protein 0.885 106 226
AF-A0A2E5NPI7-F1-model_v4 DUF5666 domain-containing protein 0.882 67 234
AF-A0A2D8P1M8-F1-model_v4 deleted 0.8797 67 215

Map