F441124

General Info

Members Datasets Scaffolds Average Seq Length
426 260 852 204

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100035219|Ga0070680_1000352195
Length 241
Sequence MSRCRPGTFTDAKLETLPDQRRTAPLRCALHRIRDTRKIMTHHVLDMPIDEAQARALKAGDTVTLEKTLFGIRDATLIAMFDRGRTTRLNMKGHAVIHTAPNVRKVDPRPGNSSGYEPLCIGTTTSMRMERFTRPLMERDGVRLIIGKGGMGQGTLDAFRDIGGAYLAIVGGAAALETTWIEAIEEVDLDDLHPESLWKFRIKGFGPLLVTMDSHGNSLHAQVNADAAARRAAVLASIGAA

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
168 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
182 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
258 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 2.58
Rhizosphere 86.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100035219 3300005336 Bacteria 4040
2 rootH2_10003710 3300003320 Bacteria 1034
3 Ga0065712_10218242 3300005290 Bacteria 1009
4 Ga0070658_10015528 3300005327 Bacteria 6090
5 Ga0070658_10023969 3300005327 Bacteria 4896
6 Ga0070658_10038062 3300005327 Bacteria 3879
7 Ga0070658_10656854 3300005327 Bacteria 910
8 Ga0070676_10017951 3300005328 Bacteria 3917
9 Ga0070690_100011512 3300005330 Bacteria 5175
10 Ga0070690_100086457 3300005330 Bacteria 2058
11 Ga0070670_100200820 3300005331 Bacteria 1732
12 Ga0070677_10069852 3300005333 Bacteria 1474
13 Ga0068869_100235885 3300005334 Bacteria 1455
14 Ga0070680_100030262 3300005336 Bacteria 4350
15 Ga0070680_100148746 3300005336 Bacteria 1966
16 Ga0070680_100255555 3300005336 Bacteria 1482
17 Ga0070682_100000979 3300005337 Bacteria 16545
18 Ga0068868_100043322 3300005338 Bacteria 3515
19 Ga0070689_100024483 3300005340 Bacteria 4529
20 Ga0070691_10088463 3300005341 Bacteria 1524
21 Ga0070687_100019224 3300005343 Bacteria 3174
22 Ga0070661_100168000 3300005344 Bacteria 1665
23 Ga0070668_100561243 3300005347 Bacteria 995
24 Ga0070669_100114538 3300005353 Bacteria 2050
25 Ga0070671_100037840 3300005355 Bacteria 4003
26 Ga0070671_100399312 3300005355 Bacteria 1176
27 Ga0070674_100002692 3300005356 Bacteria 9827
28 Ga0070688_100026128 3300005365 Bacteria 3466
29 Ga0070688_100090391 3300005365 Bacteria 1999
30 Ga0070659_100008591 3300005366 Bacteria 7468
31 Ga0070659_100073060 3300005366 Bacteria 2730
32 Ga0070709_10252101 3300005434 Bacteria 1272
33 Ga0070714_100081656 3300005435 Bacteria 2815
34 Ga0070714_100142488 3300005435 Bacteria 2153
35 Ga0070714_101018381 3300005435 Bacteria 806
36 Ga0070701_10111735 3300005438 Bacteria 1527
37 Ga0070711_100144282 3300005439 Bacteria 1788
38 Ga0070700_100152585 3300005441 Bacteria 1581
39 Ga0070681_10236207 3300005458 Bacteria 1742
40 Ga0070685_10048130 3300005466 Bacteria 2455
41 Ga0070679_100012024 3300005530 Bacteria 8261
42 Ga0070679_100012608 3300005530 Bacteria 8083
43 Ga0070679_100041995 3300005530 Bacteria 4554
44 Ga0070679_100051779 3300005530 Bacteria 4090
45 Ga0070679_100076044 3300005530 Bacteria 3347
46 Ga0070679_100545264 3300005530 Bacteria 1103
47 Ga0068853_100000659 3300005539 Bacteria 23749
48 Ga0068853_100134196 3300005539 Bacteria 2218
49 Ga0068853_100266651 3300005539 Bacteria 1576
50 Ga0068853_100932278 3300005539 Bacteria 835
51 Ga0070672_100407243 3300005543 Bacteria 1166
52 Ga0070695_100364082 3300005545 Bacteria 1087
53 Ga0070693_100351629 3300005547 Bacteria 1009
54 Ga0070665_100128587 3300005548 Bacteria 2536
55 Ga0068855_100028216 3300005563 Bacteria 6713
56 Ga0068855_100045266 3300005563 Bacteria 5205
57 Ga0068855_100101508 3300005563 Bacteria 3312
58 Ga0068855_100410511 3300005563 Bacteria 1482
59 Ga0068854_100121885 3300005578 Bacteria 1981
60 Ga0068854_100205625 3300005578 Bacteria 1550
61 Ga0068854_100451077 3300005578 Bacteria 1074
62 Ga0068856_100115447 3300005614 Bacteria 2684
63 Ga0068856_100375840 3300005614 Bacteria 1440
64 Ga0068856_100583951 3300005614 Bacteria 1139
65 Ga0070702_100055499 3300005615 Bacteria 2284
66 Ga0068852_100220598 3300005616 Bacteria 1803
67 Ga0068859_100062045 3300005617 Bacteria 3767
68 Ga0068864_100337400 3300005618 Bacteria 1419
69 Ga0068861_100542263 3300005719 Bacteria 1058
70 Ga0068863_100108967 3300005841 Bacteria 2636
71 Ga0068858_100066015 3300005842 Bacteria 3349
72 Ga0068860_100332936 3300005843 Bacteria 1492
73 Ga0068862_100288355 3300005844 Bacteria 1507
74 Ga0081538_10002434 3300005981 Bacteria 18220
75 Ga0081540_1000233 3300005983 Bacteria 58300
76 Ga0070717_10148338 3300006028 Bacteria 2028
77 Ga0070717_10970274 3300006028 Bacteria 774
78 Ga0075365_10238423 3300006038 Bacteria 1277
79 Ga0075365_10240500 3300006038 Bacteria 1271
80 Ga0075365_10244281 3300006038 Bacteria 1261
81 Ga0075368_10006186 3300006042 Bacteria 4168
82 Ga0075368_10034479 3300006042 Bacteria 1972
83 Ga0075368_10058678 3300006042 Bacteria 1538
84 Ga0075363_100357710 3300006048 Bacteria 853
85 Ga0075364_10457146 3300006051 Bacteria 872
86 Ga0070712_100046330 3300006175 Bacteria 3006
87 Ga0075367_10114304 3300006178 Bacteria 1659
88 Ga0075367_10146353 3300006178 Bacteria 1465
89 Ga0075367_10324522 3300006178 Bacteria 970
90 Ga0075366_10271998 3300006195 Bacteria 1035
91 Ga0097621_100354539 3300006237 Bacteria 1305
92 Ga0075370_10073168 3300006353 Bacteria 1962
93 Ga0075370_10127710 3300006353 Bacteria 1483
94 Ga0075370_10259887 3300006353 Bacteria 1030
95 Ga0075434_100029288 3300006871 Bacteria 5415
96 Ga0075434_100105862 3300006871 Bacteria 2822
97 Ga0075436_100009885 3300006914 Bacteria 6525
98 Ga0097620_100062046 3300006931 Bacteria 3767
99 Ga0075435_100078089 3300007076 Bacteria 2714
100 Ga0105240_10002253 3300009093 Bacteria 31317
101 Ga0105240_10030753 3300009093 Bacteria 6974
102 Ga0105240_10099137 3300009093 Bacteria 3547
103 Ga0111539_10936022 3300009094 Bacteria 1008
104 Ga0111539_11029638 3300009094 Bacteria 957
105 Ga0105245_10206619 3300009098 Bacteria 1888
106 Ga0105245_10316033 3300009098 Bacteria 1537
107 Ga0114129_10210422 3300009147 Bacteria 2629
108 Ga0105243_10212233 3300009148 Bacteria 1705
109 Ga0105237_10237590 3300009545 Bacteria 1823
110 Ga0105238_10207236 3300009551 Bacteria 1937
111 Ga0105239_11329740 3300010375 Bacteria 829
112 Ga0105246_10058854 3300011119 Bacteria 2663
113 Ga0157373_10022868 3300013100 Bacteria 4534
114 Ga0157370_10056777 3300013104 Bacteria 3725
115 Ga0157370_10170948 3300013104 Bacteria 2020
116 Ga0157370_10196881 3300013104 Bacteria 1870
117 Ga0157369_10046995 3300013105 Bacteria 4688
118 Ga0157369_10268682 3300013105 Bacteria 1778
119 Ga0157374_10328965 3300013296 Bacteria 1515
120 Ga0163162_10373607 3300013306 Bacteria 1559
121 Ga0157372_10005179 3300013307 Bacteria 13867
122 Ga0157372_11023494 3300013307 Bacteria 956
123 Ga0163163_10054012 3300014325 Bacteria 3967
124 Ga0163161_10346425 3300017792 Bacteria 1180
125 Ga0206356_11416450 3300020070 Bacteria 1275
126 Ga0206354_11241437 3300020081 Bacteria 3077
127 Ga0213874_10031386 3300021377 Bacteria 1537
128 Ga0213876_10007128 3300021384 Bacteria 6091
129 Ga0213876_10011329 3300021384 Bacteria 4762
130 Ga0213875_10001559 3300021388 Bacteria 14687
131 Ga0207697_10032210 3300025315 Bacteria 2145
132 Ga0207697_10035993 3300025315 Bacteria 2027
133 Ga0207642_10018585 3300025899 Bacteria 2672
134 Ga0207680_10207070 3300025903 Bacteria 1339
135 Ga0207645_10011889 3300025907 Bacteria 5925
136 Ga0207643_10025083 3300025908 Bacteria 3294
137 Ga0207705_10070631 3300025909 Bacteria 2531
138 Ga0207705_10112101 3300025909 Bacteria 2016
139 Ga0207707_10075696 3300025912 Bacteria 2937
140 Ga0207707_10124524 3300025912 Bacteria 2254
141 Ga0207707_10511013 3300025912 Bacteria 1024
142 Ga0207695_10051791 3300025913 Bacteria 4307
143 Ga0207695_10213015 3300025913 Bacteria 1842
144 Ga0207671_10138195 3300025914 Bacteria 1875
145 Ga0207693_10080264 3300025915 Bacteria 2554
146 Ga0207693_10082668 3300025915 Bacteria 2515
147 Ga0207660_10674323 3300025917 Bacteria 843
148 Ga0207662_10017556 3300025918 Bacteria 4050
149 Ga0207662_10050482 3300025918 Bacteria 2471
150 Ga0207657_10008591 3300025919 Bacteria 10344
151 Ga0207657_10353855 3300025919 Bacteria 1158
152 Ga0207657_10785696 3300025919 Bacteria 737
153 Ga0207652_10026750 3300025921 Bacteria 4808
154 Ga0207652_10054777 3300025921 Bacteria 3429
155 Ga0207652_10098995 3300025921 Bacteria 2572
156 Ga0207652_10110515 3300025921 Bacteria 2437
157 Ga0207652_10215743 3300025921 Bacteria 1728
158 Ga0207652_10829679 3300025921 Bacteria 820
159 Ga0207694_10330390 3300025924 Bacteria 1259
160 Ga0207694_10423182 3300025924 Bacteria 1110
161 Ga0207650_10097829 3300025925 Bacteria 2254
162 Ga0207650_10371861 3300025925 Bacteria 1179
163 Ga0207659_10033141 3300025926 Bacteria 3552
164 Ga0207659_10304679 3300025926 Bacteria 1310
165 Ga0207659_10913126 3300025926 Bacteria 755
166 Ga0207687_10289414 3300025927 Bacteria 1316
167 Ga0207687_10395615 3300025927 Bacteria 1135
168 Ga0207664_10052568 3300025929 Bacteria 3222
169 Ga0207664_10375837 3300025929 Bacteria 1261
170 Ga0207664_10848761 3300025929 Bacteria 821
171 Ga0207644_10044121 3300025931 Bacteria 3166
172 Ga0207644_10192571 3300025931 Bacteria 1604
173 Ga0207644_10427452 3300025931 Bacteria 1086
174 Ga0207706_10050687 3300025933 Bacteria 3668
175 Ga0207686_10122862 3300025934 Bacteria 1769
176 Ga0207670_10239350 3300025936 Bacteria 1397
177 Ga0207669_10055645 3300025937 Bacteria 2397
178 Ga0207704_10539460 3300025938 Bacteria 946
179 Ga0207665_10198811 3300025939 Bacteria 1460
180 Ga0207691_10267246 3300025940 Bacteria 1473
181 Ga0207711_10040471 3300025941 Bacteria 3966
182 Ga0207689_10080030 3300025942 Bacteria 2685
183 Ga0207667_10059690 3300025949 Bacteria 3993
184 Ga0207667_10074175 3300025949 Bacteria 3534
185 Ga0207667_10136030 3300025949 Bacteria 2530
186 Ga0207667_10299711 3300025949 Bacteria 1642
187 Ga0207667_10310967 3300025949 Bacteria 1609
188 Ga0207667_10507866 3300025949 Bacteria 1222
189 Ga0207651_10049657 3300025960 Bacteria 2843
190 Ga0207640_10101203 3300025981 Bacteria 2021
191 Ga0207640_10106595 3300025981 Bacteria 1977
192 Ga0207640_10849793 3300025981 Bacteria 794
193 Ga0207677_10254919 3300026023 Bacteria 1427
194 Ga0207703_10161162 3300026035 Bacteria 1965
195 Ga0207639_10016250 3300026041 Bacteria 5261
196 Ga0207639_10580322 3300026041 Bacteria 1032
197 Ga0207708_10017786 3300026075 Bacteria 5350
198 Ga0207708_10254008 3300026075 Bacteria 1417
199 Ga0207708_10683895 3300026075 Bacteria 876
200 Ga0207702_10083944 3300026078 Bacteria 2772
201 Ga0207702_10294089 3300026078 Bacteria 1539
202 Ga0207702_10682435 3300026078 Bacteria 1011
203 Ga0207641_10046043 3300026088 Bacteria 3676
204 Ga0207641_10853643 3300026088 Bacteria 903
205 Ga0207641_11008318 3300026088 Bacteria 829
206 Ga0207676_10051820 3300026095 Bacteria 3205
207 Ga0207676_10186742 3300026095 Bacteria 1820
208 Ga0207674_10454387 3300026116 Bacteria 1238
209 Ga0207675_100018519 3300026118 Bacteria 6494
210 Ga0207675_100453072 3300026118 Bacteria 1272
211 Ga0207683_10063177 3300026121 Bacteria 3262
212 Ga0207683_10139977 3300026121 Bacteria 2180
213 Ga0207683_10249876 3300026121 Bacteria 1618
214 Ga0207698_10538005 3300026142 Bacteria 1143
215 Ga0209981_1010194 3300027378 Bacteria 1288
216 Ga0209996_1010420 3300027395 Bacteria 1234
217 Ga0209970_1037181 3300027614 Bacteria 859
218 Ga0207428_10357977 3300027907 Bacteria 1073
219 Ga0268266_10409845 3300028379 Bacteria 1283
220 Ga0265338_10034538 3300028800 Bacteria 4884
221 Ga0265338_10318596 3300028800 Bacteria 1126
222 Ga0265330_10040482 3300031235 Bacteria 2069
223 Ga0265320_10036960 3300031240 Bacteria 2464
224 Ga0265325_10006946 3300031241 Bacteria 6827
225 Ga0265325_10023654 3300031241 Bacteria 3350
226 Ga0265325_10055045 3300031241 Bacteria 2035
227 Ga0265325_10141780 3300031241 Bacteria 1142
228 Ga0265329_10050314 3300031242 Bacteria 1327
229 Ga0265340_10029531 3300031247 Bacteria 2753
230 Ga0265340_10041513 3300031247 Bacteria 2261
231 Ga0265340_10171961 3300031247 Bacteria 981
232 Ga0265339_10116883 3300031249 Bacteria 1374
233 Ga0265331_10040397 3300031250 Bacteria 2270
234 Ga0265331_10115228 3300031250 Bacteria 1231
235 Ga0265316_10037970 3300031344 Bacteria 3883
236 Ga0265316_10471974 3300031344 Bacteria 898
237 Ga0265313_10009488 3300031595 Bacteria 6313
238 Ga0265313_10011191 3300031595 Bacteria 5594
239 Ga0265314_10020469 3300031711 Bacteria 5106
240 Ga0265342_10000290 3300031712 Bacteria 56854
241 Ga0265342_10011669 3300031712 Bacteria 5994
242 Ga0307416_101073741 3300032002 Bacteria 909
243 Ga0373958_0021937 3300034819 Bacteria 1189
244 Ga0373929_0003611 3300035085 Bacteria 2779
245 Ga0373923_0000212 3300035111 Bacteria 12051
246 Ga0373923_0093221 3300035111 Bacteria 1320
247 Ga0373936_0003590 3300035113 Bacteria 5833
248 Ga0373941_0061276 3300035115 Bacteria 1225
249 Ga0373953_0003138 3300035117 Bacteria 5102
250 Ga0373953_0004230 3300035117 Bacteria 4556
251 Ga0373954_0004499 3300035118 Bacteria 5998
252 Ga0373956_0006527 3300035119 Bacteria 4673
253 Ga0373957_0003967 3300035120 Bacteria 4447
254 Ga0373957_0025646 3300035120 Bacteria 2126
255 Ga0373943_0001439 3300035170 Bacteria 10744
256 Ga0373955_0000673 3300035172 Bacteria 14609
257 Ga0373955_0001617 3300035172 Bacteria 9649
258 Ga0373942_0015161 3300035207 Bacteria 1875
259 Ga0373924_0057006 3300035410 Bacteria 1628
260 Ga0373924_0220199 3300035410 Bacteria 838
261 Ga0373931_0007661 3300035691 Bacteria 5093
262 Ga0373931_0027673 3300035691 Bacteria 2896
263 Ga0373935_0000017 3300035692 Bacteria 70368
264 Ga0373935_0059608 3300035692 Bacteria 2440
265 Ga0373927_0007744 3300035695 Bacteria 7265
266 Ga0373927_0152821 3300035695 Bacteria 1511
267 Ga0373933_0001228 3300035724 Bacteria 15165
268 Ga0373933_0016982 3300035724 Bacteria 4079
269 Ga0373947_0001167 3300035725 Bacteria 16142
270 Ga0373937_0000103 3300036401 Bacteria 80386
271 Ga0373937_0019474 3300036401 Bacteria 6075
272 Ga0373925_0000058 3300037068 Bacteria 122682
273 Ga0373925_0015855 3300037068 Bacteria 5452
274 Ga0373925_0509184 3300037068 Bacteria 988
275 Ga0395905_0107627 3300037471 Bacteria 2617
276 Ga0436364_0895437 3300037853 Bacteria 2251
277 Ga0436364_1475927 3300037853 Bacteria 2135
278 Ga0395901_0212331 3300038443 Bacteria 2025
279 Ga0436365_0314125 3300039437 Bacteria 1211
280 Ga0436365_0910004 3300039437 Bacteria 6032
281 Ga0436363_0137348 3300039450 Bacteria 2553
282 Ga0436363_0488951 3300039450 Bacteria 1258
283 Ga0436363_1103966 3300039450 Bacteria 1646
284 Ga0436363_1620675 3300039450 Bacteria 17092
285 Ga0436362_0792029 3300039453 Bacteria 2652
286 Ga0439448_0009250 3300042005 Bacteria 2903
287 Ga0451577_0621778 3300042876 Bacteria 980
288 Ga0495592_0000062 3300046454 Bacteria 99207
289 Ga0495592_0109810 3300046454 Bacteria 1953
290 Ga0495629_0001807 3300046459 Bacteria 16771
291 Ga0495629_0640184 3300046459 Bacteria 709
292 Ga0495651_0001912 3300046462 Bacteria 16134
293 Ga0495653_0000072 3300046463 Bacteria 85266
294 Ga0495662_0167542 3300046476 Bacteria 1082
295 Ga0495664_0000009 3300046477 Bacteria 289534
296 Ga0495608_0001132 3300046511 Bacteria 18864
297 Ga0495608_0098412 3300046511 Bacteria 1887
298 Ga0495618_0000061 3300046514 Bacteria 78337
299 Ga0495628_0000012 3300046516 Bacteria 224162
300 Ga0495630_0002587 3300046517 Bacteria 12540
301 Ga0495630_0459440 3300046517 Bacteria 976
302 Ga0495652_0000021 3300046529 Bacteria 181454
303 Ga0495652_0441072 3300046529 Bacteria 913
304 Ga0495665_0108797 3300046531 Bacteria 1454
305 Ga0495640_0000028 3300046533 Bacteria 79904
306 Ga0495587_0000033 3300046536 Bacteria 123885
307 Ga0495587_0011210 3300046536 Bacteria 5684
308 Ga0495621_0010695 3300046539 Bacteria 2818
309 Ga0495645_0000017 3300046543 Bacteria 156865
310 Ga0495667_0000011 3300046559 Bacteria 222545
311 Ga0495667_0001149 3300046559 Bacteria 17261
312 Ga0495667_0127043 3300046559 Bacteria 1645
313 Ga0495634_0000220 3300046642 Bacteria 53609
314 Ga0495635_0000019 3300046663 Bacteria 193402
315 Ga0495635_0160198 3300046663 Bacteria 1531
316 Ga0495659_0050325 3300046664 Bacteria 1515
317 Ga0495657_0000378 3300046675 Bacteria 41496
318 Ga0495657_0014694 3300046675 Bacteria 5747
319 Ga0495599_0000024 3300046678 Bacteria 121388
320 Ga0495623_0000022 3300046679 Bacteria 98899
321 Ga0495623_0349674 3300046679 Bacteria 805
322 Ga0495646_0000033 3300046680 Bacteria 83930
323 Ga0495658_0140118 3300046683 Bacteria 1479
324 Ga0495613_0469822 3300046689 Bacteria 850
325 Ga0495600_0000028 3300046809 Bacteria 90661
326 Ga0495600_0068540 3300046809 Bacteria 2318
327 Ga0495581_0005703 3300047315 Bacteria 7222
328 Ga0495581_0145345 3300047315 Bacteria 1384
329 Ga0495604_0000011 3300047317 Bacteria 292024
330 Ga0495604_0053225 3300047317 Bacteria 3130
331 Ga0495604_0153462 3300047317 Bacteria 1634
332 Ga0495674_0000015 3300047319 Bacteria 224071
333 Ga0495680_0002528 3300047322 Bacteria 18706
334 Ga0495680_0024699 3300047322 Bacteria 4982
335 Ga0495680_0182521 3300047322 Bacteria 1514
336 Ga0495675_0000295 3300047444 Bacteria 35782
337 Ga0495675_0023486 3300047444 Bacteria 3929
338 Ga0495675_0516240 3300047444 Bacteria 684
339 Ga0495684_0000036 3300047471 Bacteria 107181
340 Ga0495684_0121501 3300047471 Bacteria 1967
341 Ga0495684_0347297 3300047471 Bacteria 1054
342 Ga0495593_0007137 3300047673 Bacteria 6551
343 Ga0495593_0405615 3300047673 Bacteria 682
344 Ga0495602_0000018 3300048088 Bacteria 183837
345 Ga0496101_0009025 3300048904 Bacteria 6538
346 Ga0496102_0072956 3300048905 Bacteria 3155
347 Ga0496103_0416281 3300048906 Bacteria 863
348 Ga0496107_0026008 3300048910 Bacteria 4147
349 Ga0496108_0214394 3300048911 Bacteria 1672
350 Ga0496110_0186161 3300048913 Bacteria 1885
351 Ga0496110_0365123 3300048913 Bacteria 1315
352 Ga0496111_0084493 3300048914 Bacteria 2320
353 Ga0496112_0299733 3300048915 Bacteria 1553
354 Ga0496114_0014685 3300048917 Bacteria 6293
355 Ga0496115_0055964 3300048918 Bacteria 3169
356 Ga0501031_0293372 3300049568 Bacteria 1054
357 Ga0501033_0031041 3300049570 Bacteria 4017
358 Ga0501033_0042353 3300049570 Bacteria 3395
359 Ga0501033_0520714 3300049570 Bacteria 821
360 Ga0501034_0123175 3300049571 Bacteria 2578
361 Ga0501034_1072123 3300049571 Bacteria 687
362 Ga0501036_0029030 3300049572 Bacteria 4675
363 Ga0501036_0356803 3300049572 Bacteria 1221
364 Ga0501037_0095709 3300049573 Bacteria 2146
365 Ga0501037_0543009 3300049573 Bacteria 785
366 Ga0501038_0095297 3300049574 Bacteria 2486
367 Ga0501041_0337475 3300049577 Bacteria 952
368 Ga0501043_0149496 3300049579 Bacteria 1828
369 Ga0501043_0818271 3300049579 Bacteria 673
370 Ga0501046_0156079 3300049580 Bacteria 1719
371 Ga0501046_0239817 3300049580 Bacteria 1337
372 Ga0501046_0623166 3300049580 Bacteria 764
373 Ga0501048_0096511 3300049582 Bacteria 2085
374 Ga0501048_0161716 3300049582 Bacteria 1585
375 Ga0501048_0291219 3300049582 Bacteria 1161
376 Ga0501067_0438665 3300049583 Bacteria 729
377 Ga0501070_0181846 3300049586 Bacteria 1730
378 Ga0501072_0277322 3300049588 Bacteria 1334
379 Ga0501073_0214951 3300049589 Bacteria 1328
380 Ga0501075_0050414 3300049591 Bacteria 3129
381 Ga0501076_0047156 3300049592 Bacteria 3406
382 Ga0501076_0703691 3300049592 Bacteria 834
383 Ga0501080_0072349 3300049742 Bacteria 3208
384 Ga0501081_0118111 3300049743 Bacteria 1887
385 Ga0501083_0308518 3300049744 Bacteria 1029
386 Ga0501035_0219837 3300049822 Bacteria 1622
387 Ga0501044_0006667 3300049823 Bacteria 12727
388 Ga0501044_0093150 3300049823 Bacteria 3038
389 Ga0501044_0110075 3300049823 Bacteria 2763
390 Ga0501044_0308656 3300049823 Bacteria 1509
391 Ga0501044_0394240 3300049823 Bacteria 1298
392 nmdc:mga03n38_162205_c1 3300050490 Bacteria 1133
393 nmdc:mga03n38_72118_c1 3300050490 Bacteria 1600
394 nmdc:mga00v17_613950_c1 3300050491 Bacteria 701
395 nmdc:mga0yw44_12256_c1 3300050492 Bacteria 4462
396 nmdc:mga0yw44_440026_c1 3300050492 Bacteria 883
397 nmdc:mga0yw44_597401_c1 3300050492 Bacteria 750
398 nmdc:mga0yw44_85771_c1 3300050492 Bacteria 1982
399 nmdc:mga06z11_214951_c1 3300050494 Bacteria 1122
400 nmdc:mga06z11_53889_c1 3300050494 Bacteria 2071
401 nmdc:mga07m45_115800_c1 3300050496 Bacteria 1546
402 nmdc:mga07m45_177144_c1 3300050496 Bacteria 1240
403 nmdc:mga07m45_340384_c1 3300050496 Bacteria 872
404 nmdc:mga09592_277187_c1 3300050508 Bacteria 1454
405 nmdc:mga06r32_342346_c1 3300050510 Bacteria 1480
406 nmdc:mga08y16_1243179_c1 3300050511 Bacteria 714
407 nmdc:mga0n895_52821_c1 3300050512 Bacteria 3990
408 nmdc:mga08x19_231234_c1 3300050514 Bacteria 1272
409 nmdc:mga08x19_38506_c1 3300050514 Bacteria 3038
410 nmdc:mga0sz30_162609_c1 3300050516 Bacteria 989
411 Ga0495601_0000024 3300053077 Bacteria 133160
412 Ga0495601_0046704 3300053077 Bacteria 2725
413 Ga0495612_0000079 3300053078 Bacteria 44236
414 Ga0495612_0148434 3300053078 Bacteria 1019
415 Ga0495595_0000036 3300053084 Bacteria 79035
416 Ga0495595_0048527 3300053084 Bacteria 1960
417 Ga0495595_0223074 3300053084 Bacteria 941
418 Ga0495619_0000034 3300053085 Bacteria 129851
419 Ga0495619_0199203 3300053085 Bacteria 1386
420 Ga0500641_0080384 3300053096 Bacteria 1383
421 Ga0500595_019643 3300053119 Bacteria 2448
422 Ga0500658_0193373 3300053134 Bacteria 929
423 Ga0500616_0059122 3300053153 Bacteria 1992
424 Ga0501084_0147445 3300054114 Bacteria 1982
425 Ga0501084_0395088 3300054114 Bacteria 1169
426 Ga0501082_0281395 3300060353 Bacteria 1448
427 Ga0070680_100035219
428 rootH2_10003710
429 Ga0065712_10218242
430 Ga0070658_10015528
431 Ga0070658_10023969
432 Ga0070658_10038062
433 Ga0070658_10656854
434 Ga0070676_10017951
435 Ga0070690_100011512
436 Ga0070690_100086457
437 Ga0070670_100200820
438 Ga0070677_10069852
439 Ga0068869_100235885
440 Ga0070680_100030262
441 Ga0070680_100148746
442 Ga0070680_100255555
443 Ga0070682_100000979
444 Ga0068868_100043322
445 Ga0070689_100024483
446 Ga0070691_10088463
447 Ga0070687_100019224
448 Ga0070661_100168000
449 Ga0070668_100561243
450 Ga0070669_100114538
451 Ga0070671_100037840
452 Ga0070671_100399312
453 Ga0070674_100002692
454 Ga0070688_100026128
455 Ga0070688_100090391
456 Ga0070659_100008591
457 Ga0070659_100073060
458 Ga0070709_10252101
459 Ga0070714_100081656
460 Ga0070714_100142488
461 Ga0070714_101018381
462 Ga0070701_10111735
463 Ga0070711_100144282
464 Ga0070700_100152585
465 Ga0070681_10236207
466 Ga0070685_10048130
467 Ga0070679_100012024
468 Ga0070679_100012608
469 Ga0070679_100041995
470 Ga0070679_100051779
471 Ga0070679_100076044
472 Ga0070679_100545264
473 Ga0068853_100000659
474 Ga0068853_100134196
475 Ga0068853_100266651
476 Ga0068853_100932278
477 Ga0070672_100407243
478 Ga0070695_100364082
479 Ga0070693_100351629
480 Ga0070665_100128587
481 Ga0068855_100028216
482 Ga0068855_100045266
483 Ga0068855_100101508
484 Ga0068855_100410511
485 Ga0068854_100121885
486 Ga0068854_100205625
487 Ga0068854_100451077
488 Ga0068856_100115447
489 Ga0068856_100375840
490 Ga0068856_100583951
491 Ga0070702_100055499
492 Ga0068852_100220598
493 Ga0068859_100062045
494 Ga0068864_100337400
495 Ga0068861_100542263
496 Ga0068863_100108967
497 Ga0068858_100066015
498 Ga0068860_100332936
499 Ga0068862_100288355
500 Ga0081538_10002434
501 Ga0081540_1000233
502 Ga0070717_10148338
503 Ga0070717_10970274
504 Ga0075365_10238423
505 Ga0075365_10240500
506 Ga0075365_10244281
507 Ga0075368_10006186
508 Ga0075368_10034479
509 Ga0075368_10058678
510 Ga0075363_100357710
511 Ga0075364_10457146
512 Ga0070712_100046330
513 Ga0075367_10114304
514 Ga0075367_10146353
515 Ga0075367_10324522
516 Ga0075366_10271998
517 Ga0097621_100354539
518 Ga0075370_10073168
519 Ga0075370_10127710
520 Ga0075370_10259887
521 Ga0075434_100029288
522 Ga0075434_100105862
523 Ga0075436_100009885
524 Ga0097620_100062046
525 Ga0075435_100078089
526 Ga0105240_10002253
527 Ga0105240_10030753
528 Ga0105240_10099137
529 Ga0111539_10936022
530 Ga0111539_11029638
531 Ga0105245_10206619
532 Ga0105245_10316033
533 Ga0114129_10210422
534 Ga0105243_10212233
535 Ga0105237_10237590
536 Ga0105238_10207236
537 Ga0105239_11329740
538 Ga0105246_10058854
539 Ga0157373_10022868
540 Ga0157370_10056777
541 Ga0157370_10170948
542 Ga0157370_10196881
543 Ga0157369_10046995
544 Ga0157369_10268682
545 Ga0157374_10328965
546 Ga0163162_10373607
547 Ga0157372_10005179
548 Ga0157372_11023494
549 Ga0163163_10054012
550 Ga0163161_10346425
551 Ga0206356_11416450
552 Ga0206354_11241437
553 Ga0213874_10031386
554 Ga0213876_10007128
555 Ga0213876_10011329
556 Ga0213875_10001559
557 Ga0207697_10032210
558 Ga0207697_10035993
559 Ga0207642_10018585
560 Ga0207680_10207070
561 Ga0207645_10011889
562 Ga0207643_10025083
563 Ga0207705_10070631
564 Ga0207705_10112101
565 Ga0207707_10075696
566 Ga0207707_10124524
567 Ga0207707_10511013
568 Ga0207695_10051791
569 Ga0207695_10213015
570 Ga0207671_10138195
571 Ga0207693_10080264
572 Ga0207693_10082668
573 Ga0207660_10674323
574 Ga0207662_10017556
575 Ga0207662_10050482
576 Ga0207657_10008591
577 Ga0207657_10353855
578 Ga0207657_10785696
579 Ga0207652_10026750
580 Ga0207652_10054777
581 Ga0207652_10098995
582 Ga0207652_10110515
583 Ga0207652_10215743
584 Ga0207652_10829679
585 Ga0207694_10330390
586 Ga0207694_10423182
587 Ga0207650_10097829
588 Ga0207650_10371861
589 Ga0207659_10033141
590 Ga0207659_10304679
591 Ga0207659_10913126
592 Ga0207687_10289414
593 Ga0207687_10395615
594 Ga0207664_10052568
595 Ga0207664_10375837
596 Ga0207664_10848761
597 Ga0207644_10044121
598 Ga0207644_10192571
599 Ga0207644_10427452
600 Ga0207706_10050687
601 Ga0207686_10122862
602 Ga0207670_10239350
603 Ga0207669_10055645
604 Ga0207704_10539460
605 Ga0207665_10198811
606 Ga0207691_10267246
607 Ga0207711_10040471
608 Ga0207689_10080030
609 Ga0207667_10059690
610 Ga0207667_10074175
611 Ga0207667_10136030
612 Ga0207667_10299711
613 Ga0207667_10310967
614 Ga0207667_10507866
615 Ga0207651_10049657
616 Ga0207640_10101203
617 Ga0207640_10106595
618 Ga0207640_10849793
619 Ga0207677_10254919
620 Ga0207703_10161162
621 Ga0207639_10016250
622 Ga0207639_10580322
623 Ga0207708_10017786
624 Ga0207708_10254008
625 Ga0207708_10683895
626 Ga0207702_10083944
627 Ga0207702_10294089
628 Ga0207702_10682435
629 Ga0207641_10046043
630 Ga0207641_10853643
631 Ga0207641_11008318
632 Ga0207676_10051820
633 Ga0207676_10186742
634 Ga0207674_10454387
635 Ga0207675_100018519
636 Ga0207675_100453072
637 Ga0207683_10063177
638 Ga0207683_10139977
639 Ga0207683_10249876
640 Ga0207698_10538005
641 Ga0209981_1010194
642 Ga0209996_1010420
643 Ga0209970_1037181
644 Ga0207428_10357977
645 Ga0268266_10409845
646 Ga0265338_10034538
647 Ga0265338_10318596
648 Ga0265330_10040482
649 Ga0265320_10036960
650 Ga0265325_10006946
651 Ga0265325_10023654
652 Ga0265325_10055045
653 Ga0265325_10141780
654 Ga0265329_10050314
655 Ga0265340_10029531
656 Ga0265340_10041513
657 Ga0265340_10171961
658 Ga0265339_10116883
659 Ga0265331_10040397
660 Ga0265331_10115228
661 Ga0265316_10037970
662 Ga0265316_10471974
663 Ga0265313_10009488
664 Ga0265313_10011191
665 Ga0265314_10020469
666 Ga0265342_10000290
667 Ga0265342_10011669
668 Ga0307416_101073741
669 Ga0373958_0021937
670 Ga0373929_0003611
671 Ga0373923_0000212
672 Ga0373923_0093221
673 Ga0373936_0003590
674 Ga0373941_0061276
675 Ga0373953_0003138
676 Ga0373953_0004230
677 Ga0373954_0004499
678 Ga0373956_0006527
679 Ga0373957_0003967
680 Ga0373957_0025646
681 Ga0373943_0001439
682 Ga0373955_0000673
683 Ga0373955_0001617
684 Ga0373942_0015161
685 Ga0373924_0057006
686 Ga0373924_0220199
687 Ga0373931_0007661
688 Ga0373931_0027673
689 Ga0373935_0000017
690 Ga0373935_0059608
691 Ga0373927_0007744
692 Ga0373927_0152821
693 Ga0373933_0001228
694 Ga0373933_0016982
695 Ga0373947_0001167
696 Ga0373937_0000103
697 Ga0373937_0019474
698 Ga0373925_0000058
699 Ga0373925_0015855
700 Ga0373925_0509184
701 Ga0395905_0107627
702 Ga0436364_0895437
703 Ga0436364_1475927
704 Ga0395901_0212331
705 Ga0436365_0314125
706 Ga0436365_0910004
707 Ga0436363_0137348
708 Ga0436363_0488951
709 Ga0436363_1103966
710 Ga0436363_1620675
711 Ga0436362_0792029
712 Ga0439448_0009250
713 Ga0451577_0621778
714 Ga0495592_0000062
715 Ga0495592_0109810
716 Ga0495629_0001807
717 Ga0495629_0640184
718 Ga0495651_0001912
719 Ga0495653_0000072
720 Ga0495662_0167542
721 Ga0495664_0000009
722 Ga0495608_0001132
723 Ga0495608_0098412
724 Ga0495618_0000061
725 Ga0495628_0000012
726 Ga0495630_0002587
727 Ga0495630_0459440
728 Ga0495652_0000021
729 Ga0495652_0441072
730 Ga0495665_0108797
731 Ga0495640_0000028
732 Ga0495587_0000033
733 Ga0495587_0011210
734 Ga0495621_0010695
735 Ga0495645_0000017
736 Ga0495667_0000011
737 Ga0495667_0001149
738 Ga0495667_0127043
739 Ga0495634_0000220
740 Ga0495635_0000019
741 Ga0495635_0160198
742 Ga0495659_0050325
743 Ga0495657_0000378
744 Ga0495657_0014694
745 Ga0495599_0000024
746 Ga0495623_0000022
747 Ga0495623_0349674
748 Ga0495646_0000033
749 Ga0495658_0140118
750 Ga0495613_0469822
751 Ga0495600_0000028
752 Ga0495600_0068540
753 Ga0495581_0005703
754 Ga0495581_0145345
755 Ga0495604_0000011
756 Ga0495604_0053225
757 Ga0495604_0153462
758 Ga0495674_0000015
759 Ga0495680_0002528
760 Ga0495680_0024699
761 Ga0495680_0182521
762 Ga0495675_0000295
763 Ga0495675_0023486
764 Ga0495675_0516240
765 Ga0495684_0000036
766 Ga0495684_0121501
767 Ga0495684_0347297
768 Ga0495593_0007137
769 Ga0495593_0405615
770 Ga0495602_0000018
771 Ga0496101_0009025
772 Ga0496102_0072956
773 Ga0496103_0416281
774 Ga0496107_0026008
775 Ga0496108_0214394
776 Ga0496110_0186161
777 Ga0496110_0365123
778 Ga0496111_0084493
779 Ga0496112_0299733
780 Ga0496114_0014685
781 Ga0496115_0055964
782 Ga0501031_0293372
783 Ga0501033_0031041
784 Ga0501033_0042353
785 Ga0501033_0520714
786 Ga0501034_0123175
787 Ga0501034_1072123
788 Ga0501036_0029030
789 Ga0501036_0356803
790 Ga0501037_0095709
791 Ga0501037_0543009
792 Ga0501038_0095297
793 Ga0501041_0337475
794 Ga0501043_0149496
795 Ga0501043_0818271
796 Ga0501046_0156079
797 Ga0501046_0239817
798 Ga0501046_0623166
799 Ga0501048_0096511
800 Ga0501048_0161716
801 Ga0501048_0291219
802 Ga0501067_0438665
803 Ga0501070_0181846
804 Ga0501072_0277322
805 Ga0501073_0214951
806 Ga0501075_0050414
807 Ga0501076_0047156
808 Ga0501076_0703691
809 Ga0501080_0072349
810 Ga0501081_0118111
811 Ga0501083_0308518
812 Ga0501035_0219837
813 Ga0501044_0006667
814 Ga0501044_0093150
815 Ga0501044_0110075
816 Ga0501044_0308656
817 Ga0501044_0394240
818 nmdc:mga03n38_162205_c1
819 nmdc:mga03n38_72118_c1
820 nmdc:mga00v17_613950_c1
821 nmdc:mga0yw44_12256_c1
822 nmdc:mga0yw44_440026_c1
823 nmdc:mga0yw44_597401_c1
824 nmdc:mga0yw44_85771_c1
825 nmdc:mga06z11_214951_c1
826 nmdc:mga06z11_53889_c1
827 nmdc:mga07m45_115800_c1
828 nmdc:mga07m45_177144_c1
829 nmdc:mga07m45_340384_c1
830 nmdc:mga09592_277187_c1
831 nmdc:mga06r32_342346_c1
832 nmdc:mga08y16_1243179_c1
833 nmdc:mga0n895_52821_c1
834 nmdc:mga08x19_231234_c1
835 nmdc:mga08x19_38506_c1
836 nmdc:mga0sz30_162609_c1
837 Ga0495601_0000024
838 Ga0495601_0046704
839 Ga0495612_0000079
840 Ga0495612_0148434
841 Ga0495595_0000036
842 Ga0495595_0048527
843 Ga0495595_0223074
844 Ga0495619_0000034
845 Ga0495619_0199203
846 Ga0500641_0080384
847 Ga0500595_019643
848 Ga0500658_0193373
849 Ga0500616_0059122
850 Ga0501084_0147445
851 Ga0501084_0395088
852 Ga0501082_0281395

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05683

Fumerase_C

Fumarase C-terminus

9

223

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dni-assembly2.cif.gz_B crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit 0.8773 3 181
2isb-assembly1.cif.gz_A crystal structure of fumarase of fum-1 (np_069927.1) from archaeoglobus fulgidus at 1.66 a resolution 0.869 1 180
5dni-assembly2.cif.gz_B crystal structure of methanocaldococcus jannaschii fumarate hydratase beta subunit 0.8635 3 181
7xky-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.8616 5 195
7xky-assembly1.cif.gz_B crystal structure of methanocaldococcus jannaschii two-subunit fumarate hydratase apo-protein complex 0.849 5 195
ID Description Score Start End Superfamily
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9251 3 179 3.20.130.10
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9002 3 179 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8743 3 181 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8688 3 179 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8606 3 181 3.20.130.10
ID Description Score Start End GO Terms
AF-A0A495TTR3-F1-model_v4 L(+)-tartrate dehydratase beta subunit 0.979 2 201 GO:0016836
AF-A0A259BUR2-F1-model_v4 L(+)-tartrate dehydratase subunit beta (EC 4.2.1.32) 0.9776 1 171 GO:0016836
AF-A0A1F4ET13-F1-model_v4 Fumarate hydrolyase 0.974 1 200 GO:0016836
AF-A0A537FVR7-F1-model_v4 L(+)-tartrate dehydratase subunit beta (EC 4.2.1.32) 0.9651 35 200 GO:0016836
AF-A0A495TTR3-F1-model_v4 L(+)-tartrate dehydratase beta subunit 0.9647 2 201 GO:0016836

Map