F441101

General Info

Members Datasets Scaffolds Average Seq Length
426 252 852 221

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10077651|JGI24737J22298_100776512
Length 250
Sequence VAGPACTQPDHAYLLRRVDSDTRGVSTHPPPLGRILVVEDDHGLRDVLARGLRSEDYDVVTAADGXGALGVDLTTIDAIVLDIGLPDSDGRDVCQAVRAGGSDVPVLLLTARRAVGDRLSGFAAGADDYLAKPFAFAELVARLRVMLRRSRARDDATRADLHIDPVSHSLVYGSARIVLSPIEFRLLARLLATTDAIVRRRELIEAGWPDGVPVSDNTLDQYVSKLRRKIAEAGAAQTILTVRGVGYRIA

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
112 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
113 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
114 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
131 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
132 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
135 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
136 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
137 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
138 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
183 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
231 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
232 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
233 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
234 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
235 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
236 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
237 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
238 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
239 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
242 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
243 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
245 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
246 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
247 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
248 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
249 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
250 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
251 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
252 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.46
Nodule 0
Rhizoplane 16.9
Rhizosphere 75.82
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10077651 3300001990 Bacteria 989
2 Ga0070658_10346485 3300005327 Bacteria 1271
3 Ga0070683_100059813 3300005329 Bacteria 3540
4 Ga0070683_100629347 3300005329 Bacteria 1027
5 Ga0070682_100065644 3300005337 Bacteria 2307
6 Ga0070682_100128379 3300005337 Bacteria 1712
7 Ga0068868_100068881 3300005338 Bacteria 2818
8 Ga0068868_100189033 3300005338 Bacteria 1712
9 Ga0070660_100002325 3300005339 Bacteria 13063
10 Ga0070660_100097849 3300005339 Bacteria 2322
11 Ga0070689_100050339 3300005340 Bacteria 3218
12 Ga0070691_10153688 3300005341 Bacteria 1182
13 Ga0070687_100149422 3300005343 Bacteria 1370
14 Ga0070692_10086877 3300005345 Bacteria 1693
15 Ga0070668_100244519 3300005347 Bacteria 1487
16 Ga0070669_100160068 3300005353 Bacteria 1749
17 Ga0070675_100322141 3300005354 Bacteria 1365
18 Ga0070671_100364755 3300005355 Bacteria 1233
19 Ga0070673_100672338 3300005364 Bacteria 949
20 Ga0070688_100018652 3300005365 Bacteria 4007
21 Ga0070688_100222743 3300005365 Bacteria 1330
22 Ga0070667_100706384 3300005367 Bacteria 933
23 Ga0070709_10036900 3300005434 Bacteria 2981
24 Ga0070714_100121621 3300005435 Bacteria 2323
25 Ga0070711_100076967 3300005439 Bacteria 2366
26 Ga0070705_100031569 3300005440 Bacteria 2934
27 Ga0070708_100005941 3300005445 Bacteria 9705
28 Ga0070663_100133339 3300005455 Bacteria 1889
29 Ga0070678_100043980 3300005456 Bacteria 3186
30 Ga0070681_10013336 3300005458 Bacteria 8168
31 Ga0070681_10038784 3300005458 Bacteria 4776
32 Ga0070681_10100216 3300005458 Bacteria 2843
33 Ga0068867_100375103 3300005459 Bacteria 1193
34 Ga0070685_10102661 3300005466 Bacteria 1748
35 Ga0070706_100189116 3300005467 Bacteria 1924
36 Ga0070698_100245277 3300005471 Bacteria 1724
37 Ga0070699_100032793 3300005518 Bacteria 4486
38 Ga0070699_100113400 3300005518 Bacteria 2381
39 Ga0070679_100089593 3300005530 Bacteria 3063
40 Ga0070684_100110100 3300005535 Bacteria 2469
41 Ga0070684_100252526 3300005535 Bacteria 1612
42 Ga0070686_100089844 3300005544 Bacteria 2052
43 Ga0070695_100009238 3300005545 Bacteria 5862
44 Ga0070693_100080890 3300005547 Bacteria 1937
45 Ga0070693_100407944 3300005547 Bacteria 944
46 Ga0070665_100288643 3300005548 Bacteria 1643
47 Ga0068855_100069623 3300005563 Bacteria 4094
48 Ga0068857_100956845 3300005577 Bacteria 823
49 Ga0070702_100013404 3300005615 Bacteria 4138
50 Ga0068852_100145495 3300005616 Bacteria 2198
51 Ga0068852_100695559 3300005616 Bacteria 1026
52 Ga0068859_100008523 3300005617 Bacteria 10373
53 Ga0068859_100153720 3300005617 Bacteria 2377
54 Ga0068864_100059604 3300005618 Bacteria 3303
55 Ga0068861_100299384 3300005719 Bacteria 1392
56 Ga0068861_100312782 3300005719 Bacteria 1365
57 Ga0068851_10148277 3300005834 Bacteria 1280
58 Ga0068863_100478536 3300005841 Bacteria 1224
59 Ga0081455_10011398 3300005937 Bacteria 8937
60 Ga0081455_10525123 3300005937 Bacteria 789
61 Ga0075432_10131948 3300006058 Bacteria 947
62 Ga0075367_10000074 3300006178 Bacteria 25690
63 Ga0097621_100290173 3300006237 Bacteria 1442
64 Ga0097621_100369627 3300006237 Bacteria 1279
65 Ga0097621_100690630 3300006237 Bacteria 939
66 Ga0068871_100305677 3300006358 Bacteria 1397
67 Ga0075433_10298715 3300006852 Bacteria 1426
68 Ga0075433_10392192 3300006852 Bacteria 1225
69 Ga0075434_100032857 3300006871 Bacteria 5118
70 Ga0075434_100053465 3300006871 Bacteria 4013
71 Ga0075434_100154340 3300006871 Bacteria 2316
72 Ga0097620_100008523 3300006931 Bacteria 10373
73 Ga0097620_100153718 3300006931 Bacteria 2377
74 Ga0075435_100027990 3300007076 Bacteria 4416
75 Ga0105240_10740463 3300009093 Bacteria 1069
76 Ga0105245_10851245 3300009098 Bacteria 952
77 Ga0105247_10100485 3300009101 Bacteria 1849
78 Ga0114129_10402442 3300009147 Bacteria 1804
79 Ga0114129_10692335 3300009147 Bacteria 1311
80 Ga0105241_10152164 3300009174 Bacteria 1894
81 Ga0105241_10327188 3300009174 Bacteria 1323
82 Ga0105242_10008868 3300009176 Bacteria 7717
83 Ga0105242_10082493 3300009176 Bacteria 2691
84 Ga0105242_10128139 3300009176 Bacteria 2187
85 Ga0105248_10407062 3300009177 Bacteria 1532
86 Ga0105238_11300789 3300009551 Bacteria 753
87 Ga0105249_10040553 3300009553 Bacteria 4229
88 Ga0105249_10040873 3300009553 Bacteria 4213
89 Ga0105239_10212931 3300010375 Bacteria 2166
90 Ga0105246_10213556 3300011119 Bacteria 1507
91 Ga0157369_10358033 3300013105 Bacteria 1515
92 Ga0157378_10073755 3300013297 Bacteria 3069
93 Ga0163162_10211868 3300013306 Bacteria 2067
94 Ga0157372_10796339 3300013307 Bacteria 1098
95 Ga0157375_10083681 3300013308 Bacteria 3236
96 Ga0157375_10160666 3300013308 Bacteria 2388
97 Ga0157375_10969379 3300013308 Bacteria 991
98 Ga0163163_10061787 3300014325 Bacteria 3712
99 Ga0163163_10301654 3300014325 Bacteria 1654
100 Ga0163163_10329768 3300014325 Bacteria 1580
101 Ga0163163_11143088 3300014325 Bacteria 841
102 Ga0157380_10018376 3300014326 Bacteria 5188
103 Ga0157380_10420260 3300014326 Bacteria 1275
104 Ga0157377_10110718 3300014745 Bacteria 1650
105 Ga0157376_10116425 3300014969 Bacteria 2361
106 Ga0163161_10264327 3300017792 Bacteria 1345
107 Ga0163161_10265492 3300017792 Bacteria 1342
108 Ga0207642_10131012 3300025899 Bacteria 1309
109 Ga0207710_10022620 3300025900 Bacteria 2699
110 Ga0207688_10037864 3300025901 Bacteria 2676
111 Ga0207685_10214478 3300025905 Bacteria 912
112 Ga0207654_10088448 3300025911 Bacteria 1882
113 Ga0207707_10010155 3300025912 Bacteria 8171
114 Ga0207707_10076612 3300025912 Bacteria 2919
115 Ga0207707_10076691 3300025912 Bacteria 2917
116 Ga0207693_10086753 3300025915 Bacteria 2453
117 Ga0207663_10078240 3300025916 Bacteria 2155
118 Ga0207660_10323947 3300025917 Bacteria 1231
119 Ga0207657_10007130 3300025919 Bacteria 11478
120 Ga0207687_10343781 3300025927 Bacteria 1214
121 Ga0207690_10054468 3300025932 Bacteria 2690
122 Ga0207706_10132277 3300025933 Bacteria 2194
123 Ga0207686_10111819 3300025934 Bacteria 1843
124 Ga0207686_10170377 3300025934 Bacteria 1535
125 Ga0207686_10258217 3300025934 Bacteria 1276
126 Ga0207686_10359095 3300025934 Bacteria 1099
127 Ga0207709_10031839 3300025935 Bacteria 3084
128 Ga0207709_10092963 3300025935 Bacteria 1976
129 Ga0207670_10491419 3300025936 Bacteria 995
130 Ga0207691_10223723 3300025940 Bacteria 1631
131 Ga0207679_10055253 3300025945 Bacteria 2926
132 Ga0207667_10276536 3300025949 Bacteria 1716
133 Ga0207651_10691281 3300025960 Bacteria 898
134 Ga0207668_10029773 3300025972 Bacteria 3582
135 Ga0207658_10596674 3300025986 Bacteria 992
136 Ga0207677_10163401 3300026023 Bacteria 1733
137 Ga0207677_10209677 3300026023 Bacteria 1555
138 Ga0207677_10229945 3300026023 Bacteria 1493
139 Ga0207678_10164950 3300026067 Bacteria 1892
140 Ga0207708_10005318 3300026075 Bacteria 9482
141 Ga0207702_10019129 3300026078 Bacteria 5667
142 Ga0207702_10088945 3300026078 Bacteria 2700
143 Ga0207702_10360761 3300026078 Bacteria 1393
144 Ga0207641_10188176 3300026088 Bacteria 1896
145 Ga0207648_10137747 3300026089 Bacteria 2150
146 Ga0207648_10306020 3300026089 Bacteria 1426
147 Ga0207676_10057868 3300026095 Bacteria 3055
148 Ga0207676_10167059 3300026095 Bacteria 1913
149 Ga0207674_10768963 3300026116 Bacteria 930
150 Ga0207683_10156135 3300026121 Bacteria 2061
151 Ga0207698_10431882 3300026142 Bacteria 1267
152 Ga0209813_10003636 3300027866 Bacteria 3624
153 Ga0268266_10286596 3300028379 Bacteria 1533
154 Ga0268265_10289027 3300028380 Bacteria 1471
155 Ga0307517_10006361 3300028786 Bacteria 17506
156 Ga0307511_10053209 3300030521 Bacteria 3213
157 Ga0307508_10025306 3300031616 Bacteria 5381
158 Ga0307514_10159342 3300031649 Bacteria 1497
159 Ga0307516_10107627 3300031730 Bacteria 2596
160 Ga0307507_10209658 3300033179 Bacteria 1331
161 Ga0373944_0014459 3300035089 Bacteria 2202
162 Ga0373932_0132671 3300035112 Bacteria 841
163 Ga0373936_0047911 3300035113 Bacteria 1725
164 Ga0373943_0001983 3300035170 Bacteria 9262
165 Ga0373946_0077436 3300035171 Bacteria 1449
166 Ga0373935_0021417 3300035692 Bacteria 3957
167 Ga0373947_0000222 3300035725 Bacteria 31904
168 Ga0373925_0021930 3300037068 Bacteria 4656
169 Ga0395900_0211115 3300037418 Bacteria 1960
170 Ga0395900_0443685 3300037418 Bacteria 1255
171 Ga0395898_0017541 3300037466 Bacteria 7307
172 Ga0395898_0418798 3300037466 Bacteria 1277
173 Ga0395898_0676728 3300037466 Bacteria 974
174 Ga0395905_0065694 3300037471 Bacteria 3397
175 Ga0395901_0782337 3300038443 Bacteria 945
176 Ga0451853_1521591 3300041512 Bacteria 746
177 Ga0466969_0129780 3300044656 Bacteria 1169
178 Ga0466972_0012905 3300044658 Bacteria 4196
179 Ga0466965_0011354 3300044683 Bacteria 4173
180 Ga0466966_0025640 3300044684 Bacteria 3851
181 Ga0466966_0046375 3300044684 Bacteria 2775
182 Ga0466961_0027808 3300044693 Bacteria 3637
183 Ga0466961_0033173 3300044693 Bacteria 3318
184 Ga0466961_0087200 3300044693 Bacteria 1972
185 Ga0466964_0009317 3300044706 Bacteria 3695
186 Ga0466964_0010045 3300044706 Bacteria 3566
187 Ga0466964_0092997 3300044706 Bacteria 1316
188 Ga0466964_0102001 3300044706 Bacteria 1266
189 Ga0466964_0183009 3300044706 Bacteria 995
190 Ga0466964_0265279 3300044706 Bacteria 852
191 Ga0466971_0031559 3300044719 Bacteria 2372
192 Ga0466968_0039424 3300044735 Bacteria 1989
193 Ga0466970_0151712 3300044765 Bacteria 1279
194 Ga0466957_0017089 3300044842 Bacteria 4244
195 Ga0466957_0019700 3300044842 Bacteria 3969
196 Ga0466957_0275938 3300044842 Bacteria 1124
197 Ga0466957_0308396 3300044842 Bacteria 1065
198 Ga0466957_0356539 3300044842 Bacteria 993
199 Ga0466960_0020902 3300044901 Bacteria 2907
200 Ga0466960_0081552 3300044901 Bacteria 1631
201 Ga0466960_0138975 3300044901 Bacteria 1289
202 Ga0466960_0145551 3300044901 Bacteria 1262
203 Ga0466959_0101964 3300045049 Bacteria 2054
204 Ga0466959_0277474 3300045049 Bacteria 1151
205 Ga0466959_0573127 3300045049 Bacteria 760
206 Ga0466958_0032341 3300045836 Bacteria 3112
207 Ga0466958_0166564 3300045836 Bacteria 1394
208 Ga0466967_0010865 3300045976 Bacteria 6859
209 Ga0466967_0023912 3300045976 Bacteria 5015
210 Ga0466967_0026236 3300045976 Bacteria 4822
211 Ga0466967_0055877 3300045976 Bacteria 3478
212 Ga0466967_0063606 3300045976 Bacteria 3279
213 Ga0466967_0136569 3300045976 Bacteria 2281
214 Ga0466967_0150149 3300045976 Bacteria 2177
215 Ga0466967_0269561 3300045976 Bacteria 1631
216 Ga0466967_0343593 3300045976 Bacteria 1444
217 Ga0466967_0347284 3300045976 Bacteria 1435
218 Ga0466967_0360775 3300045976 Bacteria 1408
219 Ga0466967_0652720 3300045976 Bacteria 1040
220 Ga0495592_0028461 3300046454 Bacteria 4232
221 Ga0495592_0071951 3300046454 Bacteria 2516
222 Ga0495592_0086600 3300046454 Bacteria 2255
223 Ga0495603_0001155 3300046455 Bacteria 15387
224 Ga0495603_0049733 3300046455 Bacteria 2495
225 Ga0495603_0436526 3300046455 Bacteria 750
226 Ga0495629_0003818 3300046459 Bacteria 11359
227 Ga0495629_0010246 3300046459 Bacteria 6826
228 Ga0495629_0064836 3300046459 Bacteria 2550
229 Ga0495629_0105214 3300046459 Unclassified 1968
230 Ga0495641_0000795 3300046461 Bacteria 26778
231 Ga0495641_0035998 3300046461 Bacteria 2329
232 Ga0495641_0128489 3300046461 Bacteria 1131
233 Ga0495653_0007924 3300046463 Bacteria 8696
234 Ga0495582_0000389 3300046473 Bacteria 23879
235 Ga0495639_0014212 3300046475 Bacteria 3445
236 Ga0495662_0001778 3300046476 Bacteria 10785
237 Ga0495664_0082385 3300046477 Bacteria 1929
238 Ga0495664_0274088 3300046477 Bacteria 1019
239 Ga0495594_0120776 3300046499 Bacteria 1481
240 Ga0495608_0031321 3300046511 Bacteria 3596
241 Ga0495618_0021109 3300046514 Bacteria 4014
242 Ga0495618_0062511 3300046514 Bacteria 2363
243 Ga0495628_0025994 3300046516 Bacteria 4780
244 Ga0495628_0074314 3300046516 Bacteria 2648
245 Ga0495630_0007847 3300046517 Bacteria 7645
246 Ga0495643_0006312 3300046522 Bacteria 7835
247 Ga0495666_0009722 3300046526 Bacteria 4807
248 Ga0495642_0120648 3300046528 Bacteria 1125
249 Ga0495652_0082874 3300046529 Bacteria 2641
250 Ga0495652_0089621 3300046529 Bacteria 2518
251 Ga0495652_0092532 3300046529 Bacteria 2470
252 Ga0495665_0004221 3300046531 Bacteria 7757
253 Ga0495640_0038654 3300046533 Bacteria 3355
254 Ga0495640_0040504 3300046533 Bacteria 3263
255 Ga0495587_0062747 3300046536 Bacteria 2175
256 Ga0495645_0043646 3300046543 Bacteria 3271
257 Ga0495645_0077999 3300046543 Bacteria 2381
258 Ga0495633_0056582 3300046558 Bacteria 1843
259 Ga0495667_0231973 3300046559 Bacteria 1177
260 Ga0495667_0393471 3300046559 Bacteria 873
261 Ga0495634_0018212 3300046642 Bacteria 5003
262 Ga0495634_0073107 3300046642 Bacteria 2255
263 Ga0495634_0104777 3300046642 Bacteria 1824
264 Ga0495659_0198630 3300046664 Bacteria 822
265 Ga0495657_0300436 3300046675 Bacteria 957
266 Ga0495657_0378217 3300046675 Bacteria 835
267 Ga0495599_0033844 3300046678 Bacteria 3212
268 Ga0495599_0184586 3300046678 Bacteria 1285
269 Ga0495623_0247891 3300046679 Bacteria 1003
270 Ga0495647_0003468 3300046681 Bacteria 5044
271 Ga0495658_0001525 3300046683 Bacteria 12150
272 Ga0495658_0008507 3300046683 Bacteria 5087
273 Ga0495613_0002272 3300046689 Bacteria 14542
274 Ga0495613_0003278 3300046689 Bacteria 12106
275 Ga0495613_0022230 3300046689 Bacteria 4726
276 Ga0495613_0202667 3300046689 Bacteria 1398
277 Ga0495624_0077263 3300046690 Bacteria 2065
278 Ga0495624_0081822 3300046690 Bacteria 1999
279 Ga0495624_0287833 3300046690 Bacteria 992
280 Ga0495600_0079223 3300046809 Bacteria 2145
281 Ga0495600_0133455 3300046809 Bacteria 1613
282 Ga0495660_0053633 3300046810 Bacteria 2188
283 Ga0495581_0001758 3300047315 Bacteria 12088
284 Ga0495604_0021702 3300047317 Bacteria 5126
285 Ga0495674_0042626 3300047319 Bacteria 4046
286 Ga0495674_0042829 3300047319 Bacteria 4035
287 Ga0495676_0015324 3300047321 Bacteria 6830
288 Ga0495676_0021231 3300047321 Bacteria 5676
289 Ga0495676_0082754 3300047321 Bacteria 2428
290 Ga0495680_0000519 3300047322 Bacteria 43595
291 Ga0495680_0003790 3300047322 Bacteria 14700
292 Ga0495687_012650 3300047443 Bacteria 4448
293 Ga0495687_023609 3300047443 Bacteria 2935
294 Ga0495675_0212392 3300047444 Bacteria 1174
295 Ga0495685_001220 3300047447 Bacteria 7889
296 Ga0495681_0006887 3300047470 Bacteria 7374
297 Ga0495684_0011537 3300047471 Bacteria 6828
298 Ga0495684_0020449 3300047471 Bacteria 5101
299 Ga0495593_0004192 3300047673 Bacteria 8570
300 Ga0495602_0128245 3300048088 Bacteria 2028
301 Ga0495614_0016737 3300048089 Bacteria 3189
302 Ga0496100_0014140 3300048903 Bacteria 4625
303 Ga0496100_0153549 3300048903 Bacteria 1645
304 Ga0496100_0181329 3300048903 Bacteria 1523
305 Ga0496100_0496918 3300048903 Bacteria 939
306 Ga0496100_0535790 3300048903 Bacteria 905
307 Ga0496101_0006615 3300048904 Bacteria 7468
308 Ga0496101_0010053 3300048904 Bacteria 6236
309 Ga0496101_0010345 3300048904 Bacteria 6160
310 Ga0496101_0023916 3300048904 Bacteria 4224
311 Ga0496101_0233787 3300048904 Bacteria 1429
312 Ga0496101_0509987 3300048904 Bacteria 950
313 Ga0496102_0000142 3300048905 Bacteria 97037
314 Ga0496102_0010551 3300048905 Bacteria 7955
315 Ga0496102_0035505 3300048905 Bacteria 4487
316 Ga0496102_0205281 3300048905 Bacteria 1858
317 Ga0496102_0423715 3300048905 Bacteria 1250
318 Ga0496103_0000085 3300048906 Bacteria 105412
319 Ga0496103_0018681 3300048906 Bacteria 4159
320 Ga0496103_0086320 3300048906 Bacteria 1978
321 Ga0496104_0006703 3300048907 Bacteria 10136
322 Ga0496104_0169688 3300048907 Bacteria 2092
323 Ga0496104_0506505 3300048907 Bacteria 1118
324 Ga0496105_0051671 3300048908 Bacteria 3395
325 Ga0496105_0162000 3300048908 Bacteria 1836
326 Ga0496105_0229450 3300048908 Bacteria 1509
327 Ga0496106_0042635 3300048909 Bacteria 3403
328 Ga0496106_0044028 3300048909 Bacteria 3350
329 Ga0496106_0048464 3300048909 Bacteria 3199
330 Ga0496106_0159062 3300048909 Bacteria 1786
331 Ga0496106_0579249 3300048909 Bacteria 900
332 Ga0496107_0014076 3300048910 Bacteria 5600
333 Ga0496107_0030945 3300048910 Bacteria 3816
334 Ga0496107_0087453 3300048910 Bacteria 2275
335 Ga0496107_0111465 3300048910 Bacteria 2011
336 Ga0496107_0370188 3300048910 Bacteria 1066
337 Ga0496108_0015085 3300048911 Bacteria 6308
338 Ga0496108_0053553 3300048911 Bacteria 3384
339 Ga0496108_0081557 3300048911 Bacteria 2741
340 Ga0496109_0004121 3300048912 Bacteria 12140
341 Ga0496109_0018930 3300048912 Bacteria 6062
342 Ga0496109_0057568 3300048912 Bacteria 3548
343 Ga0496109_0081850 3300048912 Bacteria 2975
344 Ga0496110_0036519 3300048913 Bacteria 4267
345 Ga0496110_0070820 3300048913 Bacteria 3090
346 Ga0496110_0105408 3300048913 Bacteria 2529
347 Ga0496110_0118291 3300048913 Bacteria 2386
348 Ga0496111_0021167 3300048914 Bacteria 4537
349 Ga0496111_0106141 3300048914 Bacteria 2067
350 Ga0496111_0165700 3300048914 Bacteria 1641
351 Ga0496112_0007883 3300048915 Bacteria 9485
352 Ga0496112_0048550 3300048915 Bacteria 4162
353 Ga0496112_0251671 3300048915 Bacteria 1717
354 Ga0496112_0394191 3300048915 Bacteria 1325
355 Ga0496112_0397404 3300048915 Bacteria 1318
356 Ga0496112_0693458 3300048915 Bacteria 946
357 Ga0496113_0057194 3300048916 Bacteria 2930
358 Ga0496113_0139829 3300048916 Bacteria 1904
359 Ga0496113_0313382 3300048916 Bacteria 1257
360 Ga0496114_0011954 3300048917 Bacteria 6944
361 Ga0496114_0018076 3300048917 Bacteria 5696
362 Ga0496114_0031044 3300048917 Bacteria 4395
363 Ga0496114_0033259 3300048917 Bacteria 4247
364 Ga0496114_0040045 3300048917 Bacteria 3878
365 Ga0496114_0060902 3300048917 Bacteria 3155
366 Ga0496114_0081418 3300048917 Bacteria 2735
367 Ga0496114_0149890 3300048917 Bacteria 2023
368 Ga0496114_0231167 3300048917 Bacteria 1625
369 Ga0496115_0000507 3300048918 Bacteria 30530
370 Ga0496115_0104019 3300048918 Bacteria 2330
371 Ga0496115_0184959 3300048918 Bacteria 1722
372 Ga0496115_0291484 3300048918 Bacteria 1339
373 Ga0496118_0027870 3300048921 Bacteria 4771
374 Ga0496119_0072476 3300048922 Bacteria 2012
375 Ga0496121_0098197 3300048924 Bacteria 2267
376 Ga0501033_0561976 3300049570 Bacteria 785
377 Ga0501047_0039558 3300049581 Bacteria 4561
378 Ga0501047_0387806 3300049581 Bacteria 1231
379 Ga0501048_0407133 3300049582 Bacteria 973
380 Ga0501067_0245858 3300049583 Bacteria 996
381 Ga0501070_0078564 3300049586 Bacteria 2731
382 Ga0501070_0222414 3300049586 Bacteria 1548
383 Ga0501083_0152191 3300049744 Bacteria 1515
384 Ga0501044_0217612 3300049823 Bacteria 1862
385 nmdc:mga06z11_171_c1 3300050494 Bacteria 25680
386 nmdc:mga04h51_3198_c1 3300050495 Bacteria 3954
387 nmdc:mga05p37_1043090_c1 3300050507 Bacteria 863
388 nmdc:mga05p37_213288_c1 3300050507 Bacteria 2333
389 nmdc:mga05p37_323526_c1 3300050507 Bacteria 1824
390 nmdc:mga0n895_117798_c1 3300050512 Bacteria 2675
391 nmdc:mga0n895_24720_c1 3300050512 Bacteria 5664
392 nmdc:mga0n895_35969_c1 3300050512 Bacteria 4778
393 nmdc:mga0rr50_20568_c1 3300050513 Bacteria 4487
394 nmdc:mga0a205_205947_c1 3300050515 Bacteria 1856
395 nmdc:mga0a205_49224_c1 3300050515 Bacteria 1808
396 Ga0495601_0004720 3300053077 Bacteria 7898
397 Ga0495612_0048479 3300053078 Bacteria 1741
398 Ga0495655_0025863 3300053083 Bacteria 1377
399 Ga0495595_0001289 3300053084 Bacteria 9782
400 Ga0495619_0001579 3300053085 Bacteria 14982
401 Ga0495619_0063235 3300053085 Bacteria 2465
402 Ga0500578_0012129 3300053086 Bacteria 5569
403 Ga0500566_0085879 3300053094 Bacteria 1745
404 Ga0500654_054329 3300053099 Bacteria 2121
405 Ga0500553_053801 3300053101 Bacteria 1920
406 Ga0500569_012787 3300053109 Bacteria 2038
407 Ga0500580_103287 3300053113 Bacteria 1117
408 Ga0500614_005592 3300053123 Bacteria 2636
409 Ga0500652_029760 3300053131 Bacteria 2131
410 Ga0500561_0034678 3300053137 Bacteria 1297
411 Ga0500579_047903 3300053143 Bacteria 2635
412 Ga0500600_0045154 3300053149 Bacteria 2522
413 Ga0500616_0100927 3300053153 Bacteria 1410
414 Ga0500634_0036638 3300053161 Bacteria 2670
415 Ga0500656_004243 3300053732 Bacteria 1378
416 Ga0500587_007565 3300053739 Bacteria 1411
417 Ga0466962_0001219 3300061719 Bacteria 11834
418 Ga0466962_0092736 3300061719 Bacteria 1448
419 2515853404 2515154155 Bacteria 7985436
420 2731905987 2731639228 Bacteria 4187555
421 2793982947 2791355406 Bacteria 11364898
422 8025532069 8025530807 Bacteria 8495698
423 8047903345 8047893842 Bacteria 11723082
424 8048365936 8048356638 Bacteria 11044339
425 8048379215 8048369669 Bacteria 11666822
426 8048388321 8048379754 Bacteria 11877923
427 JGI24737J22298_10077651
428 Ga0070658_10346485
429 Ga0070683_100059813
430 Ga0070683_100629347
431 Ga0070682_100065644
432 Ga0070682_100128379
433 Ga0068868_100068881
434 Ga0068868_100189033
435 Ga0070660_100002325
436 Ga0070660_100097849
437 Ga0070689_100050339
438 Ga0070691_10153688
439 Ga0070687_100149422
440 Ga0070692_10086877
441 Ga0070668_100244519
442 Ga0070669_100160068
443 Ga0070675_100322141
444 Ga0070671_100364755
445 Ga0070673_100672338
446 Ga0070688_100018652
447 Ga0070688_100222743
448 Ga0070667_100706384
449 Ga0070709_10036900
450 Ga0070714_100121621
451 Ga0070711_100076967
452 Ga0070705_100031569
453 Ga0070708_100005941
454 Ga0070663_100133339
455 Ga0070678_100043980
456 Ga0070681_10013336
457 Ga0070681_10038784
458 Ga0070681_10100216
459 Ga0068867_100375103
460 Ga0070685_10102661
461 Ga0070706_100189116
462 Ga0070698_100245277
463 Ga0070699_100032793
464 Ga0070699_100113400
465 Ga0070679_100089593
466 Ga0070684_100110100
467 Ga0070684_100252526
468 Ga0070686_100089844
469 Ga0070695_100009238
470 Ga0070693_100080890
471 Ga0070693_100407944
472 Ga0070665_100288643
473 Ga0068855_100069623
474 Ga0068857_100956845
475 Ga0070702_100013404
476 Ga0068852_100145495
477 Ga0068852_100695559
478 Ga0068859_100008523
479 Ga0068859_100153720
480 Ga0068864_100059604
481 Ga0068861_100299384
482 Ga0068861_100312782
483 Ga0068851_10148277
484 Ga0068863_100478536
485 Ga0081455_10011398
486 Ga0081455_10525123
487 Ga0075432_10131948
488 Ga0075367_10000074
489 Ga0097621_100290173
490 Ga0097621_100369627
491 Ga0097621_100690630
492 Ga0068871_100305677
493 Ga0075433_10298715
494 Ga0075433_10392192
495 Ga0075434_100032857
496 Ga0075434_100053465
497 Ga0075434_100154340
498 Ga0097620_100008523
499 Ga0097620_100153718
500 Ga0075435_100027990
501 Ga0105240_10740463
502 Ga0105245_10851245
503 Ga0105247_10100485
504 Ga0114129_10402442
505 Ga0114129_10692335
506 Ga0105241_10152164
507 Ga0105241_10327188
508 Ga0105242_10008868
509 Ga0105242_10082493
510 Ga0105242_10128139
511 Ga0105248_10407062
512 Ga0105238_11300789
513 Ga0105249_10040553
514 Ga0105249_10040873
515 Ga0105239_10212931
516 Ga0105246_10213556
517 Ga0157369_10358033
518 Ga0157378_10073755
519 Ga0163162_10211868
520 Ga0157372_10796339
521 Ga0157375_10083681
522 Ga0157375_10160666
523 Ga0157375_10969379
524 Ga0163163_10061787
525 Ga0163163_10301654
526 Ga0163163_10329768
527 Ga0163163_11143088
528 Ga0157380_10018376
529 Ga0157380_10420260
530 Ga0157377_10110718
531 Ga0157376_10116425
532 Ga0163161_10264327
533 Ga0163161_10265492
534 Ga0207642_10131012
535 Ga0207710_10022620
536 Ga0207688_10037864
537 Ga0207685_10214478
538 Ga0207654_10088448
539 Ga0207707_10010155
540 Ga0207707_10076612
541 Ga0207707_10076691
542 Ga0207693_10086753
543 Ga0207663_10078240
544 Ga0207660_10323947
545 Ga0207657_10007130
546 Ga0207687_10343781
547 Ga0207690_10054468
548 Ga0207706_10132277
549 Ga0207686_10111819
550 Ga0207686_10170377
551 Ga0207686_10258217
552 Ga0207686_10359095
553 Ga0207709_10031839
554 Ga0207709_10092963
555 Ga0207670_10491419
556 Ga0207691_10223723
557 Ga0207679_10055253
558 Ga0207667_10276536
559 Ga0207651_10691281
560 Ga0207668_10029773
561 Ga0207658_10596674
562 Ga0207677_10163401
563 Ga0207677_10209677
564 Ga0207677_10229945
565 Ga0207678_10164950
566 Ga0207708_10005318
567 Ga0207702_10019129
568 Ga0207702_10088945
569 Ga0207702_10360761
570 Ga0207641_10188176
571 Ga0207648_10137747
572 Ga0207648_10306020
573 Ga0207676_10057868
574 Ga0207676_10167059
575 Ga0207674_10768963
576 Ga0207683_10156135
577 Ga0207698_10431882
578 Ga0209813_10003636
579 Ga0268266_10286596
580 Ga0268265_10289027
581 Ga0307517_10006361
582 Ga0307511_10053209
583 Ga0307508_10025306
584 Ga0307514_10159342
585 Ga0307516_10107627
586 Ga0307507_10209658
587 Ga0373944_0014459
588 Ga0373932_0132671
589 Ga0373936_0047911
590 Ga0373943_0001983
591 Ga0373946_0077436
592 Ga0373935_0021417
593 Ga0373947_0000222
594 Ga0373925_0021930
595 Ga0395900_0211115
596 Ga0395900_0443685
597 Ga0395898_0017541
598 Ga0395898_0418798
599 Ga0395898_0676728
600 Ga0395905_0065694
601 Ga0395901_0782337
602 Ga0451853_1521591
603 Ga0466969_0129780
604 Ga0466972_0012905
605 Ga0466965_0011354
606 Ga0466966_0025640
607 Ga0466966_0046375
608 Ga0466961_0027808
609 Ga0466961_0033173
610 Ga0466961_0087200
611 Ga0466964_0009317
612 Ga0466964_0010045
613 Ga0466964_0092997
614 Ga0466964_0102001
615 Ga0466964_0183009
616 Ga0466964_0265279
617 Ga0466971_0031559
618 Ga0466968_0039424
619 Ga0466970_0151712
620 Ga0466957_0017089
621 Ga0466957_0019700
622 Ga0466957_0275938
623 Ga0466957_0308396
624 Ga0466957_0356539
625 Ga0466960_0020902
626 Ga0466960_0081552
627 Ga0466960_0138975
628 Ga0466960_0145551
629 Ga0466959_0101964
630 Ga0466959_0277474
631 Ga0466959_0573127
632 Ga0466958_0032341
633 Ga0466958_0166564
634 Ga0466967_0010865
635 Ga0466967_0023912
636 Ga0466967_0026236
637 Ga0466967_0055877
638 Ga0466967_0063606
639 Ga0466967_0136569
640 Ga0466967_0150149
641 Ga0466967_0269561
642 Ga0466967_0343593
643 Ga0466967_0347284
644 Ga0466967_0360775
645 Ga0466967_0652720
646 Ga0495592_0028461
647 Ga0495592_0071951
648 Ga0495592_0086600
649 Ga0495603_0001155
650 Ga0495603_0049733
651 Ga0495603_0436526
652 Ga0495629_0003818
653 Ga0495629_0010246
654 Ga0495629_0064836
655 Ga0495629_0105214
656 Ga0495641_0000795
657 Ga0495641_0035998
658 Ga0495641_0128489
659 Ga0495653_0007924
660 Ga0495582_0000389
661 Ga0495639_0014212
662 Ga0495662_0001778
663 Ga0495664_0082385
664 Ga0495664_0274088
665 Ga0495594_0120776
666 Ga0495608_0031321
667 Ga0495618_0021109
668 Ga0495618_0062511
669 Ga0495628_0025994
670 Ga0495628_0074314
671 Ga0495630_0007847
672 Ga0495643_0006312
673 Ga0495666_0009722
674 Ga0495642_0120648
675 Ga0495652_0082874
676 Ga0495652_0089621
677 Ga0495652_0092532
678 Ga0495665_0004221
679 Ga0495640_0038654
680 Ga0495640_0040504
681 Ga0495587_0062747
682 Ga0495645_0043646
683 Ga0495645_0077999
684 Ga0495633_0056582
685 Ga0495667_0231973
686 Ga0495667_0393471
687 Ga0495634_0018212
688 Ga0495634_0073107
689 Ga0495634_0104777
690 Ga0495659_0198630
691 Ga0495657_0300436
692 Ga0495657_0378217
693 Ga0495599_0033844
694 Ga0495599_0184586
695 Ga0495623_0247891
696 Ga0495647_0003468
697 Ga0495658_0001525
698 Ga0495658_0008507
699 Ga0495613_0002272
700 Ga0495613_0003278
701 Ga0495613_0022230
702 Ga0495613_0202667
703 Ga0495624_0077263
704 Ga0495624_0081822
705 Ga0495624_0287833
706 Ga0495600_0079223
707 Ga0495600_0133455
708 Ga0495660_0053633
709 Ga0495581_0001758
710 Ga0495604_0021702
711 Ga0495674_0042626
712 Ga0495674_0042829
713 Ga0495676_0015324
714 Ga0495676_0021231
715 Ga0495676_0082754
716 Ga0495680_0000519
717 Ga0495680_0003790
718 Ga0495687_012650
719 Ga0495687_023609
720 Ga0495675_0212392
721 Ga0495685_001220
722 Ga0495681_0006887
723 Ga0495684_0011537
724 Ga0495684_0020449
725 Ga0495593_0004192
726 Ga0495602_0128245
727 Ga0495614_0016737
728 Ga0496100_0014140
729 Ga0496100_0153549
730 Ga0496100_0181329
731 Ga0496100_0496918
732 Ga0496100_0535790
733 Ga0496101_0006615
734 Ga0496101_0010053
735 Ga0496101_0010345
736 Ga0496101_0023916
737 Ga0496101_0233787
738 Ga0496101_0509987
739 Ga0496102_0000142
740 Ga0496102_0010551
741 Ga0496102_0035505
742 Ga0496102_0205281
743 Ga0496102_0423715
744 Ga0496103_0000085
745 Ga0496103_0018681
746 Ga0496103_0086320
747 Ga0496104_0006703
748 Ga0496104_0169688
749 Ga0496104_0506505
750 Ga0496105_0051671
751 Ga0496105_0162000
752 Ga0496105_0229450
753 Ga0496106_0042635
754 Ga0496106_0044028
755 Ga0496106_0048464
756 Ga0496106_0159062
757 Ga0496106_0579249
758 Ga0496107_0014076
759 Ga0496107_0030945
760 Ga0496107_0087453
761 Ga0496107_0111465
762 Ga0496107_0370188
763 Ga0496108_0015085
764 Ga0496108_0053553
765 Ga0496108_0081557
766 Ga0496109_0004121
767 Ga0496109_0018930
768 Ga0496109_0057568
769 Ga0496109_0081850
770 Ga0496110_0036519
771 Ga0496110_0070820
772 Ga0496110_0105408
773 Ga0496110_0118291
774 Ga0496111_0021167
775 Ga0496111_0106141
776 Ga0496111_0165700
777 Ga0496112_0007883
778 Ga0496112_0048550
779 Ga0496112_0251671
780 Ga0496112_0394191
781 Ga0496112_0397404
782 Ga0496112_0693458
783 Ga0496113_0057194
784 Ga0496113_0139829
785 Ga0496113_0313382
786 Ga0496114_0011954
787 Ga0496114_0018076
788 Ga0496114_0031044
789 Ga0496114_0033259
790 Ga0496114_0040045
791 Ga0496114_0060902
792 Ga0496114_0081418
793 Ga0496114_0149890
794 Ga0496114_0231167
795 Ga0496115_0000507
796 Ga0496115_0104019
797 Ga0496115_0184959
798 Ga0496115_0291484
799 Ga0496118_0027870
800 Ga0496119_0072476
801 Ga0496121_0098197
802 Ga0501033_0561976
803 Ga0501047_0039558
804 Ga0501047_0387806
805 Ga0501048_0407133
806 Ga0501067_0245858
807 Ga0501070_0078564
808 Ga0501070_0222414
809 Ga0501083_0152191
810 Ga0501044_0217612
811 nmdc:mga06z11_171_c1
812 nmdc:mga04h51_3198_c1
813 nmdc:mga05p37_1043090_c1
814 nmdc:mga05p37_213288_c1
815 nmdc:mga05p37_323526_c1
816 nmdc:mga0n895_117798_c1
817 nmdc:mga0n895_24720_c1
818 nmdc:mga0n895_35969_c1
819 nmdc:mga0rr50_20568_c1
820 nmdc:mga0a205_205947_c1
821 nmdc:mga0a205_49224_c1
822 Ga0495601_0004720
823 Ga0495612_0048479
824 Ga0495655_0025863
825 Ga0495595_0001289
826 Ga0495619_0001579
827 Ga0495619_0063235
828 Ga0500578_0012129
829 Ga0500566_0085879
830 Ga0500654_054329
831 Ga0500553_053801
832 Ga0500569_012787
833 Ga0500580_103287
834 Ga0500614_005592
835 Ga0500652_029760
836 Ga0500561_0034678
837 Ga0500579_047903
838 Ga0500600_0045154
839 Ga0500616_0100927
840 Ga0500634_0036638
841 Ga0500656_004243
842 Ga0500587_007565
843 Ga0466962_0001219
844 Ga0466962_0092736
845 2515853404
846 2731905987
847 2793982947
848 8025532069
849 8047903345
850 8048365936
851 8048379215
852 8048388321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

35

144

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9504 34 148
3w9s-assembly1.cif.gz_B crystal structure analysis of the n-terminal receiver domain of response regulator pmra 0.9447 35 147
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9446 32 150
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9415 34 148
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9413 34 148
ID Description Score Start End Superfamily
af_Q2G2G2_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9629 32 110 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9527 33 156 3.40.50.2300
af_P0AE88_2_83_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9486 34 113 3.40.50.2300
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9421 33 149 3.40.50.2300
af_P23836_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9414 34 110 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2H0YKY1-F1-model_v4 Fis family transcriptional regulator 0.9567 31 156 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-I5B1C4-F1-model_v4 Response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains 0.9534 33 156 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A2D6JZL9-F1-model_v4 Response regulatory domain-containing protein 0.9525 33 151 GO:0000160
AF-A0A7V0ULA9-F1-model_v4 Response regulator 0.9521 32 150 GO:0000160
AF-K2B8M8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9518 31 151 GO:0000155

Map