F441055

General Info

Members Datasets Scaffolds Average Seq Length
425 220 411 109

Family's Representative Sequence

Representative Sequence 3300048921|Ga0496118_0063199|Ga0496118_0063199_2146_2445
Length 99
Sequence MNDDSALGVLAALAHPTRLDAFRLLVRHEPSGLMQSTFSTHLAVLAKAGLVRSEKRGRQQIQRASIDTLRGLMTFLARDCCGGRAELCEPLLAELATCR

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
5 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
6 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
7 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
8 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
9 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
17 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
25 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
78 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
79 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
82 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
120 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
139 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
140 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
155 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
180 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
181 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
182 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
185 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
186 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
195 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
196 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
197 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
198 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
202 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
203 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
206 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
211 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
214 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
215 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
216 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
217 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
218 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
219 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
220 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0.24
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.29
Nodule 0.47
Rhizoplane 3.76
Rhizosphere 60.71
Stem 0
Stem Tuber 0
Unclassified 15.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002046 3300001904 Bacteria 3585
2 JGI24741J21665_1001846 3300001915 Bacteria 5787
3 JGI24740J21852_10006131 3300001979 Bacteria 5019
4 JGI24739J22299_10005502 3300001989 Bacteria 4805
5 JGI24739J22299_10145626 3300001989 Bacteria 701
6 JGI24737J22298_10006147 3300001990 Bacteria 4114
7 JGI24735J21928_10006314 3300002067 Bacteria 3911
8 JGI24738J21930_10005123 3300002075 Bacteria 3167
9 JGI25152J39213_1015371 3300002773 Bacteria 1512
10 JGI25150J39212_1000369 3300002774 Bacteria 21665
11 JGI25151J46595_10096728 3300003187 Bacteria 806
12 JGI25153J46596_10000124 3300003215 Bacteria 86430
13 Ga0055526_1003257 3300003771 Bacteria 10432
14 Ga0055536_1002431 3300003781 Bacteria 10470
15 Ga0055536_1037844 3300003781 Bacteria 1176
16 Ga0055530_10004849 3300003791 Bacteria 6723
17 Ga0055530_10005341 3300003791 Bacteria 6147
18 Ga0055530_10016847 3300003791 Bacteria 2312
19 Ga0055540_1001358 3300003792 Bacteria 14676
20 Ga0055531_10004227 3300003794 Bacteria 8835
21 Ga0055531_10024408 3300003794 Bacteria 2232
22 Ga0055531_10032711 3300003794 Bacteria 1693
23 Ga0065704_10314730 3300005289 Bacteria 862
24 Ga0065704_10412611 3300005289 Bacteria 740
25 Ga0070658_10012637 3300005327 Bacteria 6772
26 Ga0070658_10420529 3300005327 Bacteria 1149
27 Ga0070670_100016799 3300005331 Bacteria 6280
28 Ga0070682_100237101 3300005337 Bacteria 1308
29 Ga0070660_100201454 3300005339 Bacteria 1614
30 Ga0070661_100144219 3300005344 Bacteria 1796
31 Ga0070668_100000569 3300005347 Bacteria 24702
32 Ga0070668_100009144 3300005347 Bacteria 7352
33 Ga0070668_100523586 3300005347 Bacteria 1029
34 Ga0070669_100078743 3300005353 Bacteria 2450
35 Ga0070669_100294746 3300005353 Bacteria 1303
36 Ga0070669_101110147 3300005353 Bacteria 681
37 Ga0070671_100000021 3300005355 Bacteria 127093
38 Ga0070659_100279166 3300005366 Bacteria 1389
39 Ga0070667_100000009 3300005367 Bacteria 281488
40 Ga0070663_100055964 3300005455 Bacteria 2825
41 Ga0070665_100006511 3300005548 Bacteria 11872
42 Ga0070665_100084815 3300005548 Bacteria 3173
43 Ga0070665_100147672 3300005548 Bacteria 2354
44 Ga0070665_100526553 3300005548 Bacteria 1194
45 Ga0068855_100073172 3300005563 Bacteria 3982
46 Ga0068855_100096236 3300005563 Bacteria 3412
47 Ga0068855_100192401 3300005563 Bacteria 2300
48 Ga0068855_100466512 3300005563 Bacteria 1376
49 Ga0068855_100664332 3300005563 Bacteria 1118
50 Ga0070664_100053193 3300005564 Bacteria 3431
51 Ga0068857_100058372 3300005577 Bacteria 3426
52 Ga0068854_100014957 3300005578 Bacteria 5126
53 Ga0068854_100104568 3300005578 Bacteria 2127
54 Ga0068854_100851183 3300005578 Bacteria 798
55 Ga0068856_100019226 3300005614 Bacteria 6631
56 Ga0068856_100156718 3300005614 Bacteria 2287
57 Ga0068852_100499143 3300005616 Bacteria 1211
58 Ga0068859_100011059 3300005617 Bacteria 9079
59 Ga0068859_101923049 3300005617 Bacteria 653
60 Ga0068864_100002538 3300005618 Bacteria 15075
61 Ga0068861_102713222 3300005719 Bacteria 500
62 Ga0068851_10019777 3300005834 Bacteria 3254
63 Ga0068851_10701521 3300005834 Bacteria 623
64 Ga0068858_100001651 3300005842 Bacteria 22784
65 Ga0068860_100000193 3300005843 Bacteria 97253
66 Ga0068862_100000031 3300005844 Bacteria 180203
67 Ga0068862_100008954 3300005844 Bacteria 8285
68 Ga0068862_100149835 3300005844 Bacteria 2076
69 Ga0075368_10000214 3300006042 Bacteria 16126
70 Ga0075368_10000330 3300006042 Bacteria 13869
71 Ga0075368_10051442 3300006042 Bacteria 1638
72 Ga0075363_100198995 3300006048 Bacteria 1144
73 Ga0075363_100661025 3300006048 Bacteria 629
74 Ga0075364_10027914 3300006051 Bacteria 3609
75 Ga0075367_10002007 3300006178 Bacteria 9075
76 Ga0075367_10024923 3300006178 Bacteria 3377
77 Ga0075367_10057748 3300006178 Bacteria 2308
78 Ga0075367_10058295 3300006178 Bacteria 2297
79 Ga0075366_10005515 3300006195 Bacteria 6857
80 Ga0075366_10238004 3300006195 Bacteria 1110
81 Ga0075370_10004824 3300006353 Bacteria 6607
82 Ga0075370_10114521 3300006353 Bacteria 1567
83 Ga0097620_100011059 3300006931 Bacteria 9079
84 Ga0097620_101924158 3300006931 Bacteria 653
85 Ga0079104_1036908 3300006946 Bacteria 1169
86 Ga0079104_1037737 3300006946 Bacteria 1149
87 Ga0105251_10018057 3300009011 Bacteria 3763
88 Ga0105251_10305571 3300009011 Bacteria 721
89 Ga0105250_10100694 3300009092 Bacteria 1179
90 Ga0105240_10011931 3300009093 Bacteria 12047
91 Ga0105240_10030854 3300009093 Bacteria 6962
92 Ga0105240_10318449 3300009093 Bacteria 1774
93 Ga0105240_10340925 3300009093 Bacteria 1702
94 Ga0105240_11009431 3300009093 Bacteria 889
95 Ga0105240_12402274 3300009093 Bacteria 545
96 Ga0105247_10112139 3300009101 Bacteria 1757
97 Ga0105243_10079746 3300009148 Bacteria 2668
98 Ga0105241_10040773 3300009174 Bacteria 3506
99 Ga0105248_10184982 3300009177 Bacteria 2348
100 Ga0105248_10240640 3300009177 Bacteria 2037
101 Ga0105237_10001890 3300009545 Bacteria 26727
102 Ga0105237_10004065 3300009545 Bacteria 17062
103 Ga0105237_10065031 3300009545 Bacteria 3643
104 Ga0105237_10157103 3300009545 Bacteria 2271
105 Ga0105238_10642329 3300009551 Bacteria 1071
106 Ga0105249_10003624 3300009553 Bacteria 13354
107 Ga0105249_10058713 3300009553 Bacteria 3526
108 Ga0105239_10000113 3300010375 Bacteria 114562
109 Ga0105239_10000385 3300010375 Bacteria 64470
110 Ga0105239_11043389 3300010375 Bacteria 940
111 Ga0157373_10038189 3300013100 Bacteria 3442
112 Ga0157370_10017512 3300013104 Bacteria 7229
113 Ga0157370_10160036 3300013104 Bacteria 2095
114 Ga0157369_10310574 3300013105 Bacteria 1640
115 Ga0157369_10457546 3300013105 Bacteria 1321
116 Ga0163162_10795809 3300013306 Bacteria 1063
117 Ga0157372_12572625 3300013307 Bacteria 584
118 Ga0163161_10001715 3300017792 Bacteria 16062
119 Ga0163161_10003363 3300017792 Bacteria 11217
120 Ga0207425_1000022 3300025245 Bacteria 355305
121 Ga0209129_1001190 3300025258 Bacteria 14977
122 Ga0209565_1013741 3300025263 Bacteria 1886
123 Ga0209676_1000060 3300025292 Bacteria 338238
124 Ga0209676_1001039 3300025292 Bacteria 32114
125 Ga0209676_1006830 3300025292 Bacteria 5534
126 Ga0209676_1069617 3300025292 Bacteria 841
127 Ga0209025_1000326 3300025294 Bacteria 106087
128 Ga0209025_1039447 3300025294 Bacteria 2059
129 Ga0209564_1004449 3300025295 Bacteria 8568
130 Ga0209758_1000004 3300025297 Bacteria 1375322
131 Ga0209050_1000001 3300025298 Bacteria 3563507
132 Ga0209050_1000402 3300025298 Bacteria 80873
133 Ga0209050_1000622 3300025298 Bacteria 55613
134 Ga0209050_1003107 3300025298 Bacteria 12726
135 Ga0209050_1014204 3300025298 Bacteria 3456
136 Ga0209050_1023582 3300025298 Bacteria 2159
137 Ga0209051_1000303 3300025303 Bacteria 77630
138 Ga0209051_1000563 3300025303 Bacteria 45044
139 Ga0209257_1001450 3300025304 Bacteria 28046
140 Ga0209257_1001686 3300025304 Bacteria 24844
141 Ga0209257_1002690 3300025304 Bacteria 16999
142 Ga0209257_1003007 3300025304 Bacteria 15275
143 Ga0207656_10190513 3300025321 Bacteria 987
144 Ga0207713_1025698 3300025735 Bacteria 2712
145 Ga0207713_1137129 3300025735 Bacteria 802
146 Ga0207710_10084952 3300025900 Bacteria 1473
147 Ga0207647_10159287 3300025904 Bacteria 1317
148 Ga0207705_10450480 3300025909 Bacteria 998
149 Ga0207654_10024820 3300025911 Bacteria 3227
150 Ga0207695_10008826 3300025913 Bacteria 12551
151 Ga0207695_10009471 3300025913 Bacteria 12051
152 Ga0207695_10067731 3300025913 Bacteria 3661
153 Ga0207695_10286956 3300025913 Bacteria 1539
154 Ga0207695_11561979 3300025913 Bacteria 540
155 Ga0207671_10001440 3300025914 Bacteria 27565
156 Ga0207671_10002051 3300025914 Bacteria 22123
157 Ga0207671_10016082 3300025914 Bacteria 5829
158 Ga0207671_10088631 3300025914 Bacteria 2328
159 Ga0207657_10013883 3300025919 Bacteria 7882
160 Ga0207649_11545813 3300025920 Bacteria 525
161 Ga0207681_10090203 3300025923 Bacteria 2187
162 Ga0207681_10279363 3300025923 Bacteria 1314
163 Ga0207681_10758044 3300025923 Bacteria 809
164 Ga0207694_10410294 3300025924 Bacteria 1127
165 Ga0207694_10572477 3300025924 Bacteria 949
166 Ga0207694_10786960 3300025924 Bacteria 803
167 Ga0207694_10808018 3300025924 Bacteria 792
168 Ga0207650_10030802 3300025925 Bacteria 3868
169 Ga0207644_10001372 3300025931 Bacteria 15670
170 Ga0207644_11077400 3300025931 Bacteria 675
171 Ga0207690_10351106 3300025932 Bacteria 1166
172 Ga0207711_10053217 3300025941 Bacteria 3472
173 Ga0207661_10287959 3300025944 Bacteria 1470
174 Ga0207679_10671957 3300025945 Bacteria 938
175 Ga0207667_10011452 3300025949 Bacteria 10307
176 Ga0207667_10170231 3300025949 Bacteria 2239
177 Ga0207667_10230791 3300025949 Bacteria 1895
178 Ga0207712_10004353 3300025961 Bacteria 8943
179 Ga0207712_10250531 3300025961 Bacteria 1431
180 Ga0207668_10000031 3300025972 Bacteria 122168
181 Ga0207668_10003517 3300025972 Bacteria 9202
182 Ga0207640_10013814 3300025981 Bacteria 4636
183 Ga0207640_10088005 3300025981 Bacteria 2143
184 Ga0207640_10127863 3300025981 Bacteria 1832
185 Ga0207640_10281137 3300025981 Bacteria 1307
186 Ga0207640_10358305 3300025981 Bacteria 1174
187 Ga0207658_10000009 3300025986 Bacteria 264118
188 Ga0207703_10003045 3300026035 Bacteria 14178
189 Ga0207639_10002138 3300026041 Bacteria 13301
190 Ga0207678_10002748 3300026067 Bacteria 15930
191 Ga0207702_10005233 3300026078 Bacteria 11389
192 Ga0207702_10136396 3300026078 Bacteria 2214
193 Ga0207641_10012950 3300026088 Bacteria 6842
194 Ga0207676_10009379 3300026095 Bacteria 6965
195 Ga0207674_10704090 3300026116 Bacteria 975
196 Ga0207674_11469751 3300026116 Bacteria 651
197 Ga0207675_100049339 3300026118 Bacteria 3929
198 Ga0207698_10042301 3300026142 Bacteria 3402
199 Ga0209813_10000038 3300027866 Bacteria 56808
200 Ga0209813_10000092 3300027866 Bacteria 33357
201 Ga0209813_10028078 3300027866 Bacteria 1638
202 Ga0209974_10022532 3300027876 Bacteria 2087
203 Ga0268266_10030166 3300028379 Bacteria 4608
204 Ga0268266_10875651 3300028379 Bacteria 868
205 Ga0268266_11776744 3300028379 Bacteria 591
206 Ga0268265_10000118 3300028380 Bacteria 99496
207 Ga0268265_10012328 3300028380 Bacteria 5792
208 Ga0268265_10465000 3300028380 Bacteria 1184
209 Ga0268264_10000001 3300028381 Bacteria 1221000
210 Ga0307408_100002886 3300031548 Bacteria 11909
211 Ga0307408_100997793 3300031548 Bacteria 771
212 Ga0307408_101945399 3300031548 Bacteria 564
213 Ga0307408_102428593 3300031548 Bacteria 509
214 Ga0307405_10013872 3300031731 Bacteria 4311
215 Ga0307413_11070526 3300031824 Bacteria 695
216 Ga0307410_10354365 3300031852 Bacteria 1173
217 Ga0307406_10232520 3300031901 Bacteria 1377
218 Ga0307406_10520326 3300031901 Bacteria 968
219 Ga0307406_11204644 3300031901 Bacteria 658
220 Ga0307406_12058314 3300031901 Bacteria 511
221 Ga0307412_10000305 3300031911 Bacteria 31093
222 Ga0307412_10002329 3300031911 Bacteria 10515
223 Ga0307412_10022479 3300031911 Bacteria 3866
224 Ga0307412_10039705 3300031911 Bacteria 3041
225 Ga0307412_10164072 3300031911 Bacteria 1654
226 Ga0307412_10219197 3300031911 Bacteria 1457
227 Ga0307412_11654157 3300031911 Bacteria 586
228 Ga0307409_100466240 3300031995 Bacteria 1222
229 Ga0307416_100548068 3300032002 Bacteria 1229
230 Ga0307414_10010641 3300032004 Bacteria 5350
231 Ga0307414_10055254 3300032004 Bacteria 2779
232 Ga0307414_10109018 3300032004 Bacteria 2102
233 Ga0307414_10174810 3300032004 Bacteria 1721
234 Ga0307414_10207459 3300032004 Bacteria 1599
235 Ga0307414_10481614 3300032004 Bacteria 1094
236 Ga0307414_10620520 3300032004 Bacteria 972
237 Ga0307411_10199934 3300032005 Bacteria 1534
238 Ga0436365_0654829 3300039437 Bacteria 5264
239 Ga0451793_1470661 3300041452 Bacteria 903
240 Ga0451797_0336325 3300041453 Unclassified 512
241 Ga0451802_1259460 3300041460 Bacteria 2312
242 Ga0451806_262030 3300041462 Bacteria 2227
243 Ga0451845_0778869 3300041501 Bacteria 1461
244 Ga0451853_0292376 3300041512 Bacteria 1173
245 Ga0451853_2575038 3300041512 Bacteria 889
246 Ga0495627_000103 3300046453 Bacteria 104335
247 Ga0495627_000105 3300046453 Bacteria 103413
248 Ga0495638_0000021 3300046460 Bacteria 365602
249 Ga0495650_0001034 3300046471 Bacteria 31214
250 Ga0495650_0005530 3300046471 Bacteria 8166
251 Ga0495596_0000171 3300046500 Bacteria 45024
252 Ga0495596_0001194 3300046500 Bacteria 15178
253 Ga0495607_0038919 3300046501 Bacteria 2844
254 Ga0495607_0318693 3300046501 Bacteria 726
255 Ga0495583_0000184 3300046506 Bacteria 105978
256 Ga0495583_0028558 3300046506 Bacteria 2741
257 Ga0495583_0142949 3300046506 Bacteria 995
258 Ga0495606_0008550 3300046507 Bacteria 8864
259 Ga0495610_0000013 3300046512 Bacteria 465872
260 Ga0495610_0000018 3300046512 Bacteria 355044
261 Ga0495610_0372144 3300046512 Bacteria 533
262 Ga0495616_0134727 3300046513 Bacteria 1129
263 Ga0495620_0017002 3300046515 Bacteria 3636
264 Ga0495620_0026371 3300046515 Bacteria 2734
265 Ga0495632_0001694 3300046519 Bacteria 18032
266 Ga0495632_0106903 3300046519 Bacteria 1316
267 Ga0495643_0046215 3300046522 Bacteria 2361
268 Ga0495648_0000026 3300046524 Bacteria 232162
269 Ga0495648_0024447 3300046524 Bacteria 4113
270 Ga0495648_0024752 3300046524 Bacteria 4078
271 Ga0495648_0043489 3300046524 Bacteria 2815
272 Ga0495654_0069429 3300046530 Bacteria 1673
273 Ga0495609_0073544 3300046538 Bacteria 1499
274 Ga0495633_0018078 3300046558 Bacteria 3585
275 Ga0495668_0000002 3300046616 Bacteria 763179
276 Ga0495625_0002714 3300046660 Bacteria 18781
277 Ga0495671_0000050 3300046692 Bacteria 141936
278 Ga0495671_0610583 3300046692 Bacteria 519
279 Ga0495673_0000125 3300047469 Bacteria 141937
280 Ga0495673_0020024 3300047469 Bacteria 3339
281 Ga0495673_0037798 3300047469 Bacteria 2202
282 Ga0495681_0000174 3300047470 Bacteria 53932
283 Ga0495681_0005853 3300047470 Bacteria 8166
284 Ga0495681_0164762 3300047470 Bacteria 921
285 Ga0495686_0000057 3300047472 Bacteria 250088
286 Ga0495686_0000944 3300047472 Bacteria 36054
287 Ga0495686_0003856 3300047472 Bacteria 12676
288 Ga0495686_0538200 3300047472 Bacteria 611
289 Ga0495615_0000009 3300048090 Bacteria 76727
290 Ga0495615_0000022 3300048090 Bacteria 51294
291 Ga0496100_1374000 3300048903 Bacteria 557
292 Ga0496100_1517190 3300048903 Bacteria 529
293 Ga0496101_0088840 3300048904 Bacteria 2296
294 Ga0496101_0211175 3300048904 Bacteria 1504
295 Ga0496102_0201706 3300048905 Bacteria 1875
296 Ga0496103_1008501 3300048906 Bacteria 518
297 Ga0496104_0176792 3300048907 Bacteria 2045
298 Ga0496108_0019420 3300048911 Bacteria 5581
299 Ga0496110_0178598 3300048913 Bacteria 1927
300 Ga0496113_0304735 3300048916 Bacteria 1276
301 Ga0496115_0000527 3300048918 Bacteria 29744
302 Ga0496117_0021146 3300048920 Bacteria 5280
303 Ga0496117_0023876 3300048920 Bacteria 4854
304 Ga0496117_0115352 3300048920 Bacteria 1663
305 Ga0496118_0001437 3300048921 Bacteria 35866
306 Ga0496118_0011607 3300048921 Bacteria 8577
307 Ga0496118_0063199 3300048921 Bacteria 2725
308 Ga0496118_0070020 3300048921 Bacteria 2536
309 Ga0496118_0198027 3300048921 Bacteria 1193
310 Ga0496118_0511087 3300048921 Bacteria 595
311 Ga0496119_0074941 3300048922 Bacteria 1969
312 Ga0496120_0031380 3300048923 Bacteria 3218
313 Ga0496120_0048673 3300048923 Bacteria 2438
314 Ga0496121_0000079 3300048924 Bacteria 232653
315 Ga0496121_0000190 3300048924 Bacteria 136607
316 Ga0496121_0000721 3300048924 Bacteria 61207
317 Ga0496121_0002392 3300048924 Bacteria 28763
318 Ga0496121_0003974 3300048924 Bacteria 20396
319 Ga0496121_0138853 3300048924 Bacteria 1806
320 Ga0496121_0847207 3300048924 Bacteria 532
321 Ga0496122_0001343 3300048925 Bacteria 40125
322 Ga0496122_0004042 3300048925 Bacteria 18642
323 Ga0496122_0008010 3300048925 Bacteria 11540
324 Ga0496122_0074625 3300048925 Bacteria 2398
325 Ga0496122_0286099 3300048925 Bacteria 898
326 Ga0496123_0000300 3300048926 Bacteria 96475
327 Ga0496123_0002078 3300048926 Bacteria 25781
328 Ga0496123_0017198 3300048926 Bacteria 5833
329 Ga0496123_0019407 3300048926 Bacteria 5360
330 Ga0496123_0097570 3300048926 Bacteria 1721
331 Ga0496123_0207420 3300048926 Bacteria 999
332 Ga0496124_0000328 3300048927 Bacteria 87848
333 Ga0496124_0003193 3300048927 Bacteria 20246
334 Ga0496124_0019730 3300048927 Bacteria 6260
335 Ga0496124_0030437 3300048927 Bacteria 4791
336 Ga0496124_0061695 3300048927 Bacteria 3141
337 Ga0496124_0070939 3300048927 Bacteria 2889
338 Ga0496124_0088942 3300048927 Bacteria 2523
339 Ga0496124_0530492 3300048927 Bacteria 782
340 Ga0496124_0940798 3300048927 Bacteria 520
341 Ga0496125_0051091 3300048928 Bacteria 3413
342 Ga0496125_0083632 3300048928 Bacteria 2427
343 Ga0496125_0133528 3300048928 Bacteria 1741
344 Ga0496125_0270470 3300048928 Bacteria 1059
345 Ga0496125_0398226 3300048928 Bacteria 805
346 Ga0496125_0477750 3300048928 Bacteria 707
347 Ga0496126_0011320 3300048929 Bacteria 9253
348 Ga0496126_0013167 3300048929 Bacteria 8436
349 Ga0496126_0027270 3300048929 Bacteria 5458
350 Ga0496126_0111630 3300048929 Bacteria 2381
351 Ga0496126_0178999 3300048929 Bacteria 1802
352 Ga0496126_0437070 3300048929 Bacteria 1055
353 Ga0496126_0695283 3300048929 Bacteria 791
354 Ga0496126_0793587 3300048929 Bacteria 727
355 Ga0496126_0932664 3300048929 Bacteria 656
356 Ga0495682_0051598 3300049460 Bacteria 1496
357 Ga0501298_158986 3300049521 Bacteria 557
358 Ga0501300_003933 3300049523 Bacteria 2211
359 Ga0501300_017021 3300049523 Bacteria 1061
360 Ga0501338_09560 3300049554 Bacteria 647
361 Ga0501032_0027261 3300049569 Bacteria 3926
362 Ga0501033_0005862 3300049570 Bacteria 9657
363 Ga0501033_0176014 3300049570 Bacteria 1535
364 Ga0501036_0168045 3300049572 Bacteria 1848
365 Ga0501037_0351344 3300049573 Bacteria 1017
366 Ga0501038_0461500 3300049574 Bacteria 975
367 Ga0501043_0156558 3300049579 Bacteria 1782
368 Ga0501043_0184813 3300049579 Bacteria 1623
369 Ga0501047_0372329 3300049581 Bacteria 1263
370 Ga0501047_0801139 3300049581 Bacteria 757
371 Ga0501249_000267 3300049679 Bacteria 14967
372 Ga0501259_098608 3300049688 Bacteria 667
373 Ga0501241_009022 3300049758 Bacteria 1817
374 Ga0501279_030456 3300049775 Unclassified 799
375 Ga0501279_049162 3300049775 Bacteria 665
376 Ga0501282_009352 3300049778 Bacteria 1051
377 Ga0501282_035950 3300049778 Bacteria 579
378 Ga0501035_0004268 3300049822 Bacteria 13569
379 Ga0501035_0376696 3300049822 Bacteria 1184
380 Ga0501044_0000109 3300049823 Bacteria 100674
381 Ga0501044_0149971 3300049823 Bacteria 2315
382 Ga0501044_0718879 3300049823 Bacteria 883
383 Ga0501204_002562 3300049850 Bacteria 1857
384 nmdc:mga03n38_11652_c1 3300050490 Bacteria 3284
385 nmdc:mga00v17_34494_c1 3300050491 Bacteria 3006
386 nmdc:mga0k408_195626_c1 3300050493 Bacteria 1207
387 nmdc:mga0k408_296070_c1 3300050493 Bacteria 966
388 nmdc:mga06z11_266573_c1 3300050494 Bacteria 1012
389 nmdc:mga06z11_41_c1 3300050494 Bacteria 53112
390 nmdc:mga06z11_48_c1 3300050494 Bacteria 51095
391 nmdc:mga06z11_781843_c1 3300050494 Bacteria 582
392 nmdc:mga04h51_126080_c1 3300050495 Bacteria 958
393 nmdc:mga04h51_27_c1 3300050495 Bacteria 53116
394 nmdc:mga04h51_57_c1 3300050495 Bacteria 35214
395 nmdc:mga07m45_2787_c1 3300050496 Bacteria 8259
396 nmdc:mga07m45_4447_c1 3300050496 Bacteria 6859
397 nmdc:mga07m45_877884_c1 3300050496 Bacteria 513
398 Ga0500643_000172 3300053087 Bacteria 63436
399 Ga0500644_0085031 3300053088 Bacteria 1172
400 Ga0500592_003422 3300053116 Bacteria 2534
401 Ga0500607_000077 3300053121 Bacteria 71543
402 Ga0500607_000293 3300053121 Bacteria 47399
403 Ga0500658_0202066 3300053134 Bacteria 908
404 Ga0500577_0182264 3300053142 Bacteria 901
405 Ga0500604_0044613 3300053151 Bacteria 1351
406 Ga0500604_0148010 3300053151 Bacteria 796
407 Ga0500624_000961 3300053157 Bacteria 5934
408 Ga0500627_0000020 3300053158 Bacteria 109977
409 Ga0500634_0106700 3300053161 Bacteria 1390
410 Ga0500645_028765 3300053730 Bacteria 1680
411 Ga0500661_000033 3300055283 Bacteria 20509

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0063199 Ga0496118_0063199_2146_2445 98
2 3300048918 Ga0496115_0000527 Ga0496115_0000527_13774_14091 100
3 3300041453 Ga0451797_0336325 Ga0451797_0336325_46_384 101
4 3300003794 Ga0055531_10032711 Ga0055531_100327113 103
5 3300046501 Ga0495607_0038919 Ga0495607_0038919_561_890 104
6 3300048927 Ga0496124_0530492 Ga0496124_0530492_174_503 104
7 iso_pu_bacteria 2599185354 2600200421 105
8 iso_pu_bacteria 2643221563 2643832605 105
9 iso_pu_bacteria 2643221563 2643834708 105
10 iso_pu_bacteria 2643221608 2644053600 105
11 iso_pu_bacteria 2643221608 2644055635 105
12 iso_pu_bacteria 2751185897 2753767253 105
13 iso_pu_bacteria 2775507255 2778123923 105
14 iso_pu_bacteria 2818991466 2819713799 105
15 iso_pu_bacteria 2818991466 2819714249 105
16 iso_pu_bacteria 2852653556 2852656980 105
17 iso_pu_bacteria 2928526807 2928530466 105
18 iso_pu_bacteria 2928968154 2928968261 105
19 iso_pu_bacteria 2928968154 2928969799 105
20 iso_pu_bacteria 8054302542 8054305121 105
21 3300005844 Ga0068862_100149835 Ga0068862_1001498353 106
22 3300028380 Ga0268265_10465000 Ga0268265_104650002 106
23 3300047472 Ga0495686_0000944 Ga0495686_0000944_23516_23836 106
24 3300005834 Ga0068851_10701521 Ga0068851_107015212 108
25 3300048926 Ga0496123_0207420 Ga0496123_0207420_641_967 108
26 3300001904 JGI24736J21556_1002046 JGI24736J21556_10020464 109
27 3300001915 JGI24741J21665_1001846 JGI24741J21665_10018464 109
28 3300001979 JGI24740J21852_10006131 JGI24740J21852_100061315 109
29 3300001989 JGI24739J22299_10005502 JGI24739J22299_100055026 109
30 3300001989 JGI24739J22299_10145626 JGI24739J22299_101456262 109
31 3300001990 JGI24737J22298_10006147 JGI24737J22298_100061476 109
32 3300002067 JGI24735J21928_10006314 JGI24735J21928_100063142 109
33 3300002075 JGI24738J21930_10005123 JGI24738J21930_100051232 109
34 3300002773 JGI25152J39213_1015371 JGI25152J39213_10153713 109
35 3300002774 JGI25150J39212_1000369 JGI25150J39212_100036922 109
36 3300003187 JGI25151J46595_10096728 JGI25151J46595_100967281 109
37 3300003215 JGI25153J46596_10000124 JGI25153J46596_1000012425 109
38 3300003771 Ga0055526_1003257 Ga0055526_10032576 109
39 3300003781 Ga0055536_1002431 Ga0055536_100243115 109
40 3300003781 Ga0055536_1037844 Ga0055536_10378442 109
41 3300003791 Ga0055530_10004849 Ga0055530_100048499 109
42 3300003791 Ga0055530_10005341 Ga0055530_100053412 109
43 3300003791 Ga0055530_10016847 Ga0055530_100168473 109
44 3300003792 Ga0055540_1001358 Ga0055540_100135812 109
45 3300003794 Ga0055531_10004227 Ga0055531_1000422712 109
46 3300003794 Ga0055531_10024408 Ga0055531_100244083 109
47 3300005289 Ga0065704_10314730 Ga0065704_103147302 109
48 3300005289 Ga0065704_10412611 Ga0065704_104126111 109
49 3300005327 Ga0070658_10012637 Ga0070658_100126374 109
50 3300005327 Ga0070658_10420529 Ga0070658_104205293 109
51 3300005331 Ga0070670_100016799 Ga0070670_1000167997 109
52 3300005337 Ga0070682_100237101 Ga0070682_1002371013 109
53 3300005339 Ga0070660_100201454 Ga0070660_1002014544 109
54 3300005344 Ga0070661_100144219 Ga0070661_1001442191 109
55 3300005347 Ga0070668_100000569 Ga0070668_10000056912 109
56 3300005347 Ga0070668_100009144 Ga0070668_1000091447 109
57 3300005347 Ga0070668_100523586 Ga0070668_1005235861 109
58 3300005353 Ga0070669_100078743 Ga0070669_1000787432 109
59 3300005353 Ga0070669_100294746 Ga0070669_1002947461 109
60 3300005353 Ga0070669_101110147 Ga0070669_1011101471 109
61 3300005355 Ga0070671_100000021 Ga0070671_1000000213 109
62 3300005366 Ga0070659_100279166 Ga0070659_1002791663 109
63 3300005367 Ga0070667_100000009 Ga0070667_100000009173 109
64 3300005455 Ga0070663_100055964 Ga0070663_1000559642 109
65 3300005548 Ga0070665_100006511 Ga0070665_1000065113 109
66 3300005548 Ga0070665_100084815 Ga0070665_1000848152 109
67 3300005548 Ga0070665_100147672 Ga0070665_1001476724 109
68 3300005548 Ga0070665_100526553 Ga0070665_1005265532 109
69 3300005563 Ga0068855_100073172 Ga0068855_1000731726 109
70 3300005563 Ga0068855_100096236 Ga0068855_1000962362 109
71 3300005563 Ga0068855_100192401 Ga0068855_1001924015 109
72 3300005563 Ga0068855_100466512 Ga0068855_1004665123 109
73 3300005563 Ga0068855_100664332 Ga0068855_1006643321 109
74 3300005564 Ga0070664_100053193 Ga0070664_1000531935 109
75 3300005577 Ga0068857_100058372 Ga0068857_1000583724 109
76 3300005578 Ga0068854_100014957 Ga0068854_1000149572 109
77 3300005578 Ga0068854_100104568 Ga0068854_1001045683 109
78 3300005578 Ga0068854_100851183 Ga0068854_1008511832 109
79 3300005614 Ga0068856_100019226 Ga0068856_1000192266 109
80 3300005614 Ga0068856_100156718 Ga0068856_1001567183 109
81 3300005616 Ga0068852_100499143 Ga0068852_1004991432 109
82 3300005617 Ga0068859_100011059 Ga0068859_10001105910 109
83 3300005617 Ga0068859_101923049 Ga0068859_1019230491 109
84 3300005618 Ga0068864_100002538 Ga0068864_10000253817 109
85 3300005719 Ga0068861_102713222 Ga0068861_1027132221 109
86 3300005834 Ga0068851_10019777 Ga0068851_100197774 109
87 3300005842 Ga0068858_100001651 Ga0068858_10000165125 109
88 3300005843 Ga0068860_100000193 Ga0068860_1000001938 109
89 3300005844 Ga0068862_100000031 Ga0068862_100000031124 109
90 3300005844 Ga0068862_100008954 Ga0068862_1000089545 109
91 3300006042 Ga0075368_10000214 Ga0075368_100002144 109
92 3300006042 Ga0075368_10000330 Ga0075368_100003302 109
93 3300006042 Ga0075368_10051442 Ga0075368_100514422 109
94 3300006048 Ga0075363_100198995 Ga0075363_1001989953 109
95 3300006048 Ga0075363_100661025 Ga0075363_1006610252 109
96 3300006051 Ga0075364_10027914 Ga0075364_100279142 109
97 3300006178 Ga0075367_10002007 Ga0075367_100020076 109
98 3300006178 Ga0075367_10024923 Ga0075367_100249234 109
99 3300006178 Ga0075367_10057748 Ga0075367_100577484 109
100 3300006178 Ga0075367_10058295 Ga0075367_100582955 109
101 3300006195 Ga0075366_10005515 Ga0075366_100055159 109
102 3300006195 Ga0075366_10238004 Ga0075366_102380042 109
103 3300006353 Ga0075370_10004824 Ga0075370_100048244 109
104 3300006353 Ga0075370_10114521 Ga0075370_101145213 109
105 3300006931 Ga0097620_100011059 Ga0097620_10001105910 109
106 3300006931 Ga0097620_101924158 Ga0097620_1019241581 109
107 3300006946 Ga0079104_1036908 Ga0079104_10369083 109
108 3300006946 Ga0079104_1037737 Ga0079104_10377372 109
109 3300009011 Ga0105251_10018057 Ga0105251_100180575 109
110 3300009011 Ga0105251_10305571 Ga0105251_103055712 109
111 3300009092 Ga0105250_10100694 Ga0105250_101006942 109
112 3300009093 Ga0105240_10011931 Ga0105240_1001193110 109
113 3300009093 Ga0105240_10030854 Ga0105240_100308544 109
114 3300009093 Ga0105240_10318449 Ga0105240_103184493 109
115 3300009093 Ga0105240_10340925 Ga0105240_103409253 109
116 3300009093 Ga0105240_11009431 Ga0105240_110094311 109
117 3300009093 Ga0105240_12402274 Ga0105240_124022742 109
118 3300009101 Ga0105247_10112139 Ga0105247_101121393 109
119 3300009148 Ga0105243_10079746 Ga0105243_100797463 109
120 3300009174 Ga0105241_10040773 Ga0105241_100407734 109
121 3300009177 Ga0105248_10184982 Ga0105248_101849821 109
122 3300009177 Ga0105248_10240640 Ga0105248_102406402 109
123 3300009545 Ga0105237_10001890 Ga0105237_100018906 109
124 3300009545 Ga0105237_10004065 Ga0105237_1000406517 109
125 3300009545 Ga0105237_10065031 Ga0105237_100650315 109
126 3300009545 Ga0105237_10157103 Ga0105237_101571032 109
127 3300009551 Ga0105238_10642329 Ga0105238_106423292 109
128 3300009553 Ga0105249_10003624 Ga0105249_100036244 109
129 3300009553 Ga0105249_10058713 Ga0105249_100587131 109
130 3300010375 Ga0105239_10000113 Ga0105239_10000113121 109
131 3300010375 Ga0105239_10000385 Ga0105239_100003857 109
132 3300010375 Ga0105239_11043389 Ga0105239_110433893 109
133 3300013100 Ga0157373_10038189 Ga0157373_100381891 109
134 3300013104 Ga0157370_10017512 Ga0157370_100175126 109
135 3300013104 Ga0157370_10160036 Ga0157370_101600363 109
136 3300013105 Ga0157369_10310574 Ga0157369_103105741 109
137 3300013105 Ga0157369_10457546 Ga0157369_104575463 109
138 3300013306 Ga0163162_10795809 Ga0163162_107958092 109
139 3300013307 Ga0157372_12572625 Ga0157372_125726252 109
140 3300017792 Ga0163161_10001715 Ga0163161_1000171512 109
141 3300017792 Ga0163161_10003363 Ga0163161_100033633 109
142 3300025245 Ga0207425_1000022 Ga0207425_100002225 109
143 3300025258 Ga0209129_1001190 Ga0209129_100119015 109
144 3300025263 Ga0209565_1013741 Ga0209565_10137412 109
145 3300025292 Ga0209676_1000060 Ga0209676_1000060221 109
146 3300025292 Ga0209676_1001039 Ga0209676_100103929 109
147 3300025292 Ga0209676_1006830 Ga0209676_10068301 109
148 3300025292 Ga0209676_1069617 Ga0209676_10696171 109
149 3300025294 Ga0209025_1000326 Ga0209025_100032628 109
150 3300025294 Ga0209025_1039447 Ga0209025_10394472 109
151 3300025295 Ga0209564_1004449 Ga0209564_10044499 109
152 3300025297 Ga0209758_1000004 Ga0209758_1000004652 109
153 3300025298 Ga0209050_1000001 Ga0209050_10000012617 109
154 3300025298 Ga0209050_1000402 Ga0209050_100040268 109
155 3300025298 Ga0209050_1000622 Ga0209050_100062245 109
156 3300025298 Ga0209050_1003107 Ga0209050_10031071 109
157 3300025298 Ga0209050_1014204 Ga0209050_10142045 109
158 3300025298 Ga0209050_1023582 Ga0209050_10235821 109
159 3300025303 Ga0209051_1000303 Ga0209051_10003034 109
160 3300025303 Ga0209051_1000563 Ga0209051_100056334 109
161 3300025304 Ga0209257_1001450 Ga0209257_100145011 109
162 3300025304 Ga0209257_1001686 Ga0209257_10016866 109
163 3300025304 Ga0209257_1002690 Ga0209257_10026906 109
164 3300025304 Ga0209257_1003007 Ga0209257_10030071 109
165 3300025321 Ga0207656_10190513 Ga0207656_101905132 109
166 3300025735 Ga0207713_1025698 Ga0207713_10256983 109
167 3300025735 Ga0207713_1137129 Ga0207713_11371291 109
168 3300025900 Ga0207710_10084952 Ga0207710_100849522 109
169 3300025904 Ga0207647_10159287 Ga0207647_101592872 109
170 3300025909 Ga0207705_10450480 Ga0207705_104504803 109
171 3300025911 Ga0207654_10024820 Ga0207654_100248205 109
172 3300025913 Ga0207695_10008826 Ga0207695_1000882614 109
173 3300025913 Ga0207695_10009471 Ga0207695_1000947110 109
174 3300025913 Ga0207695_10067731 Ga0207695_100677314 109
175 3300025913 Ga0207695_10286956 Ga0207695_102869561 109
176 3300025913 Ga0207695_11561979 Ga0207695_115619791 109
177 3300025914 Ga0207671_10001440 Ga0207671_1000144017 109
178 3300025914 Ga0207671_10002051 Ga0207671_1000205117 109
179 3300025914 Ga0207671_10016082 Ga0207671_100160826 109
180 3300025914 Ga0207671_10088631 Ga0207671_100886313 109
181 3300025919 Ga0207657_10013883 Ga0207657_100138834 109
182 3300025920 Ga0207649_11545813 Ga0207649_115458131 109
183 3300025923 Ga0207681_10090203 Ga0207681_100902033 109
184 3300025923 Ga0207681_10279363 Ga0207681_102793633 109
185 3300025923 Ga0207681_10758044 Ga0207681_107580442 109
186 3300025924 Ga0207694_10410294 Ga0207694_104102943 109
187 3300025924 Ga0207694_10572477 Ga0207694_105724772 109
188 3300025924 Ga0207694_10786960 Ga0207694_107869601 109
189 3300025924 Ga0207694_10808018 Ga0207694_108080181 109
190 3300025925 Ga0207650_10030802 Ga0207650_100308025 109
191 3300025931 Ga0207644_10001372 Ga0207644_1000137211 109
192 3300025931 Ga0207644_11077400 Ga0207644_110774002 109
193 3300025932 Ga0207690_10351106 Ga0207690_103511062 109
194 3300025941 Ga0207711_10053217 Ga0207711_100532175 109
195 3300025944 Ga0207661_10287959 Ga0207661_102879591 109
196 3300025945 Ga0207679_10671957 Ga0207679_106719572 109
197 3300025949 Ga0207667_10011452 Ga0207667_100114524 109
198 3300025949 Ga0207667_10170231 Ga0207667_101702313 109
199 3300025949 Ga0207667_10230791 Ga0207667_102307912 109
200 3300025961 Ga0207712_10004353 Ga0207712_100043537 109
201 3300025961 Ga0207712_10250531 Ga0207712_102505311 109
202 3300025972 Ga0207668_10000031 Ga0207668_1000003146 109
203 3300025972 Ga0207668_10003517 Ga0207668_100035173 109
204 3300025981 Ga0207640_10013814 Ga0207640_100138142 109
205 3300025981 Ga0207640_10088005 Ga0207640_100880053 109
206 3300025981 Ga0207640_10127863 Ga0207640_101278633 109
207 3300025981 Ga0207640_10281137 Ga0207640_102811373 109
208 3300025981 Ga0207640_10358305 Ga0207640_103583053 109
209 3300025986 Ga0207658_10000009 Ga0207658_1000000993 109
210 3300026035 Ga0207703_10003045 Ga0207703_1000304517 109
211 3300026041 Ga0207639_10002138 Ga0207639_100021388 109
212 3300026067 Ga0207678_10002748 Ga0207678_100027487 109
213 3300026078 Ga0207702_10005233 Ga0207702_100052336 109
214 3300026078 Ga0207702_10136396 Ga0207702_101363965 109
215 3300026088 Ga0207641_10012950 Ga0207641_100129509 109
216 3300026095 Ga0207676_10009379 Ga0207676_100093792 109
217 3300026116 Ga0207674_10704090 Ga0207674_107040902 109
218 3300026116 Ga0207674_11469751 Ga0207674_114697512 109
219 3300026118 Ga0207675_100049339 Ga0207675_1000493397 109
220 3300026142 Ga0207698_10042301 Ga0207698_100423015 109
221 3300027866 Ga0209813_10000038 Ga0209813_1000003844 109
222 3300027866 Ga0209813_10000092 Ga0209813_100000929 109
223 3300027866 Ga0209813_10028078 Ga0209813_100280783 109
224 3300027876 Ga0209974_10022532 Ga0209974_100225322 109
225 3300028379 Ga0268266_10030166 Ga0268266_100301665 109
226 3300028379 Ga0268266_10875651 Ga0268266_108756512 109
227 3300028379 Ga0268266_11776744 Ga0268266_117767441 109
228 3300028380 Ga0268265_10000118 Ga0268265_1000011830 109
229 3300028380 Ga0268265_10012328 Ga0268265_100123284 109
230 3300028381 Ga0268264_10000001 Ga0268264_1000000193 109
231 3300031548 Ga0307408_100002886 Ga0307408_10000288617 109
232 3300031548 Ga0307408_100997793 Ga0307408_1009977931 109
233 3300031548 Ga0307408_101945399 Ga0307408_1019453991 109
234 3300031548 Ga0307408_102428593 Ga0307408_1024285931 109
235 3300031731 Ga0307405_10013872 Ga0307405_100138725 109
236 3300031824 Ga0307413_11070526 Ga0307413_110705262 109
237 3300031852 Ga0307410_10354365 Ga0307410_103543651 109
238 3300031901 Ga0307406_10232520 Ga0307406_102325202 109
239 3300031901 Ga0307406_10520326 Ga0307406_105203263 109
240 3300031901 Ga0307406_11204644 Ga0307406_112046441 109
241 3300031901 Ga0307406_12058314 Ga0307406_120583142 109
242 3300031911 Ga0307412_10000305 Ga0307412_1000030520 109
243 3300031911 Ga0307412_10002329 Ga0307412_100023293 109
244 3300031911 Ga0307412_10022479 Ga0307412_100224794 109
245 3300031911 Ga0307412_10039705 Ga0307412_100397054 109
246 3300031911 Ga0307412_10164072 Ga0307412_101640722 109
247 3300031911 Ga0307412_10219197 Ga0307412_102191972 109
248 3300031911 Ga0307412_11654157 Ga0307412_116541571 109
249 3300031995 Ga0307409_100466240 Ga0307409_1004662403 109
250 3300032002 Ga0307416_100548068 Ga0307416_1005480683 109
251 3300032004 Ga0307414_10010641 Ga0307414_100106416 109
252 3300032004 Ga0307414_10055254 Ga0307414_100552543 109
253 3300032004 Ga0307414_10109018 Ga0307414_101090183 109
254 3300032004 Ga0307414_10174810 Ga0307414_101748101 109
255 3300032004 Ga0307414_10207459 Ga0307414_102074592 109
256 3300032004 Ga0307414_10481614 Ga0307414_104816143 109
257 3300032004 Ga0307414_10620520 Ga0307414_106205202 109
258 3300032005 Ga0307411_10199934 Ga0307411_101999342 109
259 3300039437 Ga0436365_0654829 Ga0436365_0654829_2450_2779 109
260 3300041452 Ga0451793_1470661 Ga0451793_1470661_453_824 109
261 3300041460 Ga0451802_1259460 Ga0451802_1259460_898_1269 109
262 3300041462 Ga0451806_262030 Ga0451806_262030_1231_1602 109
263 3300041501 Ga0451845_0778869 Ga0451845_0778869_1061_1432 109
264 3300041512 Ga0451853_0292376 Ga0451853_0292376_88_459 109
265 3300041512 Ga0451853_2575038 Ga0451853_2575038_296_625 109
266 3300046453 Ga0495627_000103 Ga0495627_000103_21042_21371 109
267 3300046453 Ga0495627_000105 Ga0495627_000105_28565_28894 109
268 3300046460 Ga0495638_0000021 Ga0495638_0000021_5405_5734 109
269 3300046471 Ga0495650_0001034 Ga0495650_0001034_11923_12252 109
270 3300046471 Ga0495650_0005530 Ga0495650_0005530_5353_5682 109
271 3300046500 Ga0495596_0000171 Ga0495596_0000171_4252_4581 109
272 3300046500 Ga0495596_0001194 Ga0495596_0001194_10776_11108 109
273 3300046501 Ga0495607_0318693 Ga0495607_0318693_228_557 109
274 3300046506 Ga0495583_0000184 Ga0495583_0000184_44125_44454 109
275 3300046506 Ga0495583_0028558 Ga0495583_0028558_1090_1419 109
276 3300046506 Ga0495583_0142949 Ga0495583_0142949_213_542 109
277 3300046507 Ga0495606_0008550 Ga0495606_0008550_1659_1988 109
278 3300046512 Ga0495610_0000013 Ga0495610_0000013_32121_32450 109
279 3300046512 Ga0495610_0000018 Ga0495610_0000018_263189_263518 109
280 3300046512 Ga0495610_0372144 Ga0495610_0372144_108_437 109
281 3300046513 Ga0495616_0134727 Ga0495616_0134727_711_1040 109
282 3300046515 Ga0495620_0017002 Ga0495620_0017002_1117_1446 109
283 3300046515 Ga0495620_0026371 Ga0495620_0026371_1045_1374 109
284 3300046519 Ga0495632_0001694 Ga0495632_0001694_5407_5736 109
285 3300046519 Ga0495632_0106903 Ga0495632_0106903_526_855 109
286 3300046522 Ga0495643_0046215 Ga0495643_0046215_1769_2098 109
287 3300046524 Ga0495648_0000026 Ga0495648_0000026_5377_5706 109
288 3300046524 Ga0495648_0024447 Ga0495648_0024447_1767_2096 109
289 3300046524 Ga0495648_0024752 Ga0495648_0024752_3251_3580 109
290 3300046524 Ga0495648_0043489 Ga0495648_0043489_409_738 109
291 3300046530 Ga0495654_0069429 Ga0495654_0069429_780_1109 109
292 3300046538 Ga0495609_0073544 Ga0495609_0073544_403_732 109
293 3300046558 Ga0495633_0018078 Ga0495633_0018078_1089_1418 109
294 3300046616 Ga0495668_0000002 Ga0495668_0000002_229778_230107 109
295 3300046660 Ga0495625_0002714 Ga0495625_0002714_16669_16998 109
296 3300046692 Ga0495671_0000050 Ga0495671_0000050_136267_136596 109
297 3300046692 Ga0495671_0610583 Ga0495671_0610583_150_479 109
298 3300047469 Ga0495673_0000125 Ga0495673_0000125_5342_5671 109
299 3300047469 Ga0495673_0020024 Ga0495673_0020024_2778_3107 109
300 3300047469 Ga0495673_0037798 Ga0495673_0037798_1111_1440 109
301 3300047470 Ga0495681_0000174 Ga0495681_0000174_4708_5037 109
302 3300047470 Ga0495681_0005853 Ga0495681_0005853_5353_5682 109
303 3300047470 Ga0495681_0164762 Ga0495681_0164762_56_385 109
304 3300047472 Ga0495686_0000057 Ga0495686_0000057_72169_72498 109
305 3300047472 Ga0495686_0003856 Ga0495686_0003856_2677_3006 109
306 3300047472 Ga0495686_0538200 Ga0495686_0538200_188_517 109
307 3300048090 Ga0495615_0000009 Ga0495615_0000009_26018_26347 109
308 3300048090 Ga0495615_0000022 Ga0495615_0000022_33559_33888 109
309 3300048903 Ga0496100_1374000 Ga0496100_1374000_161_493 109
310 3300048903 Ga0496100_1517190 Ga0496100_1517190_74_403 109
311 3300048904 Ga0496101_0088840 Ga0496101_0088840_1931_2260 109
312 3300048904 Ga0496101_0211175 Ga0496101_0211175_265_597 109
313 3300048905 Ga0496102_0201706 Ga0496102_0201706_1411_1743 109
314 3300048906 Ga0496103_1008501 Ga0496103_1008501_16_345 109
315 3300048907 Ga0496104_0176792 Ga0496104_0176792_661_990 109
316 3300048911 Ga0496108_0019420 Ga0496108_0019420_3585_3914 109
317 3300048913 Ga0496110_0178598 Ga0496110_0178598_955_1284 109
318 3300048916 Ga0496113_0304735 Ga0496113_0304735_403_732 109
319 3300048920 Ga0496117_0021146 Ga0496117_0021146_1986_2318 109
320 3300048920 Ga0496117_0023876 Ga0496117_0023876_1409_1741 109
321 3300048920 Ga0496117_0115352 Ga0496117_0115352_814_1143 109
322 3300048921 Ga0496118_0001437 Ga0496118_0001437_28438_28770 109
323 3300048921 Ga0496118_0011607 Ga0496118_0011607_2224_2553 109
324 3300048921 Ga0496118_0070020 Ga0496118_0070020_722_1051 109
325 3300048921 Ga0496118_0198027 Ga0496118_0198027_336_668 109
326 3300048921 Ga0496118_0511087 Ga0496118_0511087_194_523 109
327 3300048922 Ga0496119_0074941 Ga0496119_0074941_76_408 109
328 3300048923 Ga0496120_0031380 Ga0496120_0031380_2077_2406 109
329 3300048923 Ga0496120_0048673 Ga0496120_0048673_55_387 109
330 3300048924 Ga0496121_0000079 Ga0496121_0000079_53503_53835 109
331 3300048924 Ga0496121_0000190 Ga0496121_0000190_74895_75224 109
332 3300048924 Ga0496121_0000721 Ga0496121_0000721_29863_30195 109
333 3300048924 Ga0496121_0002392 Ga0496121_0002392_15902_16231 109
334 3300048924 Ga0496121_0003974 Ga0496121_0003974_16319_16648 109
335 3300048924 Ga0496121_0138853 Ga0496121_0138853_116_445 109
336 3300048924 Ga0496121_0847207 Ga0496121_0847207_151_480 109
337 3300048925 Ga0496122_0001343 Ga0496122_0001343_16106_16435 109
338 3300048925 Ga0496122_0004042 Ga0496122_0004042_14764_15093 109
339 3300048925 Ga0496122_0008010 Ga0496122_0008010_5132_5461 109
340 3300048925 Ga0496122_0074625 Ga0496122_0074625_843_1172 109
341 3300048925 Ga0496122_0286099 Ga0496122_0286099_147_479 109
342 3300048926 Ga0496123_0000300 Ga0496123_0000300_33963_34292 109
343 3300048926 Ga0496123_0002078 Ga0496123_0002078_20431_20760 109
344 3300048926 Ga0496123_0017198 Ga0496123_0017198_1115_1444 109
345 3300048926 Ga0496123_0019407 Ga0496123_0019407_2841_3170 109
346 3300048926 Ga0496123_0097570 Ga0496123_0097570_1155_1484 109
347 3300048927 Ga0496124_0000328 Ga0496124_0000328_16959_17288 109
348 3300048927 Ga0496124_0003193 Ga0496124_0003193_13867_14196 109
349 3300048927 Ga0496124_0019730 Ga0496124_0019730_238_567 109
350 3300048927 Ga0496124_0030437 Ga0496124_0030437_2655_2984 109
351 3300048927 Ga0496124_0061695 Ga0496124_0061695_169_498 109
352 3300048927 Ga0496124_0070939 Ga0496124_0070939_1106_1435 109
353 3300048927 Ga0496124_0088942 Ga0496124_0088942_1788_2117 109
354 3300048927 Ga0496124_0940798 Ga0496124_0940798_108_437 109
355 3300048928 Ga0496125_0051091 Ga0496125_0051091_2754_3083 109
356 3300048928 Ga0496125_0083632 Ga0496125_0083632_936_1265 109
357 3300048928 Ga0496125_0133528 Ga0496125_0133528_1338_1667 109
358 3300048928 Ga0496125_0270470 Ga0496125_0270470_55_384 109
359 3300048928 Ga0496125_0398226 Ga0496125_0398226_195_524 109
360 3300048928 Ga0496125_0477750 Ga0496125_0477750_189_518 109
361 3300048929 Ga0496126_0011320 Ga0496126_0011320_3003_3335 109
362 3300048929 Ga0496126_0013167 Ga0496126_0013167_6705_7034 109
363 3300048929 Ga0496126_0027270 Ga0496126_0027270_4465_4794 109
364 3300048929 Ga0496126_0111630 Ga0496126_0111630_1021_1350 109
365 3300048929 Ga0496126_0178999 Ga0496126_0178999_303_632 109
366 3300048929 Ga0496126_0437070 Ga0496126_0437070_440_769 109
367 3300048929 Ga0496126_0695283 Ga0496126_0695283_167_496 109
368 3300048929 Ga0496126_0793587 Ga0496126_0793587_386_715 109
369 3300048929 Ga0496126_0932664 Ga0496126_0932664_226_555 109
370 3300049460 Ga0495682_0051598 Ga0495682_0051598_27_356 109
371 3300049521 Ga0501298_158986 Ga0501298_158986_77_406 109
372 3300049523 Ga0501300_003933 Ga0501300_003933_1318_1647 109
373 3300049523 Ga0501300_017021 Ga0501300_017021_251_580 109
374 3300049554 Ga0501338_09560 Ga0501338_09560_206_535 109
375 3300049569 Ga0501032_0027261 Ga0501032_0027261_1297_1626 109
376 3300049570 Ga0501033_0005862 Ga0501033_0005862_8314_8643 109
377 3300049570 Ga0501033_0176014 Ga0501033_0176014_468_797 109
378 3300049572 Ga0501036_0168045 Ga0501036_0168045_431_760 109
379 3300049573 Ga0501037_0351344 Ga0501037_0351344_438_767 109
380 3300049574 Ga0501038_0461500 Ga0501038_0461500_438_767 109
381 3300049579 Ga0501043_0156558 Ga0501043_0156558_166_495 109
382 3300049579 Ga0501043_0184813 Ga0501043_0184813_907_1236 109
383 3300049581 Ga0501047_0372329 Ga0501047_0372329_627_956 109
384 3300049581 Ga0501047_0801139 Ga0501047_0801139_42_371 109
385 3300049679 Ga0501249_000267 Ga0501249_000267_4837_5166 109
386 3300049688 Ga0501259_098608 Ga0501259_098608_269_598 109
387 3300049758 Ga0501241_009022 Ga0501241_009022_401_730 109
388 3300049775 Ga0501279_030456 Ga0501279_030456_10_339 109
389 3300049775 Ga0501279_049162 Ga0501279_049162_151_480 109
390 3300049778 Ga0501282_009352 Ga0501282_009352_310_639 109
391 3300049778 Ga0501282_035950 Ga0501282_035950_212_541 109
392 3300049822 Ga0501035_0004268 Ga0501035_0004268_6979_7308 109
393 3300049822 Ga0501035_0376696 Ga0501035_0376696_801_1130 109
394 3300049823 Ga0501044_0000109 Ga0501044_0000109_46268_46597 109
395 3300049823 Ga0501044_0149971 Ga0501044_0149971_1453_1782 109
396 3300049823 Ga0501044_0718879 Ga0501044_0718879_438_767 109
397 3300049850 Ga0501204_002562 Ga0501204_002562_30_359 109
398 3300050490 nmdc:mga03n38_11652_c1 nmdc:mga03n38_11652_c1_526_855 109
399 3300050491 nmdc:mga00v17_34494_c1 nmdc:mga00v17_34494_c1_1717_2046 109
400 3300050493 nmdc:mga0k408_195626_c1 nmdc:mga0k408_195626_c1_28_357 109
401 3300050493 nmdc:mga0k408_296070_c1 nmdc:mga0k408_296070_c1_356_685 109
402 3300050494 nmdc:mga06z11_266573_c1 nmdc:mga06z11_266573_c1_39_368 109
403 3300050494 nmdc:mga06z11_41_c1 nmdc:mga06z11_41_c1_42912_43241 109
404 3300050494 nmdc:mga06z11_48_c1 nmdc:mga06z11_48_c1_47353_47682 109
405 3300050494 nmdc:mga06z11_781843_c1 nmdc:mga06z11_781843_c1_63_392 109
406 3300050495 nmdc:mga04h51_126080_c1 nmdc:mga04h51_126080_c1_282_611 109
407 3300050495 nmdc:mga04h51_27_c1 nmdc:mga04h51_27_c1_9876_10205 109
408 3300050495 nmdc:mga04h51_57_c1 nmdc:mga04h51_57_c1_28363_28692 109
409 3300050496 nmdc:mga07m45_2787_c1 nmdc:mga07m45_2787_c1_3917_4246 109
410 3300050496 nmdc:mga07m45_4447_c1 nmdc:mga07m45_4447_c1_1482_1811 109
411 3300050496 nmdc:mga07m45_877884_c1 nmdc:mga07m45_877884_c1_168_497 109
412 3300053087 Ga0500643_000172 Ga0500643_000172_7998_8330 109
413 3300053088 Ga0500644_0085031 Ga0500644_0085031_453_782 109
414 3300053116 Ga0500592_003422 Ga0500592_003422_1327_1656 109
415 3300053121 Ga0500607_000077 Ga0500607_000077_44563_44892 109
416 3300053121 Ga0500607_000293 Ga0500607_000293_30243_30572 109
417 3300053134 Ga0500658_0202066 Ga0500658_0202066_30_359 109
418 3300053142 Ga0500577_0182264 Ga0500577_0182264_57_386 109
419 3300053151 Ga0500604_0044613 Ga0500604_0044613_217_546 109
420 3300053151 Ga0500604_0148010 Ga0500604_0148010_416_745 109
421 3300053157 Ga0500624_000961 Ga0500624_000961_436_765 109
422 3300053158 Ga0500627_0000020 Ga0500627_0000020_104687_105016 109
423 3300053161 Ga0500634_0106700 Ga0500634_0106700_166_495 109
424 3300053730 Ga0500645_028765 Ga0500645_028765_342_671 109
425 3300055283 Ga0500661_000033 Ga0500661_000033_9472_9804 109

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9543 1 87
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9258 18 75
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9138 1 87
3f6o-assembly1.cif.gz_B crystal structure of arsr family transcriptional regulator, rha00566 0.9112 5 89
6j05-assembly1.cif.gz_A structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.9067 1 95
ID Description Score Start End Superfamily
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9527 18 74 1.10.10.10
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9457 17 75 1.10.10.10
af_P91529_82_146_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9435 15 75 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9428 15 75 1.10.10.10
af_B4FTK6_47_112_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9412 18 75 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Q3AQJ9-F1-model_v4 ArsR family transcriptional regulator 0.9985 1 84 GO:0003700
AF-A0A651FWF4-F1-model_v4 MarR family transcriptional regulator 0.99 1 90 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A212JDE4-F1-model_v4 Transcriptional regulator, ArsR family, putative (Modular protein) 0.9871 2 87 GO:0003700
AF-A0A529P702-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9862 1 91 GO:0003700
AF-A0A1Q3VCT5-F1-model_v4 HTH arsR-type domain-containing protein 0.985 2 89 GO:0003700

Feature Viewer

pLDDT pTM Quality
92.51 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map