F441018

General Info

Members Datasets Scaffolds Average Seq Length
425 174 850 149

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0045400|Ga0466969_0045400_700_1224
Length 174
Sequence VVFGSFRSHRNFGFVYNPHREIRLMKNPFTRRSLLALAAAVFTVASYAQWANPAEDVPAYHPAAPLKVSALPSIISGDKLTGENFRYAWQVHVYQQAAKVGNVIYQLPCNCRCDRALGHTSLRSCFETLHGTECSTCAKEGFYAYQQTKLGKTPAEIRAGIAKHDYESIDLEKQ

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
76 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
127 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
151 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
170 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.29
Metatranscriptomes 4.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 1.65
Rhizosphere 97.41
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0045400 3300044656 Bacteria 2182
2 rootH2_10037976 3300003320 Bacteria 6915
3 rootL2_10101055 3300003322 Bacteria 7167
4 rootH1_10319483 3300003323 Unclassified 1406
5 Ga0070658_10023901 3300005327 Bacteria 4902
6 Ga0070658_10132880 3300005327 Bacteria 2075
7 Ga0070658_10239424 3300005327 Bacteria 1538
8 Ga0070676_10092380 3300005328 Bacteria 1856
9 Ga0070683_100030597 3300005329 Bacteria 4889
10 Ga0070683_100156164 3300005329 Bacteria 2164
11 Ga0070683_100169552 3300005329 Bacteria 2072
12 Ga0070683_100565385 3300005329 Bacteria 1087
13 Ga0070683_100567363 3300005329 Bacteria 1085
14 Ga0070666_10114295 3300005335 Bacteria 1869
15 Ga0070680_100050432 3300005336 Bacteria 3395
16 Ga0070680_100095147 3300005336 Bacteria 2469
17 Ga0070680_100492776 3300005336 Bacteria 1048
18 Ga0070682_100124905 3300005337 Bacteria 1733
19 Ga0070682_100328655 3300005337 Bacteria 1132
20 Ga0070682_100708424 3300005337 Unclassified 808
21 Ga0068868_100066967 3300005338 Bacteria 2857
22 Ga0068868_100454360 3300005338 Bacteria 1115
23 Ga0070660_100005537 3300005339 Bacteria 8748
24 Ga0070661_100075316 3300005344 Bacteria 2486
25 Ga0070661_100132273 3300005344 Bacteria 1875
26 Ga0070661_100510172 3300005344 Unclassified 963
27 Ga0070692_10477431 3300005345 Bacteria 803
28 Ga0070675_100051677 3300005354 Bacteria 3377
29 Ga0070671_100186383 3300005355 Bacteria 1758
30 Ga0070671_100249376 3300005355 Bacteria 1508
31 Ga0070688_100164606 3300005365 Bacteria 1526
32 Ga0070659_101342310 3300005366 Unclassified 635
33 Ga0070714_101276883 3300005435 Bacteria 717
34 Ga0070713_100121500 3300005436 Bacteria 2292
35 Ga0070713_100195389 3300005436 Bacteria 1825
36 Ga0070713_100652062 3300005436 Bacteria 1003
37 Ga0070711_100552037 3300005439 Bacteria 956
38 Ga0070663_100418431 3300005455 Bacteria 1099
39 Ga0070678_100498009 3300005456 Bacteria 1074
40 Ga0070662_100096546 3300005457 Bacteria 2229
41 Ga0070681_10017164 3300005458 Bacteria 7238
42 Ga0070681_10244500 3300005458 Bacteria 1707
43 Ga0070681_10817739 3300005458 Bacteria 849
44 Ga0068867_101188953 3300005459 Unclassified 700
45 Ga0070679_100003731 3300005530 Bacteria 13961
46 Ga0070679_100038949 3300005530 Bacteria 4726
47 Ga0070684_100029339 3300005535 Bacteria 4661
48 Ga0070684_100043095 3300005535 Bacteria 3896
49 Ga0070684_100097774 3300005535 Bacteria 2618
50 Ga0070684_100142982 3300005535 Bacteria 2164
51 Ga0068853_100000152 3300005539 Bacteria 47430
52 Ga0068853_100055600 3300005539 Unclassified 3412
53 Ga0068853_100131412 3300005539 Bacteria 2241
54 Ga0068853_100138588 3300005539 Bacteria 2183
55 Ga0070672_100187970 3300005543 Bacteria 1723
56 Ga0070665_100001717 3300005548 Bacteria 25110
57 Ga0070665_100124666 3300005548 Bacteria 2578
58 Ga0070665_100443418 3300005548 Bacteria 1307
59 Ga0070665_100478531 3300005548 Bacteria 1256
60 Ga0068855_100020423 3300005563 Bacteria 7943
61 Ga0068855_100181766 3300005563 Bacteria 2377
62 Ga0068855_100393998 3300005563 Bacteria 1519
63 Ga0068855_100870470 3300005563 Bacteria 953
64 Ga0068855_101617012 3300005563 Unclassified 663
65 Ga0070664_100217474 3300005564 Bacteria 1709
66 Ga0070664_100503154 3300005564 Bacteria 1117
67 Ga0068857_100000598 3300005577 Bacteria 26483
68 Ga0068857_100179525 3300005577 Bacteria 1926
69 Ga0068857_100270480 3300005577 Bacteria 1561
70 Ga0068857_101897101 3300005577 Unclassified 584
71 Ga0068854_100032789 3300005578 Bacteria 3616
72 Ga0068856_100012479 3300005614 Bacteria 8224
73 Ga0068856_100030885 3300005614 Bacteria 5239
74 Ga0068856_100103256 3300005614 Bacteria 2844
75 Ga0068856_100246000 3300005614 Bacteria 1804
76 Ga0068856_100477312 3300005614 Bacteria 1268
77 Ga0068856_101148732 3300005614 Bacteria 793
78 Ga0068852_100000028 3300005616 Bacteria 113383
79 Ga0068852_100000191 3300005616 Bacteria 41609
80 Ga0068852_100008441 3300005616 Bacteria 7592
81 Ga0068852_100014864 3300005616 Bacteria 6015
82 Ga0068852_100055357 3300005616 Bacteria 3423
83 Ga0068852_100132923 3300005616 Bacteria 2294
84 Ga0068852_100558684 3300005616 Bacteria 1145
85 Ga0068852_100707956 3300005616 Bacteria 1017
86 Ga0068852_101233129 3300005616 Unclassified 769
87 Ga0068859_100263825 3300005617 Bacteria 1814
88 Ga0068859_100415197 3300005617 Bacteria 1442
89 Ga0068864_100541031 3300005618 Bacteria 1125
90 Ga0068851_10007785 3300005834 Bacteria 4929
91 Ga0068851_10136928 3300005834 Bacteria 1328
92 Ga0068851_10471390 3300005834 Bacteria 749
93 Ga0068863_100241406 3300005841 Bacteria 1744
94 Ga0068860_100461492 3300005843 Bacteria 1264
95 Ga0070712_100941071 3300006175 Bacteria 746
96 Ga0097621_101072175 3300006237 Bacteria 755
97 Ga0068871_100096386 3300006358 Bacteria 2471
98 Ga0068871_100287683 3300006358 Bacteria 1439
99 Ga0068871_100303349 3300006358 Bacteria 1402
100 Ga0068865_100109117 3300006881 Bacteria 2038
101 Ga0097620_100263813 3300006931 Bacteria 1814
102 Ga0097620_100415189 3300006931 Bacteria 1442
103 Ga0105240_10000796 3300009093 Bacteria 57123
104 Ga0105240_10001270 3300009093 Bacteria 43667
105 Ga0105240_10002000 3300009093 Bacteria 33627
106 Ga0105240_10005920 3300009093 Bacteria 18110
107 Ga0105240_10011336 3300009093 Bacteria 12420
108 Ga0105240_10012076 3300009093 Bacteria 11967
109 Ga0105240_10037469 3300009093 Bacteria 6232
110 Ga0105240_10069273 3300009093 Unclassified 4367
111 Ga0105240_10303349 3300009093 Bacteria 1826
112 Ga0105240_10531488 3300009093 Bacteria 1304
113 Ga0105240_10981476 3300009093 Bacteria 904
114 Ga0105240_12098231 3300009093 Bacteria 587
115 Ga0105245_10025273 3300009098 Bacteria 5222
116 Ga0105245_10040010 3300009098 Bacteria 4174
117 Ga0105245_10169759 3300009098 Bacteria 2077
118 Ga0105247_10057596 3300009101 Bacteria 2403
119 Ga0105241_10001746 3300009174 Bacteria 16499
120 Ga0105241_10028210 3300009174 Bacteria 4182
121 Ga0105241_10081789 3300009174 Unclassified 2531
122 Ga0105241_10669193 3300009174 Unclassified 945
123 Ga0105242_10364944 3300009176 Bacteria 1337
124 Ga0105248_10000087 3300009177 Bacteria 104316
125 Ga0105248_10003746 3300009177 Bacteria 16866
126 Ga0105248_10419775 3300009177 Bacteria 1507
127 Ga0105248_11366691 3300009177 Bacteria 801
128 Ga0105248_12748111 3300009177 Unclassified 561
129 Ga0105237_10002782 3300009545 Bacteria 21249
130 Ga0105237_10121828 3300009545 Bacteria 2603
131 Ga0105237_10169634 3300009545 Bacteria 2182
132 Ga0105237_10195451 3300009545 Bacteria 2023
133 Ga0105237_10330670 3300009545 Bacteria 1528
134 Ga0105237_10748802 3300009545 Bacteria 983
135 Ga0105238_10001164 3300009551 Bacteria 26499
136 Ga0105238_10003709 3300009551 Bacteria 15198
137 Ga0105238_10017759 3300009551 Bacteria 7233
138 Ga0105238_10049639 3300009551 Bacteria 4225
139 Ga0105238_10303612 3300009551 Bacteria 1580
140 Ga0105249_10571329 3300009553 Bacteria 1183
141 Ga0105239_10028613 3300010375 Bacteria 6127
142 Ga0105239_10114528 3300010375 Bacteria 2991
143 Ga0105239_10145384 3300010375 Bacteria 2644
144 Ga0105239_10148844 3300010375 Bacteria 2612
145 Ga0105239_10183269 3300010375 Bacteria 2343
146 Ga0105239_10668379 3300010375 Bacteria 1187
147 Ga0105246_10117329 3300011119 Bacteria 1966
148 Ga0157373_10051569 3300013100 Bacteria 2930
149 Ga0157371_10008689 3300013102 Bacteria 8066
150 Ga0157371_10618847 3300013102 Bacteria 806
151 Ga0157370_10000003 3300013104 Bacteria 367417
152 Ga0157370_10001456 3300013104 Bacteria 29303
153 Ga0157370_11089645 3300013104 Bacteria 722
154 Ga0157369_10000535 3300013105 Bacteria 50270
155 Ga0157369_10000767 3300013105 Bacteria 41495
156 Ga0157369_10000949 3300013105 Bacteria 36829
157 Ga0157369_10005570 3300013105 Bacteria 14620
158 Ga0157369_10012347 3300013105 Bacteria 9698
159 Ga0157369_10039251 3300013105 Bacteria 5175
160 Ga0157369_10039984 3300013105 Bacteria 5122
161 Ga0157369_10098966 3300013105 Bacteria 3109
162 Ga0157369_10256995 3300013105 Bacteria 1822
163 Ga0157369_10283604 3300013105 Bacteria 1725
164 Ga0157369_10316282 3300013105 Bacteria 1623
165 Ga0157369_10510063 3300013105 Bacteria 1244
166 Ga0157369_10827012 3300013105 Bacteria 951
167 Ga0157374_10001030 3300013296 Bacteria 24197
168 Ga0157374_10001291 3300013296 Bacteria 21298
169 Ga0157374_10036718 3300013296 Bacteria 4491
170 Ga0157374_10071948 3300013296 Bacteria 3262
171 Ga0157374_10232522 3300013296 Bacteria 1811
172 Ga0157374_10404170 3300013296 Unclassified 1363
173 Ga0157374_10429809 3300013296 Unclassified 1320
174 Ga0157378_10013801 3300013297 Bacteria 7064
175 Ga0157378_10016443 3300013297 Bacteria 6479
176 Ga0157378_10353648 3300013297 Bacteria 1436
177 Ga0157378_11392997 3300013297 Bacteria 744
178 Ga0157378_11415706 3300013297 Unclassified 738
179 Ga0163162_10303064 3300013306 Bacteria 1730
180 Ga0163162_10579546 3300013306 Bacteria 1249
181 Ga0163162_11021872 3300013306 Bacteria 935
182 Ga0157372_10000489 3300013307 Bacteria 43671
183 Ga0157372_10005985 3300013307 Bacteria 12924
184 Ga0157372_10020294 3300013307 Bacteria 7167
185 Ga0157372_10174501 3300013307 Bacteria 2488
186 Ga0157372_10176376 3300013307 Bacteria 2474
187 Ga0157372_10201011 3300013307 Bacteria 2308
188 Ga0157372_10268191 3300013307 Bacteria 1983
189 Ga0157375_10043757 3300013308 Bacteria 4345
190 Ga0157375_10542101 3300013308 Bacteria 1326
191 Ga0157375_11392551 3300013308 Bacteria 826
192 Ga0163163_10396919 3300014325 Bacteria 1437
193 Ga0163163_10479883 3300014325 Bacteria 1304
194 Ga0157377_10408255 3300014745 Bacteria 927
195 Ga0157377_10702418 3300014745 Unclassified 734
196 Ga0157379_10052622 3300014968 Bacteria 3637
197 Ga0157379_10081449 3300014968 Bacteria 2900
198 Ga0157379_10124778 3300014968 Bacteria 2317
199 Ga0157376_10159141 3300014969 Bacteria 2045
200 Ga0157376_10169594 3300014969 Bacteria 1986
201 Ga0157376_12393385 3300014969 Bacteria 568
202 Ga0163161_10242462 3300017792 Bacteria 1402
203 Ga0197907_11094781 3300020069 Bacteria 1710
204 Ga0206349_1098283 3300020075 Bacteria 696
205 Ga0206349_1897553 3300020075 Bacteria 747
206 Ga0206355_1677729 3300020076 Bacteria 1843
207 Ga0206355_1697551 3300020076 Bacteria 1188
208 Ga0206351_10447372 3300020077 Bacteria 868
209 Ga0206352_10144497 3300020078 Bacteria 1826
210 Ga0206352_10447216 3300020078 Bacteria 660
211 Ga0206350_10253880 3300020080 Bacteria 1237
212 Ga0206350_11444285 3300020080 Bacteria 1039
213 Ga0206354_11102674 3300020081 Bacteria 1429
214 Ga0154015_1394471 3300020610 Bacteria 544
215 Ga0224712_10022447 3300022467 Bacteria 2176
216 Ga0224712_10084741 3300022467 Bacteria 1316
217 Ga0207697_10223163 3300025315 Bacteria 831
218 Ga0207656_10023692 3300025321 Bacteria 2475
219 Ga0207656_10038757 3300025321 Bacteria 2012
220 Ga0207656_10106991 3300025321 Bacteria 1288
221 Ga0207656_10275788 3300025321 Bacteria 828
222 Ga0207680_10512117 3300025903 Bacteria 855
223 Ga0207647_10014771 3300025904 Bacteria 5372
224 Ga0207647_10240993 3300025904 Bacteria 1038
225 Ga0207705_10021814 3300025909 Bacteria 4569
226 Ga0207705_10022391 3300025909 Bacteria 4505
227 Ga0207654_10000074 3300025911 Bacteria 66092
228 Ga0207654_10031037 3300025911 Bacteria 2940
229 Ga0207654_10116669 3300025911 Bacteria 1670
230 Ga0207654_10122276 3300025911 Bacteria 1636
231 Ga0207654_10790164 3300025911 Bacteria 685
232 Ga0207707_10060343 3300025912 Unclassified 3299
233 Ga0207707_10108809 3300025912 Bacteria 2423
234 Ga0207695_10000119 3300025913 Bacteria 235221
235 Ga0207695_10000598 3300025913 Bacteria 72240
236 Ga0207695_10001003 3300025913 Bacteria 49974
237 Ga0207695_10016154 3300025913 Bacteria 8753
238 Ga0207695_10025289 3300025913 Bacteria 6651
239 Ga0207695_10052308 3300025913 Bacteria 4280
240 Ga0207695_10253963 3300025913 Bacteria 1657
241 Ga0207695_10617798 3300025913 Bacteria 965
242 Ga0207671_10000238 3300025914 Bacteria 82806
243 Ga0207671_10130329 3300025914 Bacteria 1930
244 Ga0207671_10273823 3300025914 Bacteria 1330
245 Ga0207671_10395218 3300025914 Bacteria 1099
246 Ga0207671_10425885 3300025914 Bacteria 1056
247 Ga0207693_11022368 3300025915 Unclassified 630
248 Ga0207663_10717753 3300025916 Bacteria 792
249 Ga0207660_10005977 3300025917 Bacteria 7902
250 Ga0207657_10001966 3300025919 Bacteria 22196
251 Ga0207649_10090956 3300025920 Bacteria 1998
252 Ga0207649_10222775 3300025920 Unclassified 1344
253 Ga0207649_10237083 3300025920 Bacteria 1308
254 Ga0207649_10424511 3300025920 Unclassified 999
255 Ga0207652_10001863 3300025921 Bacteria 18323
256 Ga0207652_10077838 3300025921 Unclassified 2895
257 Ga0207694_10000089 3300025924 Bacteria 103520
258 Ga0207694_10000528 3300025924 Bacteria 34581
259 Ga0207694_10005214 3300025924 Bacteria 10037
260 Ga0207694_10065531 3300025924 Bacteria 2832
261 Ga0207694_10176221 3300025924 Bacteria 1733
262 Ga0207659_10062542 3300025926 Bacteria 2687
263 Ga0207687_10027735 3300025927 Bacteria 3801
264 Ga0207687_10030366 3300025927 Bacteria 3643
265 Ga0207700_10116504 3300025928 Unclassified 2159
266 Ga0207700_10307890 3300025928 Bacteria 1369
267 Ga0207664_10905105 3300025929 Bacteria 792
268 Ga0207664_11073080 3300025929 Bacteria 720
269 Ga0207644_10152854 3300025931 Bacteria 1787
270 Ga0207644_10249718 3300025931 Bacteria 1415
271 Ga0207690_10838238 3300025932 Bacteria 761
272 Ga0207706_10026672 3300025933 Bacteria 5171
273 Ga0207704_10077983 3300025938 Bacteria 2129
274 Ga0207691_10053962 3300025940 Bacteria 3667
275 Ga0207711_10000428 3300025941 Bacteria 44126
276 Ga0207711_10004164 3300025941 Bacteria 12383
277 Ga0207711_10483847 3300025941 Bacteria 1153
278 Ga0207661_10033007 3300025944 Bacteria 4016
279 Ga0207661_10043611 3300025944 Bacteria 3541
280 Ga0207661_10079934 3300025944 Bacteria 2696
281 Ga0207679_11484987 3300025945 Unclassified 622
282 Ga0207667_10001714 3300025949 Bacteria 27583
283 Ga0207667_10003452 3300025949 Bacteria 19512
284 Ga0207667_10005700 3300025949 Bacteria 15186
285 Ga0207667_10107998 3300025949 Bacteria 2871
286 Ga0207667_10191370 3300025949 Bacteria 2099
287 Ga0207667_10281282 3300025949 Bacteria 1700
288 Ga0207651_10728556 3300025960 Bacteria 875
289 Ga0207677_10074239 3300026023 Bacteria 2412
290 Ga0207677_10770085 3300026023 Bacteria 859
291 Ga0207703_11057405 3300026035 Bacteria 779
292 Ga0207639_10000103 3300026041 Bacteria 70103
293 Ga0207639_10006821 3300026041 Bacteria 7776
294 Ga0207639_10338817 3300026041 Bacteria 1340
295 Ga0207639_10356525 3300026041 Bacteria 1308
296 Ga0207639_10775771 3300026041 Bacteria 892
297 Ga0207678_10792705 3300026067 Bacteria 836
298 Ga0207702_10008971 3300026078 Bacteria 8425
299 Ga0207702_10084000 3300026078 Bacteria 2771
300 Ga0207702_10300798 3300026078 Bacteria 1522
301 Ga0207702_10874644 3300026078 Bacteria 890
302 Ga0207641_10202128 3300026088 Bacteria 1833
303 Ga0207676_10990614 3300026095 Bacteria 828
304 Ga0207674_10002326 3300026116 Bacteria 24058
305 Ga0207674_10164441 3300026116 Bacteria 2173
306 Ga0207674_10638799 3300026116 Bacteria 1028
307 Ga0207683_10002152 3300026121 Bacteria 17299
308 Ga0207698_10000271 3300026142 Bacteria 31417
309 Ga0207698_10003152 3300026142 Bacteria 9891
310 Ga0207698_10015700 3300026142 Bacteria 5081
311 Ga0207698_10137751 3300026142 Bacteria 2097
312 Ga0207698_10202626 3300026142 Bacteria 1778
313 Ga0207698_10334657 3300026142 Bacteria 1423
314 Ga0207698_10524810 3300026142 Bacteria 1156
315 Ga0207698_10816848 3300026142 Bacteria 935
316 Ga0268266_10220965 3300028379 Bacteria 1741
317 Ga0268266_10318333 3300028379 Bacteria 1455
318 Ga0268264_10066135 3300028381 Bacteria 3048
319 Ga0265334_10019607 3300028573 Bacteria 2780
320 Ga0265318_10118732 3300028577 Bacteria 972
321 Ga0265318_10157495 3300028577 Bacteria 833
322 Ga0265323_10057067 3300028653 Bacteria 1367
323 Ga0265336_10040955 3300028666 Bacteria 1417
324 Ga0265338_10003286 3300028800 Bacteria 22951
325 Ga0265338_10004003 3300028800 Bacteria 20248
326 Ga0265338_10029667 3300028800 Bacteria 5414
327 Ga0265338_10139012 3300028800 Bacteria 1905
328 Ga0265338_10224167 3300028800 Bacteria 1402
329 Ga0265338_10300396 3300028800 Bacteria 1167
330 Ga0265338_10371856 3300028800 Bacteria 1024
331 Ga0265338_10628479 3300028800 Bacteria 746
332 Ga0265338_10630412 3300028800 Bacteria 745
333 Ga0265760_10098442 3300031090 Bacteria 922
334 Ga0265330_10000087 3300031235 Bacteria 78938
335 Ga0265330_10000459 3300031235 Bacteria 27193
336 Ga0265330_10035615 3300031235 Bacteria 2220
337 Ga0265330_10051007 3300031235 Bacteria 1814
338 Ga0265330_10234358 3300031235 Bacteria 774
339 Ga0265328_10004391 3300031239 Bacteria 6130
340 Ga0265328_10073860 3300031239 Bacteria 1254
341 Ga0265328_10182160 3300031239 Bacteria 795
342 Ga0265328_10233050 3300031239 Bacteria 703
343 Ga0265320_10066105 3300031240 Bacteria 1714
344 Ga0265320_10133542 3300031240 Bacteria 1127
345 Ga0265325_10000500 3300031241 Bacteria 28355
346 Ga0265325_10033226 3300031241 Bacteria 2751
347 Ga0265325_10072541 3300031241 Bacteria 1725
348 Ga0265325_10119279 3300031241 Bacteria 1273
349 Ga0265325_10153656 3300031241 Bacteria 1087
350 Ga0265340_10013037 3300031247 Bacteria 4379
351 Ga0265340_10040005 3300031247 Bacteria 2310
352 Ga0265340_10084577 3300031247 Bacteria 1489
353 Ga0265339_10000026 3300031249 Bacteria 165764
354 Ga0265339_10001353 3300031249 Bacteria 18307
355 Ga0265339_10001525 3300031249 Bacteria 17097
356 Ga0265339_10011604 3300031249 Bacteria 5413
357 Ga0265339_10132742 3300031249 Bacteria 1272
358 Ga0265339_10146051 3300031249 Bacteria 1199
359 Ga0265331_10399937 3300031250 Bacteria 616
360 Ga0265316_10000694 3300031344 Bacteria 37497
361 Ga0265316_10000852 3300031344 Bacteria 33626
362 Ga0265316_10000924 3300031344 Bacteria 31955
363 Ga0265316_10036523 3300031344 Bacteria 3972
364 Ga0265316_10088586 3300031344 Bacteria 2363
365 Ga0265316_10105064 3300031344 Bacteria 2143
366 Ga0265316_10111101 3300031344 Bacteria 2075
367 Ga0265316_10133668 3300031344 Bacteria 1867
368 Ga0265316_10270362 3300031344 Bacteria 1244
369 Ga0265316_10433169 3300031344 Unclassified 944
370 Ga0265313_10003561 3300031595 Bacteria 12522
371 Ga0265313_10016209 3300031595 Bacteria 4295
372 Ga0265313_10055395 3300031595 Bacteria 1878
373 Ga0265313_10087660 3300031595 Bacteria 1402
374 Ga0265313_10197657 3300031595 Unclassified 838
375 Ga0265314_10000067 3300031711 Bacteria 156225
376 Ga0265314_10015363 3300031711 Bacteria 6078
377 Ga0265314_10098189 3300031711 Bacteria 1890
378 Ga0265342_10000067 3300031712 Bacteria 111040
379 Ga0265342_10000537 3300031712 Bacteria 40371
380 Ga0265342_10003998 3300031712 Bacteria 11800
381 Ga0265342_10015915 3300031712 Bacteria 4932
382 Ga0265342_10022733 3300031712 Bacteria 3982
383 Ga0265342_10050347 3300031712 Bacteria 2489
384 Ga0265342_10078837 3300031712 Bacteria 1906
385 Ga0265342_10096652 3300031712 Bacteria 1687
386 Ga0373955_0064368 3300035172 Bacteria 2033
387 Ga0373937_0005972 3300036401 Bacteria 10483
388 Ga0395900_0992774 3300037418 Unclassified 760
389 Ga0451577_0038209 3300042876 Bacteria 4318
390 Ga0453683_0274142 3300044673 Bacteria 1077
391 Ga0466966_0233366 3300044684 Bacteria 1110
392 Ga0466961_0073182 3300044693 Bacteria 2173
393 Ga0466961_0190221 3300044693 Bacteria 1272
394 Ga0466961_0323060 3300044693 Unclassified 941
395 Ga0466963_0457188 3300044694 Bacteria 901
396 Ga0451576_0042504 3300045051 Bacteria 4797
397 Ga0451576_1211893 3300045051 Bacteria 788
398 Ga0466958_0407225 3300045836 Bacteria 878
399 Ga0466967_0027307 3300045976 Bacteria 4747
400 Ga0495651_0207099 3300046462 Viruses 1368
401 Ga0495606_0368710 3300046507 Bacteria 756
402 Ga0495628_0285688 3300046516 Bacteria 1224
403 Ga0495645_0223170 3300046543 Viruses 1266
404 Ga0495623_0198061 3300046679 Bacteria 1156
405 Ga0495649_0514380 3300046694 Bacteria 594
406 Ga0495600_0837327 3300046809 Unclassified 546
407 Ga0495581_0439698 3300047315 Bacteria 760
408 Ga0495636_0559070 3300047318 Bacteria 557
409 Ga0495674_0335799 3300047319 Bacteria 1229
410 Ga0495680_0332318 3300047322 Bacteria 1062
411 Ga0495684_0635012 3300047471 Bacteria 716
412 Ga0495686_0132064 3300047472 Bacteria 1479
413 Ga0496104_0043402 3300048907 Bacteria 4224
414 Ga0496105_0232785 3300048908 Bacteria 1497
415 Ga0496105_0475896 3300048908 Bacteria 983
416 Ga0496114_0002637 3300048917 Bacteria 13682
417 Ga0496114_0371329 3300048917 Bacteria 1266
418 Ga0496115_0094702 3300048918 Bacteria 2443
419 Ga0496115_0684792 3300048918 Bacteria 807
420 Ga0500595_010667 3300053119 Bacteria 3639
421 Ga0587073_0118830 3300059492 Unclassified 711
422 Ga0587088_073729 3300059508 Unclassified 717
423 Ga0587098_023606 3300059604 Bacteria 800
424 Ga0587122_022780 3300059628 Unclassified 693
425 Ga0587076_029475 3300059645 Bacteria 963
426 Ga0466969_0045400
427 rootH2_10037976
428 rootL2_10101055
429 rootH1_10319483
430 Ga0070658_10023901
431 Ga0070658_10132880
432 Ga0070658_10239424
433 Ga0070676_10092380
434 Ga0070683_100030597
435 Ga0070683_100156164
436 Ga0070683_100169552
437 Ga0070683_100565385
438 Ga0070683_100567363
439 Ga0070666_10114295
440 Ga0070680_100050432
441 Ga0070680_100095147
442 Ga0070680_100492776
443 Ga0070682_100124905
444 Ga0070682_100328655
445 Ga0070682_100708424
446 Ga0068868_100066967
447 Ga0068868_100454360
448 Ga0070660_100005537
449 Ga0070661_100075316
450 Ga0070661_100132273
451 Ga0070661_100510172
452 Ga0070692_10477431
453 Ga0070675_100051677
454 Ga0070671_100186383
455 Ga0070671_100249376
456 Ga0070688_100164606
457 Ga0070659_101342310
458 Ga0070714_101276883
459 Ga0070713_100121500
460 Ga0070713_100195389
461 Ga0070713_100652062
462 Ga0070711_100552037
463 Ga0070663_100418431
464 Ga0070678_100498009
465 Ga0070662_100096546
466 Ga0070681_10017164
467 Ga0070681_10244500
468 Ga0070681_10817739
469 Ga0068867_101188953
470 Ga0070679_100003731
471 Ga0070679_100038949
472 Ga0070684_100029339
473 Ga0070684_100043095
474 Ga0070684_100097774
475 Ga0070684_100142982
476 Ga0068853_100000152
477 Ga0068853_100055600
478 Ga0068853_100131412
479 Ga0068853_100138588
480 Ga0070672_100187970
481 Ga0070665_100001717
482 Ga0070665_100124666
483 Ga0070665_100443418
484 Ga0070665_100478531
485 Ga0068855_100020423
486 Ga0068855_100181766
487 Ga0068855_100393998
488 Ga0068855_100870470
489 Ga0068855_101617012
490 Ga0070664_100217474
491 Ga0070664_100503154
492 Ga0068857_100000598
493 Ga0068857_100179525
494 Ga0068857_100270480
495 Ga0068857_101897101
496 Ga0068854_100032789
497 Ga0068856_100012479
498 Ga0068856_100030885
499 Ga0068856_100103256
500 Ga0068856_100246000
501 Ga0068856_100477312
502 Ga0068856_101148732
503 Ga0068852_100000028
504 Ga0068852_100000191
505 Ga0068852_100008441
506 Ga0068852_100014864
507 Ga0068852_100055357
508 Ga0068852_100132923
509 Ga0068852_100558684
510 Ga0068852_100707956
511 Ga0068852_101233129
512 Ga0068859_100263825
513 Ga0068859_100415197
514 Ga0068864_100541031
515 Ga0068851_10007785
516 Ga0068851_10136928
517 Ga0068851_10471390
518 Ga0068863_100241406
519 Ga0068860_100461492
520 Ga0070712_100941071
521 Ga0097621_101072175
522 Ga0068871_100096386
523 Ga0068871_100287683
524 Ga0068871_100303349
525 Ga0068865_100109117
526 Ga0097620_100263813
527 Ga0097620_100415189
528 Ga0105240_10000796
529 Ga0105240_10001270
530 Ga0105240_10002000
531 Ga0105240_10005920
532 Ga0105240_10011336
533 Ga0105240_10012076
534 Ga0105240_10037469
535 Ga0105240_10069273
536 Ga0105240_10303349
537 Ga0105240_10531488
538 Ga0105240_10981476
539 Ga0105240_12098231
540 Ga0105245_10025273
541 Ga0105245_10040010
542 Ga0105245_10169759
543 Ga0105247_10057596
544 Ga0105241_10001746
545 Ga0105241_10028210
546 Ga0105241_10081789
547 Ga0105241_10669193
548 Ga0105242_10364944
549 Ga0105248_10000087
550 Ga0105248_10003746
551 Ga0105248_10419775
552 Ga0105248_11366691
553 Ga0105248_12748111
554 Ga0105237_10002782
555 Ga0105237_10121828
556 Ga0105237_10169634
557 Ga0105237_10195451
558 Ga0105237_10330670
559 Ga0105237_10748802
560 Ga0105238_10001164
561 Ga0105238_10003709
562 Ga0105238_10017759
563 Ga0105238_10049639
564 Ga0105238_10303612
565 Ga0105249_10571329
566 Ga0105239_10028613
567 Ga0105239_10114528
568 Ga0105239_10145384
569 Ga0105239_10148844
570 Ga0105239_10183269
571 Ga0105239_10668379
572 Ga0105246_10117329
573 Ga0157373_10051569
574 Ga0157371_10008689
575 Ga0157371_10618847
576 Ga0157370_10000003
577 Ga0157370_10001456
578 Ga0157370_11089645
579 Ga0157369_10000535
580 Ga0157369_10000767
581 Ga0157369_10000949
582 Ga0157369_10005570
583 Ga0157369_10012347
584 Ga0157369_10039251
585 Ga0157369_10039984
586 Ga0157369_10098966
587 Ga0157369_10256995
588 Ga0157369_10283604
589 Ga0157369_10316282
590 Ga0157369_10510063
591 Ga0157369_10827012
592 Ga0157374_10001030
593 Ga0157374_10001291
594 Ga0157374_10036718
595 Ga0157374_10071948
596 Ga0157374_10232522
597 Ga0157374_10404170
598 Ga0157374_10429809
599 Ga0157378_10013801
600 Ga0157378_10016443
601 Ga0157378_10353648
602 Ga0157378_11392997
603 Ga0157378_11415706
604 Ga0163162_10303064
605 Ga0163162_10579546
606 Ga0163162_11021872
607 Ga0157372_10000489
608 Ga0157372_10005985
609 Ga0157372_10020294
610 Ga0157372_10174501
611 Ga0157372_10176376
612 Ga0157372_10201011
613 Ga0157372_10268191
614 Ga0157375_10043757
615 Ga0157375_10542101
616 Ga0157375_11392551
617 Ga0163163_10396919
618 Ga0163163_10479883
619 Ga0157377_10408255
620 Ga0157377_10702418
621 Ga0157379_10052622
622 Ga0157379_10081449
623 Ga0157379_10124778
624 Ga0157376_10159141
625 Ga0157376_10169594
626 Ga0157376_12393385
627 Ga0163161_10242462
628 Ga0197907_11094781
629 Ga0206349_1098283
630 Ga0206349_1897553
631 Ga0206355_1677729
632 Ga0206355_1697551
633 Ga0206351_10447372
634 Ga0206352_10144497
635 Ga0206352_10447216
636 Ga0206350_10253880
637 Ga0206350_11444285
638 Ga0206354_11102674
639 Ga0154015_1394471
640 Ga0224712_10022447
641 Ga0224712_10084741
642 Ga0207697_10223163
643 Ga0207656_10023692
644 Ga0207656_10038757
645 Ga0207656_10106991
646 Ga0207656_10275788
647 Ga0207680_10512117
648 Ga0207647_10014771
649 Ga0207647_10240993
650 Ga0207705_10021814
651 Ga0207705_10022391
652 Ga0207654_10000074
653 Ga0207654_10031037
654 Ga0207654_10116669
655 Ga0207654_10122276
656 Ga0207654_10790164
657 Ga0207707_10060343
658 Ga0207707_10108809
659 Ga0207695_10000119
660 Ga0207695_10000598
661 Ga0207695_10001003
662 Ga0207695_10016154
663 Ga0207695_10025289
664 Ga0207695_10052308
665 Ga0207695_10253963
666 Ga0207695_10617798
667 Ga0207671_10000238
668 Ga0207671_10130329
669 Ga0207671_10273823
670 Ga0207671_10395218
671 Ga0207671_10425885
672 Ga0207693_11022368
673 Ga0207663_10717753
674 Ga0207660_10005977
675 Ga0207657_10001966
676 Ga0207649_10090956
677 Ga0207649_10222775
678 Ga0207649_10237083
679 Ga0207649_10424511
680 Ga0207652_10001863
681 Ga0207652_10077838
682 Ga0207694_10000089
683 Ga0207694_10000528
684 Ga0207694_10005214
685 Ga0207694_10065531
686 Ga0207694_10176221
687 Ga0207659_10062542
688 Ga0207687_10027735
689 Ga0207687_10030366
690 Ga0207700_10116504
691 Ga0207700_10307890
692 Ga0207664_10905105
693 Ga0207664_11073080
694 Ga0207644_10152854
695 Ga0207644_10249718
696 Ga0207690_10838238
697 Ga0207706_10026672
698 Ga0207704_10077983
699 Ga0207691_10053962
700 Ga0207711_10000428
701 Ga0207711_10004164
702 Ga0207711_10483847
703 Ga0207661_10033007
704 Ga0207661_10043611
705 Ga0207661_10079934
706 Ga0207679_11484987
707 Ga0207667_10001714
708 Ga0207667_10003452
709 Ga0207667_10005700
710 Ga0207667_10107998
711 Ga0207667_10191370
712 Ga0207667_10281282
713 Ga0207651_10728556
714 Ga0207677_10074239
715 Ga0207677_10770085
716 Ga0207703_11057405
717 Ga0207639_10000103
718 Ga0207639_10006821
719 Ga0207639_10338817
720 Ga0207639_10356525
721 Ga0207639_10775771
722 Ga0207678_10792705
723 Ga0207702_10008971
724 Ga0207702_10084000
725 Ga0207702_10300798
726 Ga0207702_10874644
727 Ga0207641_10202128
728 Ga0207676_10990614
729 Ga0207674_10002326
730 Ga0207674_10164441
731 Ga0207674_10638799
732 Ga0207683_10002152
733 Ga0207698_10000271
734 Ga0207698_10003152
735 Ga0207698_10015700
736 Ga0207698_10137751
737 Ga0207698_10202626
738 Ga0207698_10334657
739 Ga0207698_10524810
740 Ga0207698_10816848
741 Ga0268266_10220965
742 Ga0268266_10318333
743 Ga0268264_10066135
744 Ga0265334_10019607
745 Ga0265318_10118732
746 Ga0265318_10157495
747 Ga0265323_10057067
748 Ga0265336_10040955
749 Ga0265338_10003286
750 Ga0265338_10004003
751 Ga0265338_10029667
752 Ga0265338_10139012
753 Ga0265338_10224167
754 Ga0265338_10300396
755 Ga0265338_10371856
756 Ga0265338_10628479
757 Ga0265338_10630412
758 Ga0265760_10098442
759 Ga0265330_10000087
760 Ga0265330_10000459
761 Ga0265330_10035615
762 Ga0265330_10051007
763 Ga0265330_10234358
764 Ga0265328_10004391
765 Ga0265328_10073860
766 Ga0265328_10182160
767 Ga0265328_10233050
768 Ga0265320_10066105
769 Ga0265320_10133542
770 Ga0265325_10000500
771 Ga0265325_10033226
772 Ga0265325_10072541
773 Ga0265325_10119279
774 Ga0265325_10153656
775 Ga0265340_10013037
776 Ga0265340_10040005
777 Ga0265340_10084577
778 Ga0265339_10000026
779 Ga0265339_10001353
780 Ga0265339_10001525
781 Ga0265339_10011604
782 Ga0265339_10132742
783 Ga0265339_10146051
784 Ga0265331_10399937
785 Ga0265316_10000694
786 Ga0265316_10000852
787 Ga0265316_10000924
788 Ga0265316_10036523
789 Ga0265316_10088586
790 Ga0265316_10105064
791 Ga0265316_10111101
792 Ga0265316_10133668
793 Ga0265316_10270362
794 Ga0265316_10433169
795 Ga0265313_10003561
796 Ga0265313_10016209
797 Ga0265313_10055395
798 Ga0265313_10087660
799 Ga0265313_10197657
800 Ga0265314_10000067
801 Ga0265314_10015363
802 Ga0265314_10098189
803 Ga0265342_10000067
804 Ga0265342_10000537
805 Ga0265342_10003998
806 Ga0265342_10015915
807 Ga0265342_10022733
808 Ga0265342_10050347
809 Ga0265342_10078837
810 Ga0265342_10096652
811 Ga0373955_0064368
812 Ga0373937_0005972
813 Ga0395900_0992774
814 Ga0451577_0038209
815 Ga0453683_0274142
816 Ga0466966_0233366
817 Ga0466961_0073182
818 Ga0466961_0190221
819 Ga0466961_0323060
820 Ga0466963_0457188
821 Ga0451576_0042504
822 Ga0451576_1211893
823 Ga0466958_0407225
824 Ga0466967_0027307
825 Ga0495651_0207099
826 Ga0495606_0368710
827 Ga0495628_0285688
828 Ga0495645_0223170
829 Ga0495623_0198061
830 Ga0495649_0514380
831 Ga0495600_0837327
832 Ga0495581_0439698
833 Ga0495636_0559070
834 Ga0495674_0335799
835 Ga0495680_0332318
836 Ga0495684_0635012
837 Ga0495686_0132064
838 Ga0496104_0043402
839 Ga0496105_0232785
840 Ga0496105_0475896
841 Ga0496114_0002637
842 Ga0496114_0371329
843 Ga0496115_0094702
844 Ga0496115_0684792
845 Ga0500595_010667
846 Ga0587073_0118830
847 Ga0587088_073729
848 Ga0587098_023606
849 Ga0587122_022780
850 Ga0587076_029475

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13798

PCYCGC

Protein of unknown function with PCYCGC motif

83

169

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hl7-assembly1.cif.gz_A crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa 0.6224 68 133
2hl7-assembly1.cif.gz_A crystal structure of the periplasmic domain of ccmh from pseudomonas aeruginosa 0.4184 68 133
3lcn-assembly2.cif.gz_B nab2:gfd1 complex 0.3693 68 146
3sdz-assembly1.cif.gz_A structural characterization of the subunit a mutant f427w of the a-atp synthase from pyrococcus horikoshii 0.3549 64 142
3ikj-assembly1.cif.gz_A structural characterization for the nucleotide binding ability of subunit a mutant s238a of the a1ao atp synthase 0.3403 62 144
ID Description Score Start End Superfamily
af_C6SYH8_3_82_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6867 68 139 1.10.8.640
af_P0ABM9_18_102_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6596 68 140 1.10.8.640
af_P32711_19_102_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6511 61 140 1.10.8.640
2hl7A00 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.6224 68 133 1.10.8.640
af_C6SYH8_3_82_1.10.8.640 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Cytochrome C biogenesis protein 0.5155 68 139 1.10.8.640
ID Description Score Start End GO Terms
AF-A0A2V9AZJ5-F1-model_v4 Uncharacterized protein 0.9602 64 147
AF-A0A2V7K3L4-F1-model_v4 Uncharacterized protein 0.9356 79 140
AF-A0A2V7LG80-F1-model_v4 Uncharacterized protein 0.9352 62 140
AF-A0A2V9ZW13-F1-model_v4 Uncharacterized protein 0.9249 33 149
AF-A0A7V1UKR8-F1-model_v4 Uncharacterized protein 0.9134 28 147

Map