F440871

General Info

Members Datasets Scaffolds Average Seq Length
424 320 364 327

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221649|2644278959
Length 368
Sequence APTTTEPRTGGTSGGGSTPGGGRRSGGRAGGGAGGRRTRFDMIHVLSGIRDTFGSPKYGPVLVTLILFVAVFLAGGLRYRGFLSGQVFLNLLVDNAYLIVLAVGMTFVIITGGIDLSVGAVVALSTMIAASLLQSGWSPGVVIPLILVLTSLLGLLVGLMIHVFKVQPFIATLAAMFLARGLCYVISKDSISIVDPFFVAFAQTRIPLGGGLSVTPSVIIALVVVVVAVFVLGYTRFGRTVYALGGSEHSGMLMGLPVARTKVLVYIISGFCSGVAGVLFTFYTLSGYSLTAVGTELDAIAAVVIGGTLLTGGYGFVLGSVLGVLVLGVIQTIITFEGTLSSWWTKIFIGALLLVFIILQKVLTARRR

Samples

Sample ID Description Type Environment
1 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
2 2643221549 Agromyces sp. Root1464 Isolate Unclassified
3 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
4 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
5 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
6 2643221647 Streptomyces sp. Root369 Isolate Unclassified
7 2643221649 Leifsonia sp. Root4 Isolate Unclassified
8 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
9 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
10 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
11 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
12 2643221714 Streptomyces sp. Root264 Isolate Unclassified
13 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
14 2734482000 Kineosporia rhizophila JCM 9960 Isolate Unclassified
15 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
18 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
19 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
20 2808606372 Agromyces sp. 23-23 Isolate Unclassified
21 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
22 2818991459 Paenibacillus sp. 597 Isolate Unclassified
23 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
24 2854911287 Brucella lupini LUP21 Isolate Unclassified
25 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
26 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
27 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
28 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
29 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
30 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
31 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
32 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
33 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
34 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
35 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
36 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
37 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
38 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
39 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
40 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
41 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
42 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
43 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
44 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
45 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
46 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
47 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
48 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
49 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
50 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
51 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
52 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
53 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
54 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
55 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
56 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
57 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
58 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
59 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
60 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
61 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
62 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
63 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
64 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
65 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
66 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
67 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
68 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
69 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
75 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
78 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
86 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
87 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
93 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
94 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
95 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
96 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
100 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
102 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
172 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
173 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
174 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
189 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
190 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
193 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
194 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
195 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
196 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
197 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
205 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
206 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
207 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
208 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
209 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
210 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
211 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
212 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
213 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
214 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
237 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
250 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
251 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
252 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
253 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
291 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
292 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
293 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
294 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
297 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
298 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
299 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
300 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
301 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
302 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
303 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
304 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
305 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
306 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
307 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
308 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
311 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
314 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
315 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
316 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
317 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
318 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
319 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere
320 8057473075 Paenibacillus endoradicis T3-5-0-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.85
Metatranscriptomes 0
Isolates 14.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.14
Nodule 0.71
Rhizoplane 3.3
Rhizosphere 66.51
Stem 0
Stem Tuber 0
Unclassified 19.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24745J21846_1002465 3300002073 Bacteria 1892
2 Ga0065714_10021124 3300005288 Bacteria 1339
3 Ga0070658_10006191 3300005327 Bacteria 9700
4 Ga0070676_10037849 3300005328 Bacteria 2784
5 Ga0070683_100065686 3300005329 Bacteria 3378
6 Ga0070682_100034643 3300005337 Bacteria 3076
7 Ga0070682_100153768 3300005337 Bacteria 1581
8 Ga0068868_100269373 3300005338 Bacteria 1438
9 Ga0070691_10119624 3300005341 Bacteria 1325
10 Ga0070692_10044756 3300005345 Bacteria 2281
11 Ga0070668_100000179 3300005347 Bacteria 40901
12 Ga0070668_100047427 3300005347 Bacteria 3303
13 Ga0070675_100089351 3300005354 Bacteria 2579
14 Ga0070675_100192229 3300005354 Bacteria 1769
15 Ga0070671_100038721 3300005355 Bacteria 3957
16 Ga0070674_100139012 3300005356 Bacteria 1820
17 Ga0070688_100053736 3300005365 Bacteria 2521
18 Ga0070659_100145046 3300005366 Bacteria 1934
19 Ga0070659_100192583 3300005366 Bacteria 1676
20 Ga0070667_100128403 3300005367 Bacteria 2211
21 Ga0070710_10000215 3300005437 Bacteria 27009
22 Ga0070701_10189400 3300005438 Bacteria 1209
23 Ga0070663_100108496 3300005455 Bacteria 2082
24 Ga0070663_100205117 3300005455 Bacteria 1540
25 Ga0070678_100271957 3300005456 Bacteria 1429
26 Ga0070662_100030352 3300005457 Bacteria 3781
27 Ga0070681_10534968 3300005458 Bacteria 1085
28 Ga0070684_100103256 3300005535 Bacteria 2549
29 Ga0068853_100088821 3300005539 Bacteria 2714
30 Ga0070695_100175920 3300005545 Bacteria 1513
31 Ga0070693_100052125 3300005547 Bacteria 2345
32 Ga0070665_100002302 3300005548 Bacteria 21191
33 Ga0070665_100023358 3300005548 Bacteria 6224
34 Ga0070665_100105339 3300005548 Bacteria 2822
35 Ga0070665_100209616 3300005548 Bacteria 1949
36 Ga0070665_100378358 3300005548 Bacteria 1423
37 Ga0068855_100022348 3300005563 Bacteria 7579
38 Ga0068855_100502856 3300005563 Bacteria 1317
39 Ga0068857_100230044 3300005577 Bacteria 1695
40 Ga0068854_100001959 3300005578 Bacteria 12581
41 Ga0068856_100182433 3300005614 Bacteria 2112
42 Ga0068856_100232501 3300005614 Bacteria 1859
43 Ga0070702_100134686 3300005615 Bacteria 1565
44 Ga0068859_100158626 3300005617 Bacteria 2341
45 Ga0068864_100265964 3300005618 Bacteria 1596
46 Ga0068866_10051283 3300005718 Bacteria 2099
47 Ga0068861_100030751 3300005719 Bacteria 3938
48 Ga0068861_100089122 3300005719 Bacteria 2431
49 Ga0068870_10068201 3300005840 Bacteria 1932
50 Ga0068858_100093228 3300005842 Bacteria 2803
51 Ga0068860_100116109 3300005843 Bacteria 2560
52 Ga0068860_100324191 3300005843 Bacteria 1512
53 Ga0068862_100013080 3300005844 Bacteria 6865
54 Ga0068862_100014389 3300005844 Bacteria 6564
55 Ga0068862_100062847 3300005844 Bacteria 3194
56 Ga0081455_10001110 3300005937 Bacteria 33764
57 Ga0081539_10000007 3300005985 Bacteria 532790
58 Ga0070717_10247879 3300006028 Bacteria 1572
59 Ga0075365_10003457 3300006038 Bacteria 8141
60 Ga0075365_10014051 3300006038 Bacteria 4807
61 Ga0075368_10001969 3300006042 Bacteria 6620
62 Ga0075363_100047012 3300006048 Bacteria 2291
63 Ga0075364_10010719 3300006051 Bacteria 5544
64 Ga0075364_10029040 3300006051 Bacteria 3544
65 Ga0075364_10033284 3300006051 Bacteria 3317
66 Ga0075367_10009804 3300006178 Bacteria 5018
67 Ga0097621_100189691 3300006237 Bacteria 1780
68 Ga0075370_10035918 3300006353 Bacteria 2782
69 Ga0075428_100000121 3300006844 Bacteria 67666
70 Ga0068865_100007819 3300006881 Bacteria 6596
71 Ga0097620_100158630 3300006931 Bacteria 2341
72 Ga0079104_1000103 3300006946 Bacteria 124578
73 Ga0105240_10023279 3300009093 Bacteria 8197
74 Ga0111539_10504748 3300009094 Bacteria 1409
75 Ga0105245_10051980 3300009098 Bacteria 3674
76 Ga0105245_10080550 3300009098 Bacteria 2975
77 Ga0105245_10134768 3300009098 Bacteria 2320
78 Ga0105247_10038994 3300009101 Bacteria 2901
79 Ga0105241_10024241 3300009174 Bacteria 4506
80 Ga0105242_10020802 3300009176 Bacteria 5147
81 Ga0105248_10027074 3300009177 Bacteria 6379
82 Ga0105237_10000015 3300009545 Bacteria 266079
83 Ga0105237_10049518 3300009545 Bacteria 4222
84 Ga0105237_10150024 3300009545 Bacteria 2327
85 Ga0105238_10009829 3300009551 Bacteria 9581
86 Ga0105249_10181699 3300009553 Bacteria 2047
87 Ga0105239_10075021 3300010375 Bacteria 3718
88 Ga0157371_10127132 3300013102 Bacteria 1813
89 Ga0157369_10065840 3300013105 Bacteria 3900
90 Ga0171462_1002 3300013250 Bacteria 1052134
91 Ga0163162_10252045 3300013306 Bacteria 1897
92 Ga0163163_10060946 3300014325 Bacteria 3738
93 Ga0163163_10248329 3300014325 Bacteria 1830
94 Ga0157380_10057223 3300014326 Bacteria 3104
95 Ga0157377_10072633 3300014745 Bacteria 1992
96 Ga0157379_10113824 3300014968 Bacteria 2431
97 Ga0157376_10099232 3300014969 Bacteria 2540
98 Ga0183367_1009 3300015688 Bacteria 484598
99 Ga0207656_10007360 3300025321 Bacteria 4004
100 Ga0207692_10000374 3300025898 Bacteria 15408
101 Ga0207692_10019578 3300025898 Bacteria 3062
102 Ga0207642_10015525 3300025899 Bacteria 2840
103 Ga0207688_10011849 3300025901 Bacteria 4745
104 Ga0207647_10016979 3300025904 Bacteria 4955
105 Ga0207699_10258695 3300025906 Bacteria 1202
106 Ga0207645_10007002 3300025907 Bacteria 8025
107 Ga0207643_10010903 3300025908 Bacteria 4901
108 Ga0207705_10019816 3300025909 Bacteria 4810
109 Ga0207654_10025741 3300025911 Bacteria 3178
110 Ga0207695_10007795 3300025913 Bacteria 13557
111 Ga0207671_10000007 3300025914 Bacteria 825758
112 Ga0207671_10008123 3300025914 Bacteria 8955
113 Ga0207671_10202174 3300025914 Bacteria 1552
114 Ga0207663_10156732 3300025916 Bacteria 1603
115 Ga0207662_10011682 3300025918 Bacteria 4877
116 Ga0207657_10033266 3300025919 Bacteria 4649
117 Ga0207694_10013911 3300025924 Bacteria 6067
118 Ga0207687_10169874 3300025927 Bacteria 1681
119 Ga0207687_10223475 3300025927 Bacteria 1484
120 Ga0207700_10090233 3300025928 Bacteria 2418
121 Ga0207706_10025542 3300025933 Bacteria 5291
122 Ga0207706_10271911 3300025933 Bacteria 1478
123 Ga0207691_10037718 3300025940 Bacteria 4474
124 Ga0207691_10086299 3300025940 Bacteria 2816
125 Ga0207711_10180503 3300025941 Bacteria 1919
126 Ga0207689_10225409 3300025942 Bacteria 1549
127 Ga0207667_10186506 3300025949 Bacteria 2129
128 Ga0207712_10058580 3300025961 Bacteria 2722
129 Ga0207668_10044787 3300025972 Bacteria 3013
130 Ga0207640_10306586 3300025981 Bacteria 1258
131 Ga0207658_10161509 3300025986 Bacteria 1837
132 Ga0207703_10188406 3300026035 Bacteria 1825
133 Ga0207639_10066304 3300026041 Bacteria 2805
134 Ga0207678_10020295 3300026067 Bacteria 5831
135 Ga0207678_10025812 3300026067 Bacteria 5127
136 Ga0207708_10252076 3300026075 Bacteria 1423
137 Ga0207702_10322635 3300026078 Bacteria 1471
138 Ga0207641_10373207 3300026088 Bacteria 1364
139 Ga0207648_10039943 3300026089 Bacteria 4124
140 Ga0207676_10109667 3300026095 Bacteria 2307
141 Ga0207674_10039401 3300026116 Bacteria 4897
142 Ga0207675_100062559 3300026118 Bacteria 3476
143 Ga0207675_100084696 3300026118 Bacteria 2975
144 Ga0207675_100129150 3300026118 Bacteria 2396
145 Ga0207675_100264257 3300026118 Bacteria 1668
146 Ga0207683_10058703 3300026121 Bacteria 3379
147 Ga0207683_10312490 3300026121 Bacteria 1439
148 Ga0268266_10041733 3300028379 Bacteria 3916
149 Ga0268265_10037886 3300028380 Bacteria 3542
150 Ga0268265_10095423 3300028380 Bacteria 2388
151 Ga0268264_10153752 3300028381 Bacteria 2065
152 Ga0265334_10000840 3300028573 Bacteria 15351
153 Ga0307517_10028309 3300028786 Bacteria 6686
154 Ga0307515_10000005 3300028794 Bacteria 758563
155 Ga0307515_10000167 3300028794 Bacteria 160820
156 Ga0307515_10145348 3300028794 Bacteria 2515
157 Ga0316176_1148080 3300030732 Bacteria 2024
158 Ga0314311_1145984 3300030733 Bacteria 1686
159 Ga0265332_10018948 3300031238 Bacteria 3039
160 Ga0265328_10006479 3300031239 Bacteria 4952
161 Ga0265329_10002446 3300031242 Bacteria 8404
162 Ga0307513_10008634 3300031456 Bacteria 12986
163 Ga0307513_10130398 3300031456 Bacteria 2461
164 Ga0307509_10053810 3300031507 Bacteria 4289
165 Ga0307508_10002597 3300031616 Bacteria 19002
166 Ga0307508_10008300 3300031616 Bacteria 9611
167 Ga0265314_10000453 3300031711 Bacteria 54843
168 Ga0307516_10000550 3300031730 Bacteria 50318
169 Ga0307516_10009903 3300031730 Bacteria 10565
170 Ga0307516_10094284 3300031730 Bacteria 2818
171 Ga0307405_10073488 3300031731 Bacteria 2208
172 Ga0307413_10045525 3300031824 Bacteria 2602
173 Ga0307410_10101391 3300031852 Bacteria 2064
174 Ga0307412_10060786 3300031911 Bacteria 2537
175 Ga0307412_10170065 3300031911 Bacteria 1628
176 Ga0307409_100109462 3300031995 Bacteria 2313
177 Ga0307409_100172742 3300031995 Bacteria 1904
178 Ga0307416_100069483 3300032002 Bacteria 2915
179 Ga0307416_100160049 3300032002 Bacteria 2080
180 Ga0307416_100162582 3300032002 Bacteria 2066
181 Ga0307415_100063733 3300032126 Bacteria 2562
182 Ga0373951_0000123 3300035091 Bacteria 29166
183 Ga0400483_220309 3300039062 Bacteria 1487
184 Ga0439436_0001484 3300041404 Bacteria 6823
185 Ga0439439_0000127 3300041406 Bacteria 10667
186 Ga0439466_0059173 3300041411 Bacteria 1238
187 Ga0451789_0595615 3300041443 Bacteria 1766
188 Ga0451791_0035297 3300041451 Bacteria 7414
189 Ga0451791_1530393 3300041451 Bacteria 1554
190 Ga0451797_0401878 3300041453 Bacteria 2615
191 Ga0451837_0666756 3300041494 Bacteria 1904
192 Ga0451841_0912333 3300041498 Bacteria 1984
193 Ga0451843_0382836 3300041509 Bacteria 1443
194 Ga0451853_0011871 3300041512 Bacteria 6264
195 Ga0451853_0190751 3300041512 Bacteria 4011
196 Ga0439433_0019949 3300041999 Bacteria 1495
197 Ga0439445_0004138 3300042004 Bacteria 3277
198 Ga0439448_0001042 3300042005 Bacteria 6935
199 Ga0439449_0000055 3300042007 Bacteria 34359
200 Ga0439449_0000136 3300042007 Bacteria 24746
201 Ga0439449_0010907 3300042007 Bacteria 3429
202 Ga0439449_0037961 3300042007 Bacteria 1791
203 Ga0439449_0039946 3300042007 Bacteria 1744
204 Ga0439449_0069468 3300042007 Bacteria 1299
205 Ga0439455_0002880 3300042012 Bacteria 3209
206 Ga0439457_000686 3300042014 Bacteria 10018
207 Ga0439457_000747 3300042014 Bacteria 9683
208 Ga0439457_004246 3300042014 Bacteria 3773
209 Ga0439457_008807 3300042014 Bacteria 2367
210 Ga0439462_0003961 3300042015 Bacteria 3586
211 Ga0439462_0004925 3300042015 Bacteria 3279
212 Ga0439462_0014312 3300042015 Bacteria 2037
213 Ga0450894_000183 3300042131 Bacteria 11292
214 Ga0450896_002770 3300042133 Bacteria 2288
215 Ga0450899_001275 3300042135 Bacteria 2847
216 Ga0450903_001802 3300042138 Bacteria 3916
217 Ga0450906_000257 3300042145 Bacteria 10247
218 Ga0439458_0000129 3300042157 Bacteria 15799
219 Ga0450908_008029 3300042184 Bacteria 1980
220 Ga0466972_0000545 3300044658 Bacteria 18461
221 Ga0466972_0014559 3300044658 Bacteria 3939
222 Ga0466965_0003627 3300044683 Bacteria 6799
223 Ga0466961_0003521 3300044693 Bacteria 9764
224 Ga0466961_0008181 3300044693 Bacteria 6662
225 Ga0466970_0000793 3300044765 Bacteria 15256
226 Ga0466960_0022432 3300044901 Bacteria 2823
227 Ga0451576_0078561 3300045051 Bacteria 3434
228 Ga0466958_0094216 3300045836 Bacteria 1855
229 Ga0495603_0001527 3300046455 Bacteria 13521
230 Ga0495603_0006778 3300046455 Bacteria 6871
231 Ga0495629_0001210 3300046459 Bacteria 20267
232 Ga0495585_0033119 3300046492 Bacteria 2927
233 Ga0495585_0107706 3300046492 Bacteria 1485
234 Ga0495594_0004679 3300046499 Bacteria 7054
235 Ga0495594_0009881 3300046499 Bacteria 4944
236 Ga0495628_0251042 3300046516 Bacteria 1321
237 Ga0495643_0002210 3300046522 Bacteria 15864
238 Ga0495622_0016903 3300046557 Bacteria 3396
239 Ga0495667_0115408 3300046559 Bacteria 1735
240 Ga0495611_0041946 3300046648 Bacteria 2042
241 Ga0495588_0018459 3300046674 Bacteria 3402
242 Ga0495613_0123288 3300046689 Bacteria 1860
243 Ga0495624_0174483 3300046690 Bacteria 1311
244 Ga0495670_0004432 3300046691 Bacteria 6886
245 Ga0495604_0061981 3300047317 Bacteria 2859
246 Ga0495676_0011537 3300047321 Bacteria 7968
247 Ga0495685_002409 3300047447 Bacteria 5864
248 Ga0495681_0005790 3300047470 Bacteria 8212
249 Ga0496101_0199180 3300048904 Bacteria 1548
250 Ga0496102_0046872 3300048905 Bacteria 3927
251 Ga0496105_0031368 3300048908 Bacteria 4357
252 Ga0496108_0000058 3300048911 Bacteria 123379
253 Ga0496108_0047473 3300048911 Bacteria 3589
254 Ga0496109_0137749 3300048912 Bacteria 2282
255 Ga0496109_0163044 3300048912 Bacteria 2089
256 Ga0496111_0115236 3300048914 Bacteria 1981
257 Ga0496113_0067812 3300048916 Bacteria 2706
258 Ga0496115_0130432 3300048918 Bacteria 2072
259 Ga0496116_0000804 3300048919 Bacteria 39809
260 Ga0496116_0002426 3300048919 Bacteria 19644
261 Ga0496116_0022561 3300048919 Bacteria 4714
262 Ga0496116_0045360 3300048919 Bacteria 2976
263 Ga0496117_0003924 3300048920 Bacteria 16845
264 Ga0496117_0056481 3300048920 Bacteria 2733
265 Ga0496117_0056619 3300048920 Bacteria 2729
266 Ga0496118_0016152 3300048921 Bacteria 6865
267 Ga0496118_0037909 3300048921 Bacteria 3871
268 Ga0496118_0188720 3300048921 Bacteria 1235
269 Ga0496119_0000398 3300048922 Bacteria 59768
270 Ga0496119_0004303 3300048922 Bacteria 14234
271 Ga0496120_0000376 3300048923 Bacteria 72411
272 Ga0496120_0000499 3300048923 Bacteria 61341
273 Ga0496120_0012895 3300048923 Bacteria 5657
274 Ga0496120_0024072 3300048923 Bacteria 3802
275 Ga0496121_0000005 3300048924 Bacteria 1034486
276 Ga0496122_0008665 3300048925 Bacteria 10912
277 Ga0496122_0053581 3300048925 Bacteria 3039
278 Ga0496123_0001374 3300048926 Bacteria 34150
279 Ga0496123_0045985 3300048926 Bacteria 2965
280 Ga0496124_0000780 3300048927 Bacteria 51967
281 Ga0496124_0031067 3300048927 Bacteria 4732
282 Ga0496124_0100103 3300048927 Bacteria 2350
283 Ga0496125_0000076 3300048928 Bacteria 233887
284 Ga0496125_0000449 3300048928 Bacteria 74908
285 Ga0496125_0000458 3300048928 Bacteria 73821
286 Ga0496126_0002426 3300048929 Bacteria 25230
287 Ga0496126_0077708 3300048929 Bacteria 2942
288 Ga0496126_0227376 3300048929 Bacteria 1564
289 Ga0501031_0004707 3300049568 Bacteria 8851
290 Ga0501031_0038517 3300049568 Bacteria 3119
291 Ga0501032_0001525 3300049569 Bacteria 18459
292 Ga0501032_0029815 3300049569 Bacteria 3742
293 Ga0501033_0005395 3300049570 Bacteria 10132
294 Ga0501033_0048991 3300049570 Bacteria 3137
295 Ga0501034_0004749 3300049571 Bacteria 15041
296 Ga0501034_0077891 3300049571 Bacteria 3320
297 Ga0501036_0007960 3300049572 Bacteria 8674
298 Ga0501036_0101508 3300049572 Bacteria 2434
299 Ga0501037_0012532 3300049573 Bacteria 6245
300 Ga0501038_0000223 3300049574 Bacteria 48354
301 Ga0501038_0022827 3300049574 Bacteria 5601
302 Ga0501039_0008140 3300049575 Bacteria 7987
303 Ga0501040_0009773 3300049576 Bacteria 6263
304 Ga0501041_0023324 3300049577 Bacteria 3711
305 Ga0501042_0021573 3300049578 Bacteria 4491
306 Ga0501043_0000513 3300049579 Bacteria 34841
307 Ga0501046_0013830 3300049580 Bacteria 6818
308 Ga0501047_0000433 3300049581 Bacteria 46523
309 Ga0501048_0009945 3300049582 Bacteria 7122
310 Ga0501067_0003704 3300049583 Bacteria 8420
311 Ga0501068_0050449 3300049584 Bacteria 2516
312 Ga0501069_0051429 3300049585 Bacteria 2292
313 Ga0501070_0200574 3300049586 Bacteria 1638
314 Ga0501071_0003658 3300049587 Bacteria 9646
315 Ga0501072_0000482 3300049588 Bacteria 28669
316 Ga0501073_0052699 3300049589 Bacteria 2848
317 Ga0501074_0179456 3300049590 Bacteria 1510
318 Ga0501076_0368956 3300049592 Bacteria 1179
319 Ga0501077_0016336 3300049593 Bacteria 4678
320 Ga0501225_0042255 3300049705 Bacteria 1258
321 Ga0501079_0015724 3300049741 Bacteria 5780
322 Ga0501080_0125007 3300049742 Bacteria 2382
323 Ga0501081_0311985 3300049743 Bacteria 1155
324 Ga0501083_0167679 3300049744 Bacteria 1435
325 Ga0501035_0000624 3300049822 Bacteria 38958
326 Ga0501044_0004307 3300049823 Bacteria 15958
327 Ga0501045_0008143 3300049824 Bacteria 7302
328 nmdc:mga03n38_15401_c1 3300050490 Bacteria 2952
329 nmdc:mga00v17_16984_c1 3300050491 Bacteria 4111
330 nmdc:mga00v17_2217_c1 3300050491 Bacteria 9990
331 nmdc:mga00v17_224020_c1 3300050491 Bacteria 1218
332 nmdc:mga00v17_237024_c1 3300050491 Bacteria 1182
333 nmdc:mga0yw44_16531_c1 3300050492 Bacteria 3988
334 nmdc:mga0yw44_66056_c1 3300050492 Bacteria 2231
335 nmdc:mga0k408_93731_c1 3300050493 Bacteria 1765
336 nmdc:mga06z11_11587_c1 3300050494 Bacteria 3808
337 Ga0495655_0012274 3300053083 Bacteria 1742
338 Ga0500583_0030103 3300053092 Bacteria 2374
339 Ga0500641_0012740 3300053096 Bacteria 3078
340 Ga0500650_0055132 3300053098 Bacteria 1851
341 Ga0500660_064716 3300053100 Bacteria 1743
342 Ga0500553_027647 3300053101 Bacteria 2848
343 Ga0500618_000041 3300053125 Bacteria 111404
344 Ga0500652_003905 3300053131 Bacteria 4558
345 Ga0500559_0000078 3300053136 Bacteria 76033
346 Ga0500561_0002257 3300053137 Bacteria 3222
347 Ga0500573_0000011 3300053140 Bacteria 209484
348 Ga0500573_0000314 3300053140 Bacteria 20636
349 Ga0500573_0002508 3300053140 Bacteria 9196
350 Ga0500573_0009840 3300053140 Bacteria 5324
351 Ga0500573_0021909 3300053140 Bacteria 3666
352 Ga0500573_0054074 3300053140 Bacteria 2306
353 Ga0500573_0174692 3300053140 Bacteria 1159
354 Ga0500577_0003232 3300053142 Bacteria 4220
355 Ga0500577_0014860 3300053142 Bacteria 2419
356 Ga0500588_0122763 3300053146 Bacteria 918
357 Ga0500600_0024696 3300053149 Bacteria 3578
358 Ga0500616_0000074 3300053153 Bacteria 222910
359 Ga0500616_0047637 3300053153 Bacteria 2275
360 Ga0500616_0124496 3300053153 Bacteria 1226
361 Ga0500634_0112145 3300053161 Bacteria 1343
362 Ga0500637_0018293 3300053178 Bacteria 3764
363 Ga0501084_0112056 3300054114 Bacteria 2292
364 Ga0501082_0035952 3300060353 Bacteria 4268

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0123288 Ga0495613_0123288_214_1059 254
2 3300025906 Ga0207699_10258695 Ga0207699_102586952 260
3 3300053146 Ga0500588_0122763 Ga0500588_0122763_44_892 264
4 3300053153 Ga0500616_0124496 Ga0500616_0124496_361_1209 264
5 3300042012 Ga0439455_0002880 Ga0439455_0002880_2342_3193 265
6 3300042133 Ga0450896_002770 Ga0450896_002770_1426_2277 265
7 3300005539 Ga0068853_100088821 Ga0068853_1000888212 267
8 3300025981 Ga0207640_10306586 Ga0207640_103065861 267
9 3300026041 Ga0207639_10066304 Ga0207639_100663042 267
10 3300049705 Ga0501225_0042255 Ga0501225_0042255_96_1133 270
11 3300025898 Ga0207692_10019578 Ga0207692_100195782 271
12 3300042007 Ga0439449_0000136 Ga0439449_0000136_8347_9390 272
13 3300050491 nmdc:mga00v17_237024_c1 nmdc:mga00v17_237024_c1_137_1126 273
14 iso_pu_bacteria 2904755435 2904759686 276
15 3300031852 Ga0307410_10101391 Ga0307410_101013911 277
16 3300032002 Ga0307416_100069483 Ga0307416_1000694832 277
17 3300053153 Ga0500616_0000074 Ga0500616_0000074_95258_96199 279
18 3300053098 Ga0500650_0055132 Ga0500650_0055132_534_1526 280
19 3300053142 Ga0500577_0003232 Ga0500577_0003232_1234_2226 280
20 3300053100 Ga0500660_064716 Ga0500660_064716_465_1418 282
21 3300053136 Ga0500559_0000078 Ga0500559_0000078_38632_39528 282
22 3300053149 Ga0500600_0024696 Ga0500600_0024696_2651_3559 282
23 3300053140 Ga0500573_0000314 Ga0500573_0000314_15933_16937 283
24 3300053153 Ga0500616_0047637 Ga0500616_0047637_567_1562 283
25 3300026075 Ga0207708_10252076 Ga0207708_102520762 286
26 3300048925 Ga0496122_0008665 Ga0496122_0008665_5946_6926 286
27 3300053140 Ga0500573_0000011 Ga0500573_0000011_81285_82301 286
28 3300005437 Ga0070710_10000215 Ga0070710_1000021514 287
29 3300025898 Ga0207692_10000374 Ga0207692_100003742 287
30 3300044658 Ga0466972_0000545 Ga0466972_0000545_15333_16295 287
31 3300044683 Ga0466965_0003627 Ga0466965_0003627_5537_6499 287
32 3300048919 Ga0496116_0000804 Ga0496116_0000804_25347_26363 287
33 3300048919 Ga0496116_0002426 Ga0496116_0002426_10583_11599 287
34 3300048921 Ga0496118_0016152 Ga0496118_0016152_3000_4016 288
35 3300053142 Ga0500577_0014860 Ga0500577_0014860_24_1025 288
36 3300048920 Ga0496117_0056619 Ga0496117_0056619_990_2006 289
37 3300048922 Ga0496119_0004303 Ga0496119_0004303_2344_3360 289
38 3300048923 Ga0496120_0024072 Ga0496120_0024072_546_1562 289
39 3300048926 Ga0496123_0001374 Ga0496123_0001374_19040_20056 289
40 3300048927 Ga0496124_0031067 Ga0496124_0031067_3373_4389 289
41 3300048928 Ga0496125_0000076 Ga0496125_0000076_158876_159892 289
42 3300046559 Ga0495667_0115408 Ga0495667_0115408_649_1575 290
43 3300048911 Ga0496108_0000058 Ga0496108_0000058_29126_30145 290
44 3300048922 Ga0496119_0000398 Ga0496119_0000398_12583_13599 290
45 3300048923 Ga0496120_0000376 Ga0496120_0000376_68760_69776 290
46 3300049592 Ga0501076_0368956 Ga0501076_0368956_27_959 290
47 3300044693 Ga0466961_0003521 Ga0466961_0003521_6189_7121 291
48 3300045836 Ga0466958_0094216 Ga0466958_0094216_753_1685 291
49 3300005367 Ga0070667_100128403 Ga0070667_1001284031 292
50 3300005937 Ga0081455_10001110 Ga0081455_1000111014 292
51 3300025986 Ga0207658_10161509 Ga0207658_101615093 292
52 3300031824 Ga0307413_10045525 Ga0307413_100455252 292
53 3300031995 Ga0307409_100109462 Ga0307409_1001094622 292
54 3300032002 Ga0307416_100162582 Ga0307416_1001625822 292
55 3300035091 Ga0373951_0000123 Ga0373951_0000123_2287_3309 292
56 3300041512 Ga0451853_0011871 Ga0451853_0011871_4677_5702 292
57 3300045051 Ga0451576_0078561 Ga0451576_0078561_366_1316 292
58 3300049568 Ga0501031_0038517 Ga0501031_0038517_17_943 292
59 3300053140 Ga0500573_0009840 Ga0500573_0009840_1014_2018 292
60 3300053140 Ga0500573_0054074 Ga0500573_0054074_320_1246 292
61 3300006844 Ga0075428_100000121 Ga0075428_10000012144 293
62 3300005985 Ga0081539_10000007 Ga0081539_10000007123 294
63 3300025933 Ga0207706_10271911 Ga0207706_102719111 294
64 3300031911 Ga0307412_10060786 Ga0307412_100607863 294
65 3300048920 Ga0496117_0003924 Ga0496117_0003924_2254_3270 294
66 3300048921 Ga0496118_0188720 Ga0496118_0188720_159_1175 294
67 3300048923 Ga0496120_0000499 Ga0496120_0000499_31280_32296 294
68 3300048929 Ga0496126_0002426 Ga0496126_0002426_18307_19323 294
69 3300053140 Ga0500573_0021909 Ga0500573_0021909_1105_2118 294
70 3300009093 Ga0105240_10023279 Ga0105240_100232795 295
71 3300009174 Ga0105241_10024241 Ga0105241_100242413 295
72 3300009545 Ga0105237_10150024 Ga0105237_101500242 295
73 3300009551 Ga0105238_10009829 Ga0105238_100098293 295
74 3300010375 Ga0105239_10075021 Ga0105239_100750212 295
75 3300030732 Ga0316176_1148080 Ga0316176_11480803 295
76 3300030733 Ga0314311_1145984 Ga0314311_11459842 295
77 3300041406 Ga0439439_0000127 Ga0439439_0000127_4513_5481 295
78 3300042007 Ga0439449_0000055 Ga0439449_0000055_22983_23951 295
79 3300042014 Ga0439457_004246 Ga0439457_004246_2549_3517 295
80 3300042015 Ga0439462_0003961 Ga0439462_0003961_2502_3470 295
81 3300042015 Ga0439462_0004925 Ga0439462_0004925_2034_2996 295
82 3300048919 Ga0496116_0022561 Ga0496116_0022561_3674_4639 295
83 3300053096 Ga0500641_0012740 Ga0500641_0012740_317_1345 295
84 3300005548 Ga0070665_100105339 Ga0070665_1001053392 296
85 3300006051 Ga0075364_10010719 Ga0075364_100107194 296
86 3300006946 Ga0079104_1000103 Ga0079104_100010373 296
87 3300028794 Ga0307515_10000005 Ga0307515_10000005547 296
88 3300041443 Ga0451789_0595615 Ga0451789_0595615_773_1747 296
89 3300042004 Ga0439445_0004138 Ga0439445_0004138_1244_2287 296
90 3300042007 Ga0439449_0039946 Ga0439449_0039946_733_1695 296
91 3300048919 Ga0496116_0045360 Ga0496116_0045360_500_1480 296
92 3300048920 Ga0496117_0056481 Ga0496117_0056481_1162_2142 296
93 3300048921 Ga0496118_0037909 Ga0496118_0037909_1800_2780 296
94 3300048923 Ga0496120_0012895 Ga0496120_0012895_3210_4190 296
95 3300048924 Ga0496121_0000005 Ga0496121_0000005_580832_581812 296
96 3300048925 Ga0496122_0053581 Ga0496122_0053581_2014_3000 296
97 3300048926 Ga0496123_0045985 Ga0496123_0045985_1234_2214 296
98 3300048927 Ga0496124_0000780 Ga0496124_0000780_12212_13198 296
99 3300048928 Ga0496125_0000449 Ga0496125_0000449_29861_30841 296
100 3300048928 Ga0496125_0000458 Ga0496125_0000458_11051_12037 296
101 3300048929 Ga0496126_0227376 Ga0496126_0227376_500_1480 296
102 3300050491 nmdc:mga00v17_16984_c1 nmdc:mga00v17_16984_c1_312_1292 296
103 3300053125 Ga0500618_000041 Ga0500618_000041_52582_53568 296
104 iso_pu_bacteria 2791355222 2793183362 296
105 iso_pu_bacteria 2816332139 2816507619 296
106 iso_pu_bacteria 2818991459 2819669855 296
107 iso_pu_bacteria 2818991459 2819670965 296
108 iso_pu_bacteria 2854911287 2854912663 296
109 iso_pu_bacteria 2870622029 2870624883 296
110 iso_pu_bacteria 2904113452 2904116233 296
111 iso_pu_bacteria 2919425241 2919428369 296
112 iso_pu_bacteria 2919425241 2919429589 296
113 iso_pu_bacteria 2929138655 2929143435 296
114 iso_pu_bacteria 2939657138 2939659663 296
115 iso_pu_bacteria 8054460903 8054465400 296
116 iso_pu_bacteria 8056533031 8056537774 296
117 iso_pu_bacteria 8057473075 8057475656 296
118 3300025928 Ga0207700_10090233 Ga0207700_100902332 297
119 3300031238 Ga0265332_10018948 Ga0265332_100189483 297
120 3300031239 Ga0265328_10006479 Ga0265328_100064792 297
121 3300031242 Ga0265329_10002446 Ga0265329_100024463 297
122 3300031711 Ga0265314_10000453 Ga0265314_1000045316 297
123 3300048929 Ga0496126_0077708 Ga0496126_0077708_52_1029 297
124 3300005545 Ga0070695_100175920 Ga0070695_1001759202 298
125 3300039062 Ga0400483_220309 Ga0400483_220309_18_995 298
126 3300053140 Ga0500573_0002508 Ga0500573_0002508_5699_6700 298
127 3300053178 Ga0500637_0018293 Ga0500637_0018293_1396_2370 298
128 iso_pu_bacteria 2643221601 2644016796 298
129 iso_pu_bacteria 2643221631 2644178187 298
130 3300009545 Ga0105237_10000015 Ga0105237_1000001551 299
131 3300025914 Ga0207671_10000007 Ga0207671_10000007727 299
132 3300044658 Ga0466972_0014559 Ga0466972_0014559_1783_2772 299
133 3300049743 Ga0501081_0311985 Ga0501081_0311985_60_1061 299
134 iso_pu_bacteria 2791354901 2791911329 299
135 iso_pu_bacteria 2932431166 2932434489 299
136 3300005548 Ga0070665_100002302 Ga0070665_1000023029 300
137 3300005563 Ga0068855_100502856 Ga0068855_1005028562 300
138 3300031731 Ga0307405_10073488 Ga0307405_100734882 300
139 3300031911 Ga0307412_10170065 Ga0307412_101700652 300
140 3300048927 Ga0496124_0100103 Ga0496124_0100103_332_1351 300
141 iso_pu_bacteria 2844852863 2844853063 300
142 iso_pu_bacteria 8056037122 8056038338 300
143 iso_pu_bacteria 8057345674 8057349030 300
144 3300005337 Ga0070682_100034643 Ga0070682_1000346433 301
145 3300046516 Ga0495628_0251042 Ga0495628_0251042_35_1039 301
146 3300048912 Ga0496109_0137749 Ga0496109_0137749_910_1938 301
147 3300031730 Ga0307516_10009903 Ga0307516_100099038 302
148 iso_pu_bacteria 2643221678 2644436126 302
149 iso_pu_bacteria 2643221714 2644632017 302
150 iso_pu_bacteria 2784746763 2785344593 302
151 iso_pu_bacteria 2808606359 2808840952 302
152 iso_pu_bacteria 2862281513 2862288369 302
153 iso_pu_bacteria 2862382967 2862384273 302
154 iso_pu_bacteria 2862993130 2862996779 302
155 iso_pu_bacteria 2863404153 2863405859 302
156 iso_pu_bacteria 2877676314 2877682273 302
157 iso_pu_bacteria 2919468124 2919468438 302
158 iso_pu_bacteria 2946072368 2946074909 302
159 iso_pu_bacteria 2954002825 2954003974 302
160 iso_pu_bacteria 2954380949 2954387403 302
161 iso_pu_bacteria 2990059506 2990067056 302
162 iso_pu_bacteria 8008558824 8008559268 302
163 iso_pu_bacteria 8048406513 8048407957 302
164 3300005327 Ga0070658_10006191 Ga0070658_100061913 303
165 3300013105 Ga0157369_10065840 Ga0157369_100658401 303
166 3300025909 Ga0207705_10019816 Ga0207705_100198161 303
167 3300025916 Ga0207663_10156732 Ga0207663_101567322 303
168 3300044765 Ga0466970_0000793 Ga0466970_0000793_12522_13535 303
169 3300044901 Ga0466960_0022432 Ga0466960_0022432_1508_2521 303
170 iso_pu_bacteria 2643221647 2644268912 303
171 iso_pu_bacteria 2734482000 2734968600 303
172 iso_pu_bacteria 2786546132 2786669303 303
173 iso_pu_bacteria 2954673503 2954675766 303
174 iso_pu_bacteria 2954682443 2954688498 303
175 iso_pu_bacteria 2954691527 2954698236 303
176 iso_pu_bacteria 2954701450 2954703991 303
177 3300005347 Ga0070668_100000179 Ga0070668_10000017934 304
178 3300005844 Ga0068862_100062847 Ga0068862_1000628472 304
179 3300026118 Ga0207675_100062559 Ga0207675_1000625591 304
180 3300028380 Ga0268265_10037886 Ga0268265_100378863 304
181 3300031616 Ga0307508_10008300 Ga0307508_100083008 304
182 3300049574 Ga0501038_0022827 Ga0501038_0022827_2262_3260 304
183 3300053092 Ga0500583_0030103 Ga0500583_0030103_1217_2227 304
184 iso_pu_bacteria 2643221549 2643766505 304
185 iso_pu_bacteria 2643221694 2644525080 304
186 iso_pu_bacteria 2643221722 2644669168 304
187 iso_pu_bacteria 2808606372 2808903643 304
188 iso_pu_bacteria 2861520306 2861526853 304
189 iso_pu_bacteria 2919443155 2919444041 304
190 3300032126 Ga0307415_100063733 Ga0307415_1000637332 305
191 3300041451 Ga0451791_0035297 Ga0451791_0035297_5442_6464 305
192 3300041453 Ga0451797_0401878 Ga0451797_0401878_875_1897 305
193 3300041494 Ga0451837_0666756 Ga0451837_0666756_617_1639 305
194 3300041498 Ga0451841_0912333 Ga0451841_0912333_580_1602 305
195 3300041509 Ga0451843_0382836 Ga0451843_0382836_53_1075 305
196 3300046690 Ga0495624_0174483 Ga0495624_0174483_212_1249 305
197 3300053140 Ga0500573_0174692 Ga0500573_0174692_52_1089 305
198 iso_pu_bacteria 2643221587 2643947198 305
199 iso_pu_bacteria 2643221677 2644433331 305
200 iso_pu_bacteria 2945968032 2945969119 305
201 iso_pu_bacteria 3006321560 3006327587 305
202 3300005455 Ga0070663_100205117 Ga0070663_1002051172 306
203 3300005458 Ga0070681_10534968 Ga0070681_105349681 306
204 3300005548 Ga0070665_100023358 Ga0070665_1000233585 306
205 3300005548 Ga0070665_100378358 Ga0070665_1003783582 306
206 3300005563 Ga0068855_100022348 Ga0068855_1000223487 306
207 3300005578 Ga0068854_100001959 Ga0068854_1000019593 306
208 3300005614 Ga0068856_100232501 Ga0068856_1002325013 306
209 3300006048 Ga0075363_100047012 Ga0075363_1000470122 306
210 3300025904 Ga0207647_10016979 Ga0207647_100169793 306
211 3300025911 Ga0207654_10025741 Ga0207654_100257413 306
212 3300025913 Ga0207695_10007795 Ga0207695_100077953 306
213 3300025914 Ga0207671_10008123 Ga0207671_100081235 306
214 3300025924 Ga0207694_10013911 Ga0207694_100139114 306
215 3300025949 Ga0207667_10186506 Ga0207667_101865061 306
216 3300026067 Ga0207678_10025812 Ga0207678_100258123 306
217 3300026078 Ga0207702_10322635 Ga0207702_103226351 306
218 3300028379 Ga0268266_10041733 Ga0268266_100417333 306
219 3300028786 Ga0307517_10028309 Ga0307517_100283092 306
220 3300028794 Ga0307515_10000167 Ga0307515_1000016755 306
221 3300028794 Ga0307515_10145348 Ga0307515_101453483 306
222 3300031456 Ga0307513_10008634 Ga0307513_100086349 306
223 3300031456 Ga0307513_10130398 Ga0307513_101303981 306
224 3300031507 Ga0307509_10053810 Ga0307509_100538102 306
225 3300031616 Ga0307508_10002597 Ga0307508_100025975 306
226 3300031730 Ga0307516_10000550 Ga0307516_1000055050 306
227 3300031995 Ga0307409_100172742 Ga0307409_1001727422 306
228 3300041404 Ga0439436_0001484 Ga0439436_0001484_61_1089 306
229 3300041411 Ga0439466_0059173 Ga0439466_0059173_150_1160 306
230 3300041451 Ga0451791_1530393 Ga0451791_1530393_59_1072 306
231 3300041999 Ga0439433_0019949 Ga0439433_0019949_398_1426 306
232 3300042007 Ga0439449_0010907 Ga0439449_0010907_157_1188 306
233 3300042007 Ga0439449_0037961 Ga0439449_0037961_245_1285 306
234 3300042007 Ga0439449_0069468 Ga0439449_0069468_208_1236 306
235 3300042014 Ga0439457_000686 Ga0439457_000686_391_1431 306
236 3300042014 Ga0439457_000747 Ga0439457_000747_5775_6803 306
237 3300042014 Ga0439457_008807 Ga0439457_008807_60_1070 306
238 3300042015 Ga0439462_0014312 Ga0439462_0014312_42_1082 306
239 3300042131 Ga0450894_000183 Ga0450894_000183_901_1932 306
240 3300042135 Ga0450899_001275 Ga0450899_001275_624_1655 306
241 3300042145 Ga0450906_000257 Ga0450906_000257_6417_7448 306
242 3300042184 Ga0450908_008029 Ga0450908_008029_459_1490 306
243 3300046492 Ga0495585_0107706 Ga0495585_0107706_43_1065 306
244 3300046499 Ga0495594_0009881 Ga0495594_0009881_2219_3223 306
245 3300046522 Ga0495643_0002210 Ga0495643_0002210_6905_7909 306
246 3300046648 Ga0495611_0041946 Ga0495611_0041946_821_1843 306
247 3300046691 Ga0495670_0004432 Ga0495670_0004432_3793_4797 306
248 3300047470 Ga0495681_0005790 Ga0495681_0005790_7030_8034 306
249 3300053083 Ga0495655_0012274 Ga0495655_0012274_509_1513 306
250 3300053101 Ga0500553_027647 Ga0500553_027647_906_1910 306
251 3300053131 Ga0500652_003905 Ga0500652_003905_3098_4102 306
252 3300053137 Ga0500561_0002257 Ga0500561_0002257_1978_2982 306
253 3300053161 Ga0500634_0112145 Ga0500634_0112145_240_1244 306
254 iso_pu_bacteria 2643221649 2644278959 306
255 iso_pu_bacteria 2643221690 2644502714 306
256 3300005288 Ga0065714_10021124 Ga0065714_100211241 307
257 3300013306 Ga0163162_10252045 Ga0163162_102520452 307
258 3300015688 Ga0183367_1009 Ga0183367_1009156 307
259 3300025940 Ga0207691_10037718 Ga0207691_100377182 307
260 3300031730 Ga0307516_10094284 Ga0307516_100942841 307
261 3300041512 Ga0451853_0190751 Ga0451853_0190751_1937_2935 307
262 3300042005 Ga0439448_0001042 Ga0439448_0001042_211_1242 307
263 3300042138 Ga0450903_001802 Ga0450903_001802_2506_3537 307
264 3300042157 Ga0439458_0000129 Ga0439458_0000129_11085_12116 307
265 3300044693 Ga0466961_0008181 Ga0466961_0008181_5086_6117 307
266 3300046455 Ga0495603_0006778 Ga0495603_0006778_3343_4368 307
267 3300046459 Ga0495629_0001210 Ga0495629_0001210_14488_15513 307
268 3300046492 Ga0495585_0033119 Ga0495585_0033119_134_1141 307
269 3300046499 Ga0495594_0004679 Ga0495594_0004679_2752_3777 307
270 3300046557 Ga0495622_0016903 Ga0495622_0016903_154_1179 307
271 3300046674 Ga0495588_0018459 Ga0495588_0018459_15_1040 307
272 3300047317 Ga0495604_0061981 Ga0495604_0061981_863_1870 307
273 3300047321 Ga0495676_0011537 Ga0495676_0011537_3666_4691 307
274 3300047447 Ga0495685_002409 Ga0495685_002409_2067_3098 307
275 3300049568 Ga0501031_0004707 Ga0501031_0004707_3404_4411 307
276 3300049569 Ga0501032_0001525 Ga0501032_0001525_4441_5448 307
277 3300049570 Ga0501033_0005395 Ga0501033_0005395_5946_6953 307
278 3300049571 Ga0501034_0004749 Ga0501034_0004749_8748_9755 307
279 3300049572 Ga0501036_0007960 Ga0501036_0007960_4650_5657 307
280 3300049573 Ga0501037_0012532 Ga0501037_0012532_4441_5448 307
281 3300049574 Ga0501038_0000223 Ga0501038_0000223_6698_7705 307
282 3300049575 Ga0501039_0008140 Ga0501039_0008140_1913_2920 307
283 3300049576 Ga0501040_0009773 Ga0501040_0009773_4833_5840 307
284 3300049577 Ga0501041_0023324 Ga0501041_0023324_1996_3003 307
285 3300049578 Ga0501042_0021573 Ga0501042_0021573_1417_2424 307
286 3300049579 Ga0501043_0000513 Ga0501043_0000513_28497_29504 307
287 3300049580 Ga0501046_0013830 Ga0501046_0013830_4064_5071 307
288 3300049581 Ga0501047_0000433 Ga0501047_0000433_38819_39826 307
289 3300049582 Ga0501048_0009945 Ga0501048_0009945_1594_2601 307
290 3300049583 Ga0501067_0003704 Ga0501067_0003704_6703_7710 307
291 3300049584 Ga0501068_0050449 Ga0501068_0050449_44_1051 307
292 3300049585 Ga0501069_0051429 Ga0501069_0051429_861_1868 307
293 3300049586 Ga0501070_0200574 Ga0501070_0200574_614_1621 307
294 3300049587 Ga0501071_0003658 Ga0501071_0003658_6700_7707 307
295 3300049588 Ga0501072_0000482 Ga0501072_0000482_25_1032 307
296 3300049589 Ga0501073_0052699 Ga0501073_0052699_425_1432 307
297 3300049590 Ga0501074_0179456 Ga0501074_0179456_486_1493 307
298 3300049593 Ga0501077_0016336 Ga0501077_0016336_201_1208 307
299 3300049741 Ga0501079_0015724 Ga0501079_0015724_1594_2601 307
300 3300049742 Ga0501080_0125007 Ga0501080_0125007_1336_2343 307
301 3300049744 Ga0501083_0167679 Ga0501083_0167679_18_1025 307
302 3300049822 Ga0501035_0000624 Ga0501035_0000624_27848_28855 307
303 3300049823 Ga0501044_0004307 Ga0501044_0004307_6205_7212 307
304 3300049824 Ga0501045_0008143 Ga0501045_0008143_4830_5837 307
305 3300050490 nmdc:mga03n38_15401_c1 nmdc:mga03n38_15401_c1_1429_2460 307
306 3300054114 Ga0501084_0112056 Ga0501084_0112056_861_1868 307
307 3300060353 Ga0501082_0035952 Ga0501082_0035952_42_1049 307
308 iso_pu_bacteria 2884994152 2884996567 307
309 iso_pu_bacteria 3006486233 3006487819 307
310 3300005329 Ga0070683_100065686 Ga0070683_1000656862 308
311 3300005341 Ga0070691_10119624 Ga0070691_101196242 308
312 3300005354 Ga0070675_100192229 Ga0070675_1001922291 308
313 3300005365 Ga0070688_100053736 Ga0070688_1000537363 308
314 3300005366 Ga0070659_100145046 Ga0070659_1001450462 308
315 3300005535 Ga0070684_100103256 Ga0070684_1001032562 308
316 3300005615 Ga0070702_100134686 Ga0070702_1001346862 308
317 3300005617 Ga0068859_100158626 Ga0068859_1001586263 308
318 3300005719 Ga0068861_100030751 Ga0068861_1000307512 308
319 3300005719 Ga0068861_100089122 Ga0068861_1000891222 308
320 3300005840 Ga0068870_10068201 Ga0068870_100682012 308
321 3300005842 Ga0068858_100093228 Ga0068858_1000932282 308
322 3300005843 Ga0068860_100116109 Ga0068860_1001161093 308
323 3300005843 Ga0068860_100324191 Ga0068860_1003241912 308
324 3300005844 Ga0068862_100013080 Ga0068862_1000130802 308
325 3300006038 Ga0075365_10003457 Ga0075365_100034578 308
326 3300006038 Ga0075365_10014051 Ga0075365_100140512 308
327 3300006042 Ga0075368_10001969 Ga0075368_100019692 308
328 3300006051 Ga0075364_10029040 Ga0075364_100290403 308
329 3300006051 Ga0075364_10033284 Ga0075364_100332843 308
330 3300006178 Ga0075367_10009804 Ga0075367_100098043 308
331 3300006353 Ga0075370_10035918 Ga0075370_100359183 308
332 3300006881 Ga0068865_100007819 Ga0068865_1000078193 308
333 3300006931 Ga0097620_100158630 Ga0097620_1001586302 308
334 3300009098 Ga0105245_10051980 Ga0105245_100519803 308
335 3300009098 Ga0105245_10134768 Ga0105245_101347682 308
336 3300009176 Ga0105242_10020802 Ga0105242_100208024 308
337 3300009177 Ga0105248_10027074 Ga0105248_100270749 308
338 3300013250 Ga0171462_1002 Ga0171462_1002710 308
339 3300014325 Ga0163163_10060946 Ga0163163_100609464 308
340 3300014326 Ga0157380_10057223 Ga0157380_100572232 308
341 3300014969 Ga0157376_10099232 Ga0157376_100992322 308
342 3300025927 Ga0207687_10169874 Ga0207687_101698742 308
343 3300025927 Ga0207687_10223475 Ga0207687_102234752 308
344 3300025941 Ga0207711_10180503 Ga0207711_101805032 308
345 3300025942 Ga0207689_10225409 Ga0207689_102254091 308
346 3300025961 Ga0207712_10058580 Ga0207712_100585803 308
347 3300026035 Ga0207703_10188406 Ga0207703_101884062 308
348 3300026118 Ga0207675_100129150 Ga0207675_1001291502 308
349 3300026118 Ga0207675_100264257 Ga0207675_1002642572 308
350 3300026121 Ga0207683_10312490 Ga0207683_103124902 308
351 3300028381 Ga0268264_10153752 Ga0268264_101537522 308
352 3300028573 Ga0265334_10000840 Ga0265334_100008403 308
353 3300032002 Ga0307416_100160049 Ga0307416_1001600492 308
354 3300046455 Ga0495603_0001527 Ga0495603_0001527_8401_9411 308
355 3300048905 Ga0496102_0046872 Ga0496102_0046872_1096_2157 308
356 3300048908 Ga0496105_0031368 Ga0496105_0031368_1879_2889 308
357 3300048911 Ga0496108_0047473 Ga0496108_0047473_228_1238 308
358 3300048912 Ga0496109_0163044 Ga0496109_0163044_683_1744 308
359 3300048916 Ga0496113_0067812 Ga0496113_0067812_531_1592 308
360 3300050491 nmdc:mga00v17_2217_c1 nmdc:mga00v17_2217_c1_362_1387 308
361 3300050491 nmdc:mga00v17_224020_c1 nmdc:mga00v17_224020_c1_62_1087 308
362 3300050492 nmdc:mga0yw44_16531_c1 nmdc:mga0yw44_16531_c1_1651_2676 308
363 3300050492 nmdc:mga0yw44_66056_c1 nmdc:mga0yw44_66056_c1_1154_2179 308
364 3300050493 nmdc:mga0k408_93731_c1 nmdc:mga0k408_93731_c1_521_1546 308
365 3300050494 nmdc:mga06z11_11587_c1 nmdc:mga06z11_11587_c1_619_1644 308
366 iso_pu_bacteria 2554235005 2554260955 308
367 3300005355 Ga0070671_100038721 Ga0070671_1000387213 309
368 3300049569 Ga0501032_0029815 Ga0501032_0029815_2466_3482 310
369 3300049570 Ga0501033_0048991 Ga0501033_0048991_340_1356 310
370 3300049571 Ga0501034_0077891 Ga0501034_0077891_645_1661 310
371 3300049572 Ga0501036_0101508 Ga0501036_0101508_222_1238 310
372 3300002073 JGI24745J21846_1002465 JGI24745J21846_10024652 311
373 3300005328 Ga0070676_10037849 Ga0070676_100378492 311
374 3300005337 Ga0070682_100153768 Ga0070682_1001537682 311
375 3300005338 Ga0068868_100269373 Ga0068868_1002693731 311
376 3300005345 Ga0070692_10044756 Ga0070692_100447562 311
377 3300005347 Ga0070668_100047427 Ga0070668_1000474272 311
378 3300005354 Ga0070675_100089351 Ga0070675_1000893512 311
379 3300005356 Ga0070674_100139012 Ga0070674_1001390122 311
380 3300005366 Ga0070659_100192583 Ga0070659_1001925831 311
381 3300005438 Ga0070701_10189400 Ga0070701_101894001 311
382 3300005455 Ga0070663_100108496 Ga0070663_1001084962 311
383 3300005456 Ga0070678_100271957 Ga0070678_1002719572 311
384 3300005457 Ga0070662_100030352 Ga0070662_1000303522 311
385 3300005547 Ga0070693_100052125 Ga0070693_1000521252 311
386 3300005548 Ga0070665_100209616 Ga0070665_1002096162 311
387 3300005577 Ga0068857_100230044 Ga0068857_1002300442 311
388 3300005614 Ga0068856_100182433 Ga0068856_1001824332 311
389 3300005618 Ga0068864_100265964 Ga0068864_1002659642 311
390 3300005718 Ga0068866_10051283 Ga0068866_100512832 311
391 3300005844 Ga0068862_100014389 Ga0068862_1000143895 311
392 3300006028 Ga0070717_10247879 Ga0070717_102478792 311
393 3300006237 Ga0097621_100189691 Ga0097621_1001896912 311
394 3300009094 Ga0111539_10504748 Ga0111539_105047482 311
395 3300009098 Ga0105245_10080550 Ga0105245_100805502 311
396 3300009101 Ga0105247_10038994 Ga0105247_100389942 311
397 3300009545 Ga0105237_10049518 Ga0105237_100495183 311
398 3300009553 Ga0105249_10181699 Ga0105249_101816992 311
399 3300013102 Ga0157371_10127132 Ga0157371_101271322 311
400 3300014325 Ga0163163_10248329 Ga0163163_102483292 311
401 3300014745 Ga0157377_10072633 Ga0157377_100726332 311
402 3300014968 Ga0157379_10113824 Ga0157379_101138242 311
403 3300025321 Ga0207656_10007360 Ga0207656_100073604 311
404 3300025899 Ga0207642_10015525 Ga0207642_100155252 311
405 3300025901 Ga0207688_10011849 Ga0207688_100118494 311
406 3300025907 Ga0207645_10007002 Ga0207645_100070024 311
407 3300025908 Ga0207643_10010903 Ga0207643_100109032 311
408 3300025914 Ga0207671_10202174 Ga0207671_102021742 311
409 3300025918 Ga0207662_10011682 Ga0207662_100116824 311
410 3300025919 Ga0207657_10033266 Ga0207657_100332662 311
411 3300025933 Ga0207706_10025542 Ga0207706_100255424 311
412 3300025940 Ga0207691_10086299 Ga0207691_100862993 311
413 3300025972 Ga0207668_10044787 Ga0207668_100447872 311
414 3300026067 Ga0207678_10020295 Ga0207678_100202953 311
415 3300026088 Ga0207641_10373207 Ga0207641_103732071 311
416 3300026089 Ga0207648_10039943 Ga0207648_100399433 311
417 3300026095 Ga0207676_10109667 Ga0207676_101096671 311
418 3300026116 Ga0207674_10039401 Ga0207674_100394013 311
419 3300026118 Ga0207675_100084696 Ga0207675_1000846962 311
420 3300026121 Ga0207683_10058703 Ga0207683_100587032 311
421 3300028380 Ga0268265_10095423 Ga0268265_100954232 311
422 3300048904 Ga0496101_0199180 Ga0496101_0199180_178_1197 311
423 3300048914 Ga0496111_0115236 Ga0496111_0115236_830_1849 311
424 3300048918 Ga0496115_0130432 Ga0496115_0130432_659_1678 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

87

357

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.4911 12 277
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4837 47 305
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.473 47 305
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4719 20 300
5b57-assembly1.cif.gz_A inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.4631 20 275
ID Description Score Start End Superfamily
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9128 47 299 1.10.3470.10
af_P0AGI4_56_383_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.898 49 300 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.888 47 300 1.10.3470.10
af_P77315_52_317_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8784 48 300 1.10.3470.10
af_P0AE26_50_315_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8711 47 300 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A847G1R5-F1-model_v4 Sugar ABC transporter permease YjfF 0.9579 13 309 GO:0005886
GO:0022857
AF-A0A290QG31-F1-model_v4 Sugar ABC transporter permease YjfF 0.955 11 309 GO:0005886
GO:0022857
AF-A0A0Q5W849-F1-model_v4 ABC transporter permease 0.9436 10 309 GO:0005886
GO:0022857
AF-A0A6I2UDV7-F1-model_v4 Sugar ABC transporter permease YjfF 0.9391 17 311 GO:0005886
GO:0022857
AF-A0A2R4FUE9-F1-model_v4 Sugar ABC transporter permease YjfF 0.9386 14 311 GO:0005886
GO:0022857

Feature Viewer

pLDDT pTM Quality
77.48 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map