F440852

General Info

Members Datasets Scaffolds Average Seq Length
424 239 848 311

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0010551|Ga0501034_0010551_7763_8767
Length 334
Sequence MSAQESGTMQHDTTDVGAAATATAPPDDRPQPVDLSVRIGSLTLANPVMSASGCFGYGVEYAGVVDLASLGAVVVKGLFLKEREGHRAPRIVETPAGMINAIGLQGIGVHRFVSEKLPELRKLGAAVVVNVCGTTVDEYAEVSRILSDAEGVHAIELNISCPNIKEGGIQFGCSLHGTHDVVAAVRKVTSLPLIPKLTPNVTDPASFARAAEEAGADAVSLVNTVLALAIDVETRRPKISNGMGGLSGPAIRPIAVRMVYECRKAVKIPVVGMGGIMDARDALEFIIAGATAVQVGTAAFVDPAVFGKVIDGIRQYSQRHGISRVEDLVGSVEM

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
134 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
139 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
234 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
237 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 5.19
Rhizosphere 93.16
Stem 0
Stem Tuber 0
Unclassified 0.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0010551 3300049571 Bacteria 9619
2 JGI24751J29686_10010403 3300002459 Bacteria 1918
3 Ga0065712_10006799 3300005290 Bacteria 2764
4 Ga0065707_10003814 3300005295 Bacteria 5235
5 Ga0070676_10002123 3300005328 Bacteria 10091
6 Ga0070690_100037059 3300005330 Bacteria 3071
7 Ga0070690_100131118 3300005330 Bacteria 1693
8 Ga0068869_100054963 3300005334 Bacteria 2900
9 Ga0070666_10016621 3300005335 Bacteria 4709
10 Ga0070680_100051097 3300005336 Bacteria 3373
11 Ga0070680_100160423 3300005336 Bacteria 1890
12 Ga0068868_100331248 3300005338 Bacteria 1299
13 Ga0070660_100017376 3300005339 Bacteria 5243
14 Ga0070689_100242833 3300005340 Bacteria 1484
15 Ga0070692_10284741 3300005345 Bacteria 1003
16 Ga0070669_100007608 3300005353 Bacteria 7744
17 Ga0070669_100011365 3300005353 Bacteria 6321
18 Ga0070669_100048924 3300005353 Bacteria 3086
19 Ga0070675_100108588 3300005354 Bacteria 2343
20 Ga0070674_100002917 3300005356 Bacteria 9475
21 Ga0070674_100063280 3300005356 Bacteria 2588
22 Ga0070673_100086087 3300005364 Bacteria 2560
23 Ga0070688_100165359 3300005365 Bacteria 1523
24 Ga0070667_100006439 3300005367 Bacteria 9758
25 Ga0070667_100088833 3300005367 Bacteria 2654
26 Ga0070709_10232800 3300005434 Bacteria 1319
27 Ga0070710_10109224 3300005437 Bacteria 1659
28 Ga0070701_10005304 3300005438 Bacteria 5309
29 Ga0070711_100270773 3300005439 Bacteria 1340
30 Ga0070705_100014632 3300005440 Bacteria 4042
31 Ga0070700_100089772 3300005441 Bacteria 2003
32 Ga0070700_100102802 3300005441 Bacteria 1885
33 Ga0070678_100237349 3300005456 Bacteria 1523
34 Ga0068867_100008411 3300005459 Bacteria 7277
35 Ga0070685_10074250 3300005466 Bacteria 2023
36 Ga0070698_100009315 3300005471 Bacteria 10532
37 Ga0070698_100276115 3300005471 Bacteria 1612
38 Ga0070699_100002875 3300005518 Bacteria 15347
39 Ga0070699_100244942 3300005518 Bacteria 1601
40 Ga0070679_100029229 3300005530 Bacteria 5438
41 Ga0068853_100469213 3300005539 Bacteria 1185
42 Ga0070672_100161736 3300005543 Bacteria 1858
43 Ga0070686_100008065 3300005544 Bacteria 5882
44 Ga0070686_100273478 3300005544 Bacteria 1243
45 Ga0070695_100004882 3300005545 Bacteria 7896
46 Ga0070665_100050408 3300005548 Bacteria 4177
47 Ga0070704_100037181 3300005549 Bacteria 3324
48 Ga0070704_100082195 3300005549 Bacteria 2375
49 Ga0070704_100108400 3300005549 Bacteria 2108
50 Ga0068855_100019893 3300005563 Bacteria 8062
51 Ga0068855_100217377 3300005563 Bacteria 2145
52 Ga0068855_100656147 3300005563 Bacteria 1126
53 Ga0068857_100237186 3300005577 Bacteria 1669
54 Ga0068856_100116016 3300005614 Bacteria 2678
55 Ga0068859_100028541 3300005617 Bacteria 5594
56 Ga0068859_100032621 3300005617 Bacteria 5231
57 Ga0068859_100066192 3300005617 Bacteria 3648
58 Ga0068859_100424460 3300005617 Bacteria 1426
59 Ga0068864_100011593 3300005618 Bacteria 7280
60 Ga0068864_100023260 3300005618 Bacteria 5202
61 Ga0068864_100251298 3300005618 Unclassified 1642
62 Ga0068861_100004525 3300005719 Bacteria 9334
63 Ga0068863_100014185 3300005841 Bacteria 7676
64 Ga0068863_100018670 3300005841 Bacteria 6636
65 Ga0068863_100063938 3300005841 Bacteria 3480
66 Ga0068858_100040952 3300005842 Bacteria 4297
67 Ga0068858_100067587 3300005842 Bacteria 3311
68 Ga0068858_100128283 3300005842 Bacteria 2377
69 Ga0068858_100354821 3300005842 Bacteria 1405
70 Ga0068858_100408668 3300005842 Bacteria 1305
71 Ga0068860_100018514 3300005843 Bacteria 6774
72 Ga0068860_100030430 3300005843 Bacteria 5192
73 Ga0068862_100090095 3300005844 Bacteria 2669
74 Ga0068862_100281187 3300005844 Bacteria 1525
75 Ga0081455_10075308 3300005937 Bacteria 2785
76 Ga0081539_10059097 3300005985 Bacteria 2112
77 Ga0075364_10068626 3300006051 Bacteria 2332
78 Ga0097621_100005792 3300006237 Bacteria 8726
79 Ga0075428_100017213 3300006844 Bacteria 7988
80 Ga0075428_100218498 3300006844 Bacteria 2058
81 Ga0075428_100227681 3300006844 Bacteria 2012
82 Ga0075428_100381539 3300006844 Bacteria 1511
83 Ga0075431_100045676 3300006847 Bacteria 4516
84 Ga0075433_10017447 3300006852 Bacteria 5945
85 Ga0075433_10052737 3300006852 Bacteria 3544
86 Ga0075434_100000049 3300006871 Bacteria 57417
87 Ga0075434_100020397 3300006871 Bacteria 6429
88 Ga0075434_100026242 3300006871 Bacteria 5706
89 Ga0075434_100034882 3300006871 Bacteria 4972
90 Ga0075434_100046088 3300006871 Bacteria 4327
91 Ga0075434_100065845 3300006871 Bacteria 3609
92 Ga0075429_100171129 3300006880 Bacteria 1902
93 Ga0075436_100001894 3300006914 Bacteria 14378
94 Ga0075436_100016643 3300006914 Bacteria 5033
95 Ga0075436_100022587 3300006914 Bacteria 4320
96 Ga0075436_100087257 3300006914 Bacteria 2167
97 Ga0097620_100028541 3300006931 Bacteria 5594
98 Ga0097620_100032620 3300006931 Bacteria 5231
99 Ga0097620_100066190 3300006931 Bacteria 3648
100 Ga0097620_100424463 3300006931 Bacteria 1426
101 Ga0075435_100000059 3300007076 Bacteria 56189
102 Ga0075435_100003706 3300007076 Bacteria 10404
103 Ga0075435_100009328 3300007076 Bacteria 7097
104 Ga0075435_100015709 3300007076 Bacteria 5696
105 Ga0075435_100088093 3300007076 Bacteria 2558
106 Ga0075435_100153889 3300007076 Bacteria 1934
107 Ga0075435_100329320 3300007076 Bacteria 1308
108 Ga0105240_10010582 3300009093 Bacteria 12960
109 Ga0105240_10132503 3300009093 Bacteria 2988
110 Ga0111539_10004585 3300009094 Bacteria 18059
111 Ga0111539_10020867 3300009094 Bacteria 8066
112 Ga0111539_10052592 3300009094 Bacteria 4848
113 Ga0111539_10199719 3300009094 Bacteria 2332
114 Ga0105247_10002398 3300009101 Bacteria 12740
115 Ga0105247_10116395 3300009101 Bacteria 1726
116 Ga0114129_10017217 3300009147 Bacteria 10294
117 Ga0114129_10021242 3300009147 Bacteria 9218
118 Ga0114129_10022608 3300009147 Bacteria 8919
119 Ga0114129_10102460 3300009147 Bacteria 3959
120 Ga0114129_10118881 3300009147 Bacteria 3640
121 Ga0114129_10220403 3300009147 Bacteria 2559
122 Ga0114129_10308749 3300009147 Bacteria 2106
123 Ga0114129_10390688 3300009147 Bacteria 1835
124 Ga0105243_10007955 3300009148 Bacteria 8145
125 Ga0105241_10016316 3300009174 Bacteria 5444
126 Ga0105242_10568581 3300009176 Bacteria 1090
127 Ga0105248_10003876 3300009177 Bacteria 16536
128 Ga0105248_10008887 3300009177 Bacteria 11042
129 Ga0105248_10020544 3300009177 Bacteria 7319
130 Ga0105248_10126554 3300009177 Bacteria 2882
131 Ga0105248_10155487 3300009177 Bacteria 2580
132 Ga0105248_10192171 3300009177 Bacteria 2300
133 Ga0105248_10230856 3300009177 Bacteria 2083
134 Ga0105248_10278956 3300009177 Bacteria 1881
135 Ga0105248_10659978 3300009177 Bacteria 1180
136 Ga0105237_10450411 3300009545 Bacteria 1293
137 Ga0105249_10093544 3300009553 Bacteria 2816
138 Ga0105246_10096797 3300011119 Bacteria 2140
139 Ga0157378_10010449 3300013297 Bacteria 8108
140 Ga0157378_10055148 3300013297 Bacteria 3540
141 Ga0163162_10416715 3300013306 Bacteria 1475
142 Ga0157375_10133429 3300013308 Bacteria 2604
143 Ga0163163_10032474 3300014325 Bacteria 5041
144 Ga0163163_10154737 3300014325 Bacteria 2337
145 Ga0163163_10186487 3300014325 Bacteria 2122
146 Ga0157380_10003100 3300014326 Bacteria 11337
147 Ga0157376_10521092 3300014969 Bacteria 1172
148 Ga0207680_10008779 3300025903 Bacteria 4980
149 Ga0207699_10017733 3300025906 Bacteria 3756
150 Ga0207645_10004578 3300025907 Bacteria 10197
151 Ga0207643_10013797 3300025908 Bacteria 4385
152 Ga0207705_10063018 3300025909 Bacteria 2678
153 Ga0207654_10035570 3300025911 Bacteria 2776
154 Ga0207707_10306176 3300025912 Bacteria 1373
155 Ga0207695_10072154 3300025913 Bacteria 3524
156 Ga0207695_10103634 3300025913 Bacteria 2836
157 Ga0207663_10260223 3300025916 Bacteria 1281
158 Ga0207660_10022618 3300025917 Bacteria 4236
159 Ga0207662_10041199 3300025918 Bacteria 2718
160 Ga0207662_10124012 3300025918 Bacteria 1622
161 Ga0207657_10008776 3300025919 Bacteria 10231
162 Ga0207681_10006546 3300025923 Bacteria 7147
163 Ga0207681_10011894 3300025923 Bacteria 5357
164 Ga0207650_10020289 3300025925 Bacteria 4685
165 Ga0207687_10111406 3300025927 Bacteria 2032
166 Ga0207644_10011969 3300025931 Bacteria 5753
167 Ga0207706_10133610 3300025933 Bacteria 2182
168 Ga0207686_10056398 3300025934 Bacteria 2469
169 Ga0207709_10133265 3300025935 Bacteria 1696
170 Ga0207670_10121682 3300025936 Bacteria 1898
171 Ga0207669_10023701 3300025937 Bacteria 3284
172 Ga0207669_10029466 3300025937 Bacteria 3036
173 Ga0207669_10268095 3300025937 Bacteria 1281
174 Ga0207704_10091077 3300025938 Bacteria 2003
175 Ga0207704_10123127 3300025938 Bacteria 1779
176 Ga0207691_10048454 3300025940 Bacteria 3896
177 Ga0207691_10227376 3300025940 Bacteria 1616
178 Ga0207711_10101485 3300025941 Bacteria 2546
179 Ga0207711_10113719 3300025941 Bacteria 2410
180 Ga0207711_10116640 3300025941 Bacteria 2381
181 Ga0207711_10149760 3300025941 Bacteria 2105
182 Ga0207711_10187800 3300025941 Bacteria 1882
183 Ga0207711_10322711 3300025941 Bacteria 1427
184 Ga0207689_10061639 3300025942 Bacteria 3085
185 Ga0207679_10229310 3300025945 Bacteria 1567
186 Ga0207667_10080830 3300025949 Bacteria 3367
187 Ga0207651_10074629 3300025960 Bacteria 2416
188 Ga0207651_10212623 3300025960 Bacteria 1558
189 Ga0207651_10246676 3300025960 Bacteria 1459
190 Ga0207651_10451513 3300025960 Bacteria 1103
191 Ga0207712_10192671 3300025961 Bacteria 1610
192 Ga0207712_10255967 3300025961 Bacteria 1417
193 Ga0207668_10151184 3300025972 Bacteria 1797
194 Ga0207658_10088957 3300025986 Bacteria 2389
195 Ga0207703_10236439 3300026035 Bacteria 1640
196 Ga0207703_10349413 3300026035 Bacteria 1361
197 Ga0207639_10062227 3300026041 Bacteria 2885
198 Ga0207678_10035993 3300026067 Bacteria 4309
199 Ga0207708_10002562 3300026075 Bacteria 13377
200 Ga0207708_10005924 3300026075 Bacteria 9042
201 Ga0207641_10002783 3300026088 Bacteria 15931
202 Ga0207641_10046901 3300026088 Bacteria 3643
203 Ga0207641_10063782 3300026088 Bacteria 3148
204 Ga0207648_10014339 3300026089 Bacteria 7327
205 Ga0207648_10186684 3300026089 Bacteria 1836
206 Ga0207676_10020821 3300026095 Bacteria 4804
207 Ga0207676_10036827 3300026095 Bacteria 3724
208 Ga0207676_10584211 3300026095 Bacteria 1071
209 Ga0207674_10222850 3300026116 Bacteria 1834
210 Ga0207675_100009065 3300026118 Bacteria 9337
211 Ga0207675_100253982 3300026118 Bacteria 1702
212 Ga0207683_10171373 3300026121 Bacteria 1966
213 Ga0207428_10026719 3300027907 Bacteria 4813
214 Ga0207428_10097139 3300027907 Bacteria 2280
215 Ga0207428_10177841 3300027907 Bacteria 1608
216 Ga0268266_10068621 3300028379 Bacteria 3070
217 Ga0268265_10006332 3300028380 Bacteria 8022
218 Ga0268265_10072077 3300028380 Bacteria 2693
219 Ga0268265_10084133 3300028380 Bacteria 2521
220 Ga0268265_10121335 3300028380 Bacteria 2154
221 Ga0268264_10034554 3300028381 Bacteria 4159
222 Ga0268264_10040506 3300028381 Bacteria 3849
223 Ga0268264_10389839 3300028381 Bacteria 1336
224 Ga0265314_10036972 3300031711 Bacteria 3542
225 Ga0316577_10031556 3300031733 Bacteria 2960
226 Ga0307413_10001004 3300031824 Bacteria 10190
227 Ga0307410_10001006 3300031852 Bacteria 12208
228 Ga0307406_10004707 3300031901 Bacteria 7437
229 Ga0307407_10098576 3300031903 Bacteria 1808
230 Ga0307407_10117026 3300031903 Bacteria 1683
231 Ga0307407_10176562 3300031903 Bacteria 1412
232 Ga0307412_10004176 3300031911 Bacteria 8052
233 Ga0307409_100350178 3300031995 Bacteria 1393
234 Ga0307416_100016690 3300032002 Bacteria 5112
235 Ga0307416_100125638 3300032002 Bacteria 2297
236 Ga0307414_10002517 3300032004 Bacteria 9617
237 Ga0307414_10074253 3300032004 Bacteria 2463
238 Ga0307411_10003322 3300032005 Bacteria 7441
239 Ga0307411_10005163 3300032005 Bacteria 6382
240 Ga0373930_0005511 3300034816 Bacteria 2109
241 Ga0373948_0005333 3300034817 Bacteria 2079
242 Ga0373950_0002298 3300034818 Bacteria 2620
243 Ga0373958_0005804 3300034819 Bacteria 1894
244 Ga0373938_0002129 3300034957 Bacteria 3181
245 Ga0373929_0003561 3300035085 Bacteria 2796
246 Ga0373934_0078341 3300035086 Bacteria 1326
247 Ga0373940_0001435 3300035088 Bacteria 4307
248 Ga0373949_0002212 3300035090 Bacteria 5091
249 Ga0373951_0004494 3300035091 Bacteria 3308
250 Ga0373951_0013494 3300035091 Bacteria 1837
251 Ga0373952_0001897 3300035092 Bacteria 3795
252 Ga0373952_0029263 3300035092 Bacteria 1213
253 Ga0373923_0037862 3300035111 Bacteria 1974
254 Ga0373923_0102145 3300035111 Bacteria 1266
255 Ga0373932_0011991 3300035112 Bacteria 2128
256 Ga0373939_0000434 3300035114 Bacteria 10521
257 Ga0373939_0044007 3300035114 Bacteria 1357
258 Ga0373941_0003390 3300035115 Bacteria 3607
259 Ga0373960_0000610 3300035121 Bacteria 7315
260 Ga0373943_0003364 3300035170 Bacteria 7268
261 Ga0373946_0001638 3300035171 Bacteria 7812
262 Ga0373955_0012285 3300035172 Bacteria 4113
263 Ga0373955_0124339 3300035172 Bacteria 1502
264 Ga0373961_0008433 3300035241 Bacteria 2505
265 Ga0373961_0009343 3300035241 Bacteria 2399
266 Ga0373962_0003286 3300035242 Bacteria 3889
267 Ga0373924_0008308 3300035410 Bacteria 3768
268 Ga0373931_0001463 3300035691 Bacteria 10161
269 Ga0373935_0012577 3300035692 Bacteria 5093
270 Ga0373935_0170387 3300035692 Bacteria 1489
271 Ga0373927_0160635 3300035695 Bacteria 1472
272 Ga0373933_0364408 3300035724 Bacteria 940
273 Ga0373947_0002247 3300035725 Bacteria 11672
274 Ga0373947_0115809 3300035725 Bacteria 1699
275 Ga0373947_0205052 3300035725 Bacteria 1291
276 Ga0316584_0001977 3300036712 Bacteria 12799
277 Ga0316584_0204175 3300036712 Unclassified 1457
278 Ga0373925_0034947 3300037068 Bacteria 3706
279 Ga0450923_010802 3300042125 Bacteria 1629
280 Ga0451577_0034950 3300042876 Bacteria 4528
281 Ga0466963_0143756 3300044694 Bacteria 1654
282 Ga0451576_0022386 3300045051 Bacteria 6851
283 Ga0451576_0066814 3300045051 Bacteria 3743
284 Ga0451576_0097311 3300045051 Bacteria 3061
285 Ga0451576_0550538 3300045051 Bacteria 1212
286 Ga0495653_0075967 3300046463 Bacteria 2499
287 Ga0495582_0041023 3300046473 Bacteria 2550
288 Ga0495582_0157488 3300046473 Bacteria 1291
289 Ga0495608_0145197 3300046511 Bacteria 1513
290 Ga0495630_0002524 3300046517 Bacteria 12693
291 Ga0495652_0259334 3300046529 Bacteria 1284
292 Ga0495640_0046999 3300046533 Bacteria 2988
293 Ga0495640_0077506 3300046533 Bacteria 2216
294 Ga0495645_0019441 3300046543 Bacteria 4890
295 Ga0495667_0034655 3300046559 Bacteria 3376
296 Ga0495635_0174344 3300046663 Bacteria 1462
297 Ga0495659_0005863 3300046664 Bacteria 3879
298 Ga0495623_0065692 3300046679 Bacteria 2268
299 Ga0495647_0019102 3300046681 Bacteria 2448
300 Ga0495647_0185116 3300046681 Bacteria 908
301 Ga0495658_0068898 3300046683 Bacteria 2050
302 Ga0495669_0009314 3300046684 Bacteria 4138
303 Ga0495669_0011753 3300046684 Bacteria 3721
304 Ga0495613_0001120 3300046689 Bacteria 20390
305 Ga0495600_0066250 3300046809 Bacteria 2361
306 Ga0495581_0052709 3300047315 Unclassified 2350
307 Ga0495604_0026845 3300047317 Bacteria 4583
308 Ga0495674_0101495 3300047319 Bacteria 2447
309 Ga0495674_0164021 3300047319 Unclassified 1858
310 Ga0495676_0179239 3300047321 Bacteria 1486
311 Ga0495684_0021910 3300047471 Bacteria 4920
312 Ga0496100_0301727 3300048903 Bacteria 1199
313 Ga0496101_0001528 3300048904 Bacteria 13862
314 Ga0496102_0026333 3300048905 Bacteria 5186
315 Ga0496104_0125618 3300048907 Bacteria 2463
316 Ga0496104_0197061 3300048907 Bacteria 1926
317 Ga0496105_0079713 3300048908 Bacteria 2704
318 Ga0496105_0263231 3300048908 Bacteria 1394
319 Ga0496106_0072661 3300048909 Bacteria 2631
320 Ga0496107_0042790 3300048910 Bacteria 3253
321 Ga0496107_0111709 3300048910 Bacteria 2009
322 Ga0496107_0261832 3300048910 Bacteria 1287
323 Ga0496108_0223899 3300048911 Bacteria 1635
324 Ga0496108_0285199 3300048911 Bacteria 1437
325 Ga0496109_0069606 3300048912 Bacteria 3228
326 Ga0496110_0038510 3300048913 Bacteria 4161
327 Ga0496110_0445119 3300048913 Bacteria 1181
328 Ga0496112_0005789 3300048915 Bacteria 10751
329 Ga0496112_0046821 3300048915 Bacteria 4243
330 Ga0496112_0077313 3300048915 Bacteria 3291
331 Ga0496113_0096068 3300048916 Bacteria 2291
332 Ga0496113_0344892 3300048916 Bacteria 1194
333 Ga0496114_0000958 3300048917 Bacteria 21594
334 Ga0501032_0151699 3300049569 Bacteria 1523
335 Ga0501034_0005502 3300049571 Bacteria 13822
336 Ga0501034_0132478 3300049571 Bacteria 2475
337 Ga0501034_0285480 3300049571 Bacteria 1589
338 Ga0501036_0075594 3300049572 Bacteria 2848
339 Ga0501036_0159703 3300049572 Bacteria 1901
340 Ga0501037_0032482 3300049573 Bacteria 3854
341 Ga0501038_0060471 3300049574 Bacteria 3242
342 Ga0501040_0142819 3300049576 Bacteria 1687
343 Ga0501040_0188742 3300049576 Bacteria 1462
344 Ga0501043_0001097 3300049579 Bacteria 23794
345 Ga0501043_0111545 3300049579 Bacteria 2147
346 Ga0501043_0123951 3300049579 Bacteria 2026
347 Ga0501046_0018474 3300049580 Bacteria 5800
348 Ga0501047_0000303 3300049581 Bacteria 56793
349 Ga0501047_0023638 3300049581 Bacteria 5900
350 Ga0501047_0166492 3300049581 Bacteria 2074
351 Ga0501067_0009850 3300049583 Bacteria 5292
352 Ga0501068_0185697 3300049584 Bacteria 1315
353 Ga0501069_0035963 3300049585 Bacteria 2729
354 Ga0501072_0144523 3300049588 Bacteria 1897
355 Ga0501072_0148909 3300049588 Bacteria 1866
356 Ga0501072_0250488 3300049588 Bacteria 1410
357 Ga0501073_0047002 3300049589 Bacteria 3034
358 Ga0501073_0059195 3300049589 Bacteria 2676
359 Ga0501073_0189115 3300049589 Bacteria 1424
360 Ga0501073_0268419 3300049589 Bacteria 1177
361 Ga0501074_0172720 3300049590 Bacteria 1542
362 Ga0501074_0228254 3300049590 Bacteria 1325
363 Ga0501075_0084145 3300049591 Bacteria 2409
364 Ga0501075_0238321 3300049591 Bacteria 1387
365 Ga0501076_0015523 3300049592 Bacteria 5759
366 Ga0501076_0017133 3300049592 Bacteria 5504
367 Ga0501076_0128807 3300049592 Bacteria 2052
368 Ga0501076_0316637 3300049592 Bacteria 1280
369 Ga0501077_0070951 3300049593 Bacteria 2208
370 Ga0501080_0024504 3300049742 Bacteria 5593
371 Ga0501081_0119463 3300049743 Bacteria 1876
372 Ga0501083_0004890 3300049744 Bacteria 9475
373 Ga0501044_0015181 3300049823 Bacteria 8296
374 nmdc:mga00v17_171936_c1 3300050491 Bacteria 1397
375 nmdc:mga05p37_1529_c1 3300050507 Bacteria 26922
376 nmdc:mga05p37_183171_c1 3300050507 Bacteria 2547
377 nmdc:mga05p37_184585_c1 3300050507 Bacteria 2536
378 nmdc:mga05p37_190092_c1 3300050507 Bacteria 2493
379 nmdc:mga05p37_729844_c1 3300050507 Bacteria 1095
380 nmdc:mga05p37_8731_c1 3300050507 Bacteria 11967
381 nmdc:mga06r32_31156_c2 3300050510 Bacteria 4325
382 nmdc:mga06r32_642834_c1 3300050510 Bacteria 1029
383 nmdc:mga08y16_176336_c1 3300050511 Bacteria 2220
384 nmdc:mga08y16_260428_c1 3300050511 Bacteria 1791
385 nmdc:mga08y16_36234_c1 3300050511 Bacteria 5181
386 nmdc:mga08y16_683_c1 3300050511 Bacteria 32086
387 nmdc:mga08y16_83639_c1 3300050511 Bacteria 3326
388 nmdc:mga0n895_115434_c1 3300050512 Bacteria 2703
389 nmdc:mga0n895_131852_c1 3300050512 Bacteria 2524
390 nmdc:mga0n895_44575_c1 3300050512 Bacteria 4325
391 nmdc:mga0n895_58275_c1 3300050512 Bacteria 3807
392 nmdc:mga0n895_64245_c1 3300050512 Bacteria 3631
393 nmdc:mga0n895_74512_c1 3300050512 Bacteria 3372
394 nmdc:mga0n895_95_c1 3300050512 Bacteria 52030
395 nmdc:mga0rr50_122062_c1 3300050513 Bacteria 2076
396 nmdc:mga0rr50_1294_c1 3300050513 Bacteria 13637
397 nmdc:mga0rr50_249285_c1 3300050513 Bacteria 1474
398 nmdc:mga0rr50_265229_c1 3300050513 Bacteria 1430
399 nmdc:mga0rr50_28_c1 3300050513 Bacteria 108950
400 nmdc:mga0rr50_75991_c1 3300050513 Bacteria 2577
401 nmdc:mga08x19_14474_c1 3300050514 Bacteria 4784
402 nmdc:mga08x19_33744_c1 3300050514 Bacteria 3231
403 nmdc:mga08x19_874_c1 3300050514 Bacteria 19134
404 nmdc:mga0a205_199098_c1 3300050515 Bacteria 1894
405 nmdc:mga0a205_31186_c1 3300050515 Bacteria 5106
406 nmdc:mga0a205_77441_c1 3300050515 Bacteria 3213
407 Ga0495601_0007735 3300053077 Bacteria 6317
408 Ga0495601_0041490 3300053077 Bacteria 2885
409 Ga0495612_0081662 3300053078 Bacteria 1359
410 Ga0495595_0039179 3300053084 Bacteria 2161
411 Ga0495619_0144124 3300053085 Bacteria 1641
412 Ga0500646_0009309 3300053090 Bacteria 2516
413 Ga0500555_000454 3300053103 Bacteria 16963
414 Ga0500555_014905 3300053103 Bacteria 2241
415 Ga0500568_0004656 3300053139 Bacteria 7295
416 Ga0500645_000401 3300053730 Bacteria 30362
417 Ga0501084_0017468 3300054114 Bacteria 5964
418 Ga0501084_0196891 3300054114 Bacteria 1700
419 Ga0501084_0347238 3300054114 Bacteria 1253
420 Ga0501082_0035760 3300060353 Bacteria 4280
421 Ga0501082_0037632 3300060353 Bacteria 4172
422 Ga0530510_0016129 3300061734 Bacteria 5283
423 Ga0530510_0083839 3300061734 Bacteria 2321
424 Ga0530510_0135996 3300061734 Bacteria 1809
425 Ga0501034_0010551
426 JGI24751J29686_10010403
427 Ga0065712_10006799
428 Ga0065707_10003814
429 Ga0070676_10002123
430 Ga0070690_100037059
431 Ga0070690_100131118
432 Ga0068869_100054963
433 Ga0070666_10016621
434 Ga0070680_100051097
435 Ga0070680_100160423
436 Ga0068868_100331248
437 Ga0070660_100017376
438 Ga0070689_100242833
439 Ga0070692_10284741
440 Ga0070669_100007608
441 Ga0070669_100011365
442 Ga0070669_100048924
443 Ga0070675_100108588
444 Ga0070674_100002917
445 Ga0070674_100063280
446 Ga0070673_100086087
447 Ga0070688_100165359
448 Ga0070667_100006439
449 Ga0070667_100088833
450 Ga0070709_10232800
451 Ga0070710_10109224
452 Ga0070701_10005304
453 Ga0070711_100270773
454 Ga0070705_100014632
455 Ga0070700_100089772
456 Ga0070700_100102802
457 Ga0070678_100237349
458 Ga0068867_100008411
459 Ga0070685_10074250
460 Ga0070698_100009315
461 Ga0070698_100276115
462 Ga0070699_100002875
463 Ga0070699_100244942
464 Ga0070679_100029229
465 Ga0068853_100469213
466 Ga0070672_100161736
467 Ga0070686_100008065
468 Ga0070686_100273478
469 Ga0070695_100004882
470 Ga0070665_100050408
471 Ga0070704_100037181
472 Ga0070704_100082195
473 Ga0070704_100108400
474 Ga0068855_100019893
475 Ga0068855_100217377
476 Ga0068855_100656147
477 Ga0068857_100237186
478 Ga0068856_100116016
479 Ga0068859_100028541
480 Ga0068859_100032621
481 Ga0068859_100066192
482 Ga0068859_100424460
483 Ga0068864_100011593
484 Ga0068864_100023260
485 Ga0068864_100251298
486 Ga0068861_100004525
487 Ga0068863_100014185
488 Ga0068863_100018670
489 Ga0068863_100063938
490 Ga0068858_100040952
491 Ga0068858_100067587
492 Ga0068858_100128283
493 Ga0068858_100354821
494 Ga0068858_100408668
495 Ga0068860_100018514
496 Ga0068860_100030430
497 Ga0068862_100090095
498 Ga0068862_100281187
499 Ga0081455_10075308
500 Ga0081539_10059097
501 Ga0075364_10068626
502 Ga0097621_100005792
503 Ga0075428_100017213
504 Ga0075428_100218498
505 Ga0075428_100227681
506 Ga0075428_100381539
507 Ga0075431_100045676
508 Ga0075433_10017447
509 Ga0075433_10052737
510 Ga0075434_100000049
511 Ga0075434_100020397
512 Ga0075434_100026242
513 Ga0075434_100034882
514 Ga0075434_100046088
515 Ga0075434_100065845
516 Ga0075429_100171129
517 Ga0075436_100001894
518 Ga0075436_100016643
519 Ga0075436_100022587
520 Ga0075436_100087257
521 Ga0097620_100028541
522 Ga0097620_100032620
523 Ga0097620_100066190
524 Ga0097620_100424463
525 Ga0075435_100000059
526 Ga0075435_100003706
527 Ga0075435_100009328
528 Ga0075435_100015709
529 Ga0075435_100088093
530 Ga0075435_100153889
531 Ga0075435_100329320
532 Ga0105240_10010582
533 Ga0105240_10132503
534 Ga0111539_10004585
535 Ga0111539_10020867
536 Ga0111539_10052592
537 Ga0111539_10199719
538 Ga0105247_10002398
539 Ga0105247_10116395
540 Ga0114129_10017217
541 Ga0114129_10021242
542 Ga0114129_10022608
543 Ga0114129_10102460
544 Ga0114129_10118881
545 Ga0114129_10220403
546 Ga0114129_10308749
547 Ga0114129_10390688
548 Ga0105243_10007955
549 Ga0105241_10016316
550 Ga0105242_10568581
551 Ga0105248_10003876
552 Ga0105248_10008887
553 Ga0105248_10020544
554 Ga0105248_10126554
555 Ga0105248_10155487
556 Ga0105248_10192171
557 Ga0105248_10230856
558 Ga0105248_10278956
559 Ga0105248_10659978
560 Ga0105237_10450411
561 Ga0105249_10093544
562 Ga0105246_10096797
563 Ga0157378_10010449
564 Ga0157378_10055148
565 Ga0163162_10416715
566 Ga0157375_10133429
567 Ga0163163_10032474
568 Ga0163163_10154737
569 Ga0163163_10186487
570 Ga0157380_10003100
571 Ga0157376_10521092
572 Ga0207680_10008779
573 Ga0207699_10017733
574 Ga0207645_10004578
575 Ga0207643_10013797
576 Ga0207705_10063018
577 Ga0207654_10035570
578 Ga0207707_10306176
579 Ga0207695_10072154
580 Ga0207695_10103634
581 Ga0207663_10260223
582 Ga0207660_10022618
583 Ga0207662_10041199
584 Ga0207662_10124012
585 Ga0207657_10008776
586 Ga0207681_10006546
587 Ga0207681_10011894
588 Ga0207650_10020289
589 Ga0207687_10111406
590 Ga0207644_10011969
591 Ga0207706_10133610
592 Ga0207686_10056398
593 Ga0207709_10133265
594 Ga0207670_10121682
595 Ga0207669_10023701
596 Ga0207669_10029466
597 Ga0207669_10268095
598 Ga0207704_10091077
599 Ga0207704_10123127
600 Ga0207691_10048454
601 Ga0207691_10227376
602 Ga0207711_10101485
603 Ga0207711_10113719
604 Ga0207711_10116640
605 Ga0207711_10149760
606 Ga0207711_10187800
607 Ga0207711_10322711
608 Ga0207689_10061639
609 Ga0207679_10229310
610 Ga0207667_10080830
611 Ga0207651_10074629
612 Ga0207651_10212623
613 Ga0207651_10246676
614 Ga0207651_10451513
615 Ga0207712_10192671
616 Ga0207712_10255967
617 Ga0207668_10151184
618 Ga0207658_10088957
619 Ga0207703_10236439
620 Ga0207703_10349413
621 Ga0207639_10062227
622 Ga0207678_10035993
623 Ga0207708_10002562
624 Ga0207708_10005924
625 Ga0207641_10002783
626 Ga0207641_10046901
627 Ga0207641_10063782
628 Ga0207648_10014339
629 Ga0207648_10186684
630 Ga0207676_10020821
631 Ga0207676_10036827
632 Ga0207676_10584211
633 Ga0207674_10222850
634 Ga0207675_100009065
635 Ga0207675_100253982
636 Ga0207683_10171373
637 Ga0207428_10026719
638 Ga0207428_10097139
639 Ga0207428_10177841
640 Ga0268266_10068621
641 Ga0268265_10006332
642 Ga0268265_10072077
643 Ga0268265_10084133
644 Ga0268265_10121335
645 Ga0268264_10034554
646 Ga0268264_10040506
647 Ga0268264_10389839
648 Ga0265314_10036972
649 Ga0316577_10031556
650 Ga0307413_10001004
651 Ga0307410_10001006
652 Ga0307406_10004707
653 Ga0307407_10098576
654 Ga0307407_10117026
655 Ga0307407_10176562
656 Ga0307412_10004176
657 Ga0307409_100350178
658 Ga0307416_100016690
659 Ga0307416_100125638
660 Ga0307414_10002517
661 Ga0307414_10074253
662 Ga0307411_10003322
663 Ga0307411_10005163
664 Ga0373930_0005511
665 Ga0373948_0005333
666 Ga0373950_0002298
667 Ga0373958_0005804
668 Ga0373938_0002129
669 Ga0373929_0003561
670 Ga0373934_0078341
671 Ga0373940_0001435
672 Ga0373949_0002212
673 Ga0373951_0004494
674 Ga0373951_0013494
675 Ga0373952_0001897
676 Ga0373952_0029263
677 Ga0373923_0037862
678 Ga0373923_0102145
679 Ga0373932_0011991
680 Ga0373939_0000434
681 Ga0373939_0044007
682 Ga0373941_0003390
683 Ga0373960_0000610
684 Ga0373943_0003364
685 Ga0373946_0001638
686 Ga0373955_0012285
687 Ga0373955_0124339
688 Ga0373961_0008433
689 Ga0373961_0009343
690 Ga0373962_0003286
691 Ga0373924_0008308
692 Ga0373931_0001463
693 Ga0373935_0012577
694 Ga0373935_0170387
695 Ga0373927_0160635
696 Ga0373933_0364408
697 Ga0373947_0002247
698 Ga0373947_0115809
699 Ga0373947_0205052
700 Ga0316584_0001977
701 Ga0316584_0204175
702 Ga0373925_0034947
703 Ga0450923_010802
704 Ga0451577_0034950
705 Ga0466963_0143756
706 Ga0451576_0022386
707 Ga0451576_0066814
708 Ga0451576_0097311
709 Ga0451576_0550538
710 Ga0495653_0075967
711 Ga0495582_0041023
712 Ga0495582_0157488
713 Ga0495608_0145197
714 Ga0495630_0002524
715 Ga0495652_0259334
716 Ga0495640_0046999
717 Ga0495640_0077506
718 Ga0495645_0019441
719 Ga0495667_0034655
720 Ga0495635_0174344
721 Ga0495659_0005863
722 Ga0495623_0065692
723 Ga0495647_0019102
724 Ga0495647_0185116
725 Ga0495658_0068898
726 Ga0495669_0009314
727 Ga0495669_0011753
728 Ga0495613_0001120
729 Ga0495600_0066250
730 Ga0495581_0052709
731 Ga0495604_0026845
732 Ga0495674_0101495
733 Ga0495674_0164021
734 Ga0495676_0179239
735 Ga0495684_0021910
736 Ga0496100_0301727
737 Ga0496101_0001528
738 Ga0496102_0026333
739 Ga0496104_0125618
740 Ga0496104_0197061
741 Ga0496105_0079713
742 Ga0496105_0263231
743 Ga0496106_0072661
744 Ga0496107_0042790
745 Ga0496107_0111709
746 Ga0496107_0261832
747 Ga0496108_0223899
748 Ga0496108_0285199
749 Ga0496109_0069606
750 Ga0496110_0038510
751 Ga0496110_0445119
752 Ga0496112_0005789
753 Ga0496112_0046821
754 Ga0496112_0077313
755 Ga0496113_0096068
756 Ga0496113_0344892
757 Ga0496114_0000958
758 Ga0501032_0151699
759 Ga0501034_0005502
760 Ga0501034_0132478
761 Ga0501034_0285480
762 Ga0501036_0075594
763 Ga0501036_0159703
764 Ga0501037_0032482
765 Ga0501038_0060471
766 Ga0501040_0142819
767 Ga0501040_0188742
768 Ga0501043_0001097
769 Ga0501043_0111545
770 Ga0501043_0123951
771 Ga0501046_0018474
772 Ga0501047_0000303
773 Ga0501047_0023638
774 Ga0501047_0166492
775 Ga0501067_0009850
776 Ga0501068_0185697
777 Ga0501069_0035963
778 Ga0501072_0144523
779 Ga0501072_0148909
780 Ga0501072_0250488
781 Ga0501073_0047002
782 Ga0501073_0059195
783 Ga0501073_0189115
784 Ga0501073_0268419
785 Ga0501074_0172720
786 Ga0501074_0228254
787 Ga0501075_0084145
788 Ga0501075_0238321
789 Ga0501076_0015523
790 Ga0501076_0017133
791 Ga0501076_0128807
792 Ga0501076_0316637
793 Ga0501077_0070951
794 Ga0501080_0024504
795 Ga0501081_0119463
796 Ga0501083_0004890
797 Ga0501044_0015181
798 nmdc:mga00v17_171936_c1
799 nmdc:mga05p37_1529_c1
800 nmdc:mga05p37_183171_c1
801 nmdc:mga05p37_184585_c1
802 nmdc:mga05p37_190092_c1
803 nmdc:mga05p37_729844_c1
804 nmdc:mga05p37_8731_c1
805 nmdc:mga06r32_31156_c2
806 nmdc:mga06r32_642834_c1
807 nmdc:mga08y16_176336_c1
808 nmdc:mga08y16_260428_c1
809 nmdc:mga08y16_36234_c1
810 nmdc:mga08y16_683_c1
811 nmdc:mga08y16_83639_c1
812 nmdc:mga0n895_115434_c1
813 nmdc:mga0n895_131852_c1
814 nmdc:mga0n895_44575_c1
815 nmdc:mga0n895_58275_c1
816 nmdc:mga0n895_64245_c1
817 nmdc:mga0n895_74512_c1
818 nmdc:mga0n895_95_c1
819 nmdc:mga0rr50_122062_c1
820 nmdc:mga0rr50_1294_c1
821 nmdc:mga0rr50_249285_c1
822 nmdc:mga0rr50_265229_c1
823 nmdc:mga0rr50_28_c1
824 nmdc:mga0rr50_75991_c1
825 nmdc:mga08x19_14474_c1
826 nmdc:mga08x19_33744_c1
827 nmdc:mga08x19_874_c1
828 nmdc:mga0a205_199098_c1
829 nmdc:mga0a205_31186_c1
830 nmdc:mga0a205_77441_c1
831 Ga0495601_0007735
832 Ga0495601_0041490
833 Ga0495612_0081662
834 Ga0495595_0039179
835 Ga0495619_0144124
836 Ga0500646_0009309
837 Ga0500555_000454
838 Ga0500555_014905
839 Ga0500568_0004656
840 Ga0500645_000401
841 Ga0501084_0017468
842 Ga0501084_0196891
843 Ga0501084_0347238
844 Ga0501082_0035760
845 Ga0501082_0037632
846 Ga0530510_0016129
847 Ga0530510_0083839
848 Ga0530510_0135996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01180

DHO_dh

Dihydroorotate dehydrogenase

34

316

0.98

PF01207

Dus

Dihydrouridine synthase (Dus)

246

326

0.88

PF03060

NMO

Nitronate monooxygenase

239

302

0.85

PF01207

Dus

Dihydrouridine synthase (Dus)

109

224

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ue9-assembly1.cif.gz_A wt dhodb with orotate bound 0.8458 1 300
5ksw-assembly1.cif.gz_A dhodb-i74d mutant 0.8451 1 300
1ep2-assembly1.cif.gz_A-2 crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate 0.8447 2 303
1ep3-assembly1.cif.gz_A crystal structure of lactococcus lactis dihydroorotate dehydrogenase b. data collected under cryogenic conditions. 0.8389 2 305
1ep2-assembly1.cif.gz_A-2 crystal structure of lactococcus lactis dihydroorotate dehydrogenase b complexed with orotate 0.8289 2 303
ID Description Score Start End Superfamily
3c61A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.855 1 302 3.20.20.70
3c61A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8433 1 302 3.20.20.70
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8413 1 303 3.20.20.70
1ep1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8233 1 303 3.20.20.70
af_Q58070_5_305_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8097 3 300 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V9SM04-F1-model_v4 Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-) 0.9084 2 299 GO:0004035
GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A7V4PAR0-F1-model_v4 Dihydroorotate dehydrogenase 0.8882 1 184 GO:0004152
GO:0005737
GO:0006207
GO:0006221
AF-A0A7V5N4V6-F1-model_v4 Dihydroorotate dehydrogenase 0.8856 1 190 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A7V4IX53-F1-model_v4 Rhodanese domain-containing protein 0.8848 6 194 GO:0004152
GO:0005737
GO:0006207
GO:0044205
AF-A0A7K0SCN2-F1-model_v4 Dihydroorotate dehydrogenase 0.8789 1 181 GO:0004152
GO:0005737
GO:0006207
GO:0006221

Map