F440821

General Info

Members Datasets Scaffolds Average Seq Length
424 231 848 221

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0098640|Ga0466959_0098640_303_971
Length 209
Sequence MSKPTRERRKVVAVEPVGPYALVRVERGGIDPGIPGQFFMVEAPGRVLPRPMSLCLAPRGELAFLLDPIGPGTRALASVERFRLDVSRPLLVGGGIGVAPLPYLSEALERPPAVLGFRSERHAEAAALVPNAEVVIDPVLVTDVLPEGRSVLACGPEPMLEALRVLRPDAQLAWEAPMACGYGACYGCVVEIDGELKRLCVEGPVLCCS

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
178 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
179 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
206 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
229 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.06
Metatranscriptomes 0.94
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.84
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0098640 3300045049 Unclassified 2093
2 Ga0070658_10035053 3300005327 Bacteria 4040
3 Ga0070658_10042742 3300005327 Bacteria 3660
4 Ga0070658_10239892 3300005327 Bacteria 1536
5 Ga0070683_100031547 3300005329 Bacteria 4820
6 Ga0070683_100077438 3300005329 Bacteria 3110
7 Ga0070683_100084104 3300005329 Bacteria 2981
8 Ga0070683_100142925 3300005329 Unclassified 2267
9 Ga0070690_100026117 3300005330 Bacteria 3600
10 Ga0070680_100060477 3300005336 Bacteria 3099
11 Ga0070680_100135596 3300005336 Unclassified 2062
12 Ga0070680_100180161 3300005336 Bacteria 1780
13 Ga0070680_100195843 3300005336 Bacteria 1703
14 Ga0070680_100223514 3300005336 Bacteria 1589
15 Ga0070682_100068640 3300005337 Bacteria 2262
16 Ga0070682_100130722 3300005337 Bacteria 1699
17 Ga0068868_100063646 3300005338 Bacteria 2926
18 Ga0068868_100621902 3300005338 Bacteria 959
19 Ga0070660_100019504 3300005339 Bacteria 4971
20 Ga0070660_100051168 3300005339 Bacteria 3180
21 Ga0070660_100081411 3300005339 Bacteria 2542
22 Ga0070660_100116775 3300005339 Bacteria 2128
23 Ga0070660_100289982 3300005339 Bacteria 1340
24 Ga0070689_100065714 3300005340 Bacteria 2825
25 Ga0070661_100006256 3300005344 Bacteria 8215
26 Ga0070661_100006849 3300005344 Bacteria 7859
27 Ga0070692_10052317 3300005345 Bacteria 2127
28 Ga0070668_100040362 3300005347 Bacteria 3571
29 Ga0070669_100097047 3300005353 Bacteria 2218
30 Ga0070675_100076913 3300005354 Bacteria 2777
31 Ga0070674_100018721 3300005356 Bacteria 4385
32 Ga0070673_100194055 3300005364 Bacteria 1746
33 Ga0070659_100011282 3300005366 Bacteria 6603
34 Ga0070709_10006500 3300005434 Bacteria 6372
35 Ga0070713_100149227 3300005436 Bacteria 2078
36 Ga0070701_10005276 3300005438 Bacteria 5323
37 Ga0070711_100021568 3300005439 Bacteria 4167
38 Ga0070700_100067624 3300005441 Unclassified 2270
39 Ga0070694_100006011 3300005444 Bacteria 7362
40 Ga0070663_100124403 3300005455 Bacteria 1952
41 Ga0070663_100231376 3300005455 Bacteria 1456
42 Ga0070678_100001665 3300005456 Bacteria 11902
43 Ga0070678_100127651 3300005456 Bacteria 2016
44 Ga0070681_10004247 3300005458 Bacteria 13582
45 Ga0070681_10008490 3300005458 Bacteria 10055
46 Ga0070681_10028993 3300005458 Bacteria 5559
47 Ga0070681_10049751 3300005458 Bacteria 4184
48 Ga0070681_10061919 3300005458 Bacteria 3716
49 Ga0070681_10093363 3300005458 Bacteria 2958
50 Ga0070681_10098071 3300005458 Bacteria 2877
51 Ga0070681_10276692 3300005458 Bacteria 1590
52 Ga0070681_10284975 3300005458 Bacteria 1563
53 Ga0068867_100000419 3300005459 Bacteria 28327
54 Ga0070685_10105156 3300005466 Bacteria 1730
55 Ga0070685_10353866 3300005466 Bacteria 1005
56 Ga0070707_100295195 3300005468 Bacteria 1575
57 Ga0070699_100078338 3300005518 Bacteria 2879
58 Ga0070679_100064030 3300005530 Bacteria 3664
59 Ga0070679_100071266 3300005530 Bacteria 3466
60 Ga0070679_100094128 3300005530 Bacteria 2983
61 Ga0070679_100203308 3300005530 Bacteria 1946
62 Ga0070679_100206013 3300005530 Bacteria 1931
63 Ga0070684_100068863 3300005535 Bacteria 3111
64 Ga0070684_100201473 3300005535 Bacteria 1813
65 Ga0068853_100012231 3300005539 Bacteria 6979
66 Ga0068853_100460778 3300005539 Bacteria 1196
67 Ga0070686_100006394 3300005544 Bacteria 6544
68 Ga0070693_100026077 3300005547 Bacteria 3152
69 Ga0070665_100121600 3300005548 Bacteria 2612
70 Ga0070704_100011069 3300005549 Bacteria 5508
71 Ga0068855_100013130 3300005563 Bacteria 9991
72 Ga0068855_100058468 3300005563 Bacteria 4515
73 Ga0068855_100102239 3300005563 Bacteria 3298
74 Ga0068855_100135165 3300005563 Bacteria 2813
75 Ga0068855_100164646 3300005563 Bacteria 2515
76 Ga0070664_100539747 3300005564 Unclassified 1078
77 Ga0068857_100141946 3300005577 Bacteria 2171
78 Ga0068854_100098094 3300005578 Unclassified 2192
79 Ga0068856_100006515 3300005614 Bacteria 11449
80 Ga0068856_100014290 3300005614 Bacteria 7678
81 Ga0068856_100157301 3300005614 Bacteria 2283
82 Ga0068856_100444011 3300005614 Unclassified 1318
83 Ga0070702_100004263 3300005615 Bacteria 6515
84 Ga0068852_100335420 3300005616 Bacteria 1472
85 Ga0068852_100884896 3300005616 Unclassified 910
86 Ga0068859_100043645 3300005617 Bacteria 4507
87 Ga0068866_10001799 3300005718 Bacteria 9030
88 Ga0068861_100014718 3300005719 Bacteria 5495
89 Ga0068863_100553499 3300005841 Bacteria 1136
90 Ga0068860_100365114 3300005843 Bacteria 1423
91 Ga0068862_100053553 3300005844 Bacteria 3455
92 Ga0081455_10036701 3300005937 Bacteria 4359
93 Ga0070715_10084495 3300006163 Bacteria 1448
94 Ga0070716_100042773 3300006173 Bacteria 2530
95 Ga0070712_100020648 3300006175 Bacteria 4313
96 Ga0097621_100005304 3300006237 Bacteria 9078
97 Ga0068871_100003722 3300006358 Bacteria 10489
98 Ga0075433_10041996 3300006852 Bacteria 3966
99 Ga0075434_100018510 3300006871 Bacteria 6731
100 Ga0068865_100000269 3300006881 Bacteria 28461
101 Ga0075436_100488458 3300006914 Bacteria 900
102 Ga0097620_100043643 3300006931 Bacteria 4507
103 Ga0075435_100029614 3300007076 Bacteria 4298
104 Ga0105240_10104814 3300009093 Bacteria 3434
105 Ga0105240_10123093 3300009093 Bacteria 3121
106 Ga0105240_10124892 3300009093 Bacteria 3094
107 Ga0105240_10956295 3300009093 Bacteria 918
108 Ga0105245_10008137 3300009098 Bacteria 9169
109 Ga0105245_10196274 3300009098 Bacteria 1936
110 Ga0105245_10672893 3300009098 Bacteria 1066
111 Ga0105243_10011092 3300009148 Bacteria 6818
112 Ga0105241_10022389 3300009174 Bacteria 4681
113 Ga0105242_10012809 3300009176 Bacteria 6460
114 Ga0105248_10012514 3300009177 Bacteria 9357
115 Ga0105238_10029238 3300009551 Bacteria 5615
116 Ga0105249_10003662 3300009553 Bacteria 13260
117 Ga0105239_10059946 3300010375 Bacteria 4176
118 Ga0105239_10248419 3300010375 Bacteria 1998
119 Ga0105239_10272306 3300010375 Unclassified 1905
120 Ga0105246_10059871 3300011119 Bacteria 2644
121 Ga0157373_10029236 3300013100 Bacteria 3972
122 Ga0157371_10059602 3300013102 Bacteria 2706
123 Ga0157371_10354953 3300013102 Bacteria 1068
124 Ga0157370_10040599 3300013104 Bacteria 4492
125 Ga0157370_10042864 3300013104 Bacteria 4358
126 Ga0157370_10147260 3300013104 Bacteria 2192
127 Ga0157370_10165920 3300013104 Bacteria 2054
128 Ga0157369_10006129 3300013105 Bacteria 13955
129 Ga0157369_10018632 3300013105 Bacteria 7782
130 Ga0157369_10036065 3300013105 Bacteria 5421
131 Ga0157369_10037075 3300013105 Bacteria 5340
132 Ga0157369_10140321 3300013105 Bacteria 2557
133 Ga0157369_10148781 3300013105 Bacteria 2475
134 Ga0157374_10067402 3300013296 Bacteria 3365
135 Ga0157374_10081747 3300013296 Bacteria 3066
136 Ga0157378_10011528 3300013297 Bacteria 7739
137 Ga0163162_10028626 3300013306 Bacteria 5514
138 Ga0157372_10016430 3300013307 Bacteria 7941
139 Ga0157372_10052141 3300013307 Bacteria 4554
140 Ga0157372_10067351 3300013307 Bacteria 4023
141 Ga0157372_10134473 3300013307 Bacteria 2847
142 Ga0157372_10456846 3300013307 Bacteria 1488
143 Ga0157372_10630330 3300013307 Bacteria 1249
144 Ga0157375_10023843 3300013308 Bacteria 5653
145 Ga0157380_10019261 3300014326 Bacteria 5085
146 Ga0157376_10007465 3300014969 Bacteria 7807
147 Ga0206356_10516456 3300020070 Bacteria 1633
148 Ga0206354_11248505 3300020081 Unclassified 1045
149 Ga0206353_10206590 3300020082 Bacteria 2822
150 Ga0206353_12011239 3300020082 Unclassified 888
151 Ga0207692_10005834 3300025898 Bacteria 4963
152 Ga0207642_10001615 3300025899 Bacteria 6936
153 Ga0207699_10007552 3300025906 Bacteria 5320
154 Ga0207705_10049149 3300025909 Bacteria 3036
155 Ga0207684_10224887 3300025910 Bacteria 1620
156 Ga0207654_10153865 3300025911 Bacteria 1479
157 Ga0207707_10002473 3300025912 Bacteria 16636
158 Ga0207707_10017502 3300025912 Bacteria 6248
159 Ga0207707_10079753 3300025912 Bacteria 2858
160 Ga0207707_10289024 3300025912 Bacteria 1419
161 Ga0207695_10085059 3300025913 Bacteria 3192
162 Ga0207671_10054617 3300025914 Bacteria 2959
163 Ga0207671_10094550 3300025914 Bacteria 2256
164 Ga0207693_10001049 3300025915 Bacteria 24711
165 Ga0207693_10152503 3300025915 Bacteria 1818
166 Ga0207660_10008507 3300025917 Bacteria 6638
167 Ga0207660_10074988 3300025917 Unclassified 2470
168 Ga0207660_10093018 3300025917 Bacteria 2239
169 Ga0207660_10093505 3300025917 Bacteria 2234
170 Ga0207660_10175377 3300025917 Bacteria 1662
171 Ga0207657_10005734 3300025919 Bacteria 12955
172 Ga0207657_10011769 3300025919 Bacteria 8666
173 Ga0207657_10038519 3300025919 Bacteria 4255
174 Ga0207657_10043543 3300025919 Bacteria 3953
175 Ga0207657_10089392 3300025919 Bacteria 2573
176 Ga0207657_10089472 3300025919 Bacteria 2572
177 Ga0207649_10009939 3300025920 Bacteria 5214
178 Ga0207652_10008151 3300025921 Bacteria 8412
179 Ga0207652_10039928 3300025921 Bacteria 3984
180 Ga0207652_10067465 3300025921 Bacteria 3102
181 Ga0207652_10072066 3300025921 Bacteria 3003
182 Ga0207652_10086258 3300025921 Bacteria 2752
183 Ga0207652_10102301 3300025921 Bacteria 2532
184 Ga0207652_10149467 3300025921 Unclassified 2091
185 Ga0207652_10401346 3300025921 Bacteria 1237
186 Ga0207646_10227758 3300025922 Bacteria 1684
187 Ga0207646_10400285 3300025922 Bacteria 1240
188 Ga0207681_10074391 3300025923 Bacteria 2380
189 Ga0207694_10060554 3300025924 Bacteria 2946
190 Ga0207687_10011064 3300025927 Bacteria 5899
191 Ga0207687_10477375 3300025927 Bacteria 1038
192 Ga0207686_10007895 3300025934 Bacteria 5737
193 Ga0207709_10002279 3300025935 Bacteria 12176
194 Ga0207670_10013688 3300025936 Bacteria 4792
195 Ga0207669_10071648 3300025937 Unclassified 2178
196 Ga0207704_10010665 3300025938 Bacteria 4491
197 Ga0207665_10026002 3300025939 Bacteria 3862
198 Ga0207665_10028937 3300025939 Bacteria 3663
199 Ga0207661_10057740 3300025944 Bacteria 3122
200 Ga0207661_10083539 3300025944 Bacteria 2643
201 Ga0207661_10361487 3300025944 Bacteria 1311
202 Ga0207679_10544805 3300025945 Bacteria 1040
203 Ga0207667_10024089 3300025949 Bacteria 6693
204 Ga0207667_10063012 3300025949 Bacteria 3875
205 Ga0207667_10066609 3300025949 Bacteria 3754
206 Ga0207667_10260033 3300025949 Bacteria 1775
207 Ga0207712_10008520 3300025961 Bacteria 6482
208 Ga0207640_10094654 3300025981 Unclassified 2078
209 Ga0207677_10058769 3300026023 Bacteria 2650
210 Ga0207677_10257014 3300026023 Bacteria 1422
211 Ga0207677_10277635 3300026023 Bacteria 1374
212 Ga0207677_10427057 3300026023 Unclassified 1130
213 Ga0207639_10064081 3300026041 Unclassified 2848
214 Ga0207639_10527768 3300026041 Bacteria 1082
215 Ga0207639_10655478 3300026041 Bacteria 971
216 Ga0207678_10168472 3300026067 Bacteria 1870
217 Ga0207678_10306094 3300026067 Unclassified 1366
218 Ga0207708_10001945 3300026075 Bacteria 15228
219 Ga0207702_10011217 3300026078 Bacteria 7473
220 Ga0207702_10015873 3300026078 Bacteria 6236
221 Ga0207702_10062164 3300026078 Bacteria 3187
222 Ga0207641_10353153 3300026088 Bacteria 1402
223 Ga0207648_10000729 3300026089 Bacteria 36820
224 Ga0207674_10080249 3300026116 Bacteria 3266
225 Ga0207674_10092707 3300026116 Bacteria 3010
226 Ga0207675_100036337 3300026118 Bacteria 4596
227 Ga0207683_10000371 3300026121 Bacteria 41225
228 Ga0207698_10285282 3300026142 Bacteria 1529
229 Ga0207698_10363942 3300026142 Bacteria 1370
230 Ga0207698_10572950 3300026142 Unclassified 1110
231 Ga0268266_10151534 3300028379 Bacteria 2090
232 Ga0268265_10197544 3300028380 Bacteria 1742
233 Ga0265326_10097526 3300028558 Unclassified 834
234 Ga0265334_10012155 3300028573 Bacteria 3617
235 Ga0265322_10039955 3300028654 Bacteria 1335
236 Ga0265338_10019418 3300028800 Bacteria 7212
237 Ga0265338_10058891 3300028800 Bacteria 3387
238 Ga0265330_10013863 3300031235 Bacteria 3749
239 Ga0265330_10175150 3300031235 Unclassified 909
240 Ga0265320_10071352 3300031240 Bacteria 1636
241 Ga0265325_10011163 3300031241 Bacteria 5169
242 Ga0265340_10061899 3300031247 Bacteria 1789
243 Ga0265339_10017306 3300031249 Bacteria 4273
244 Ga0265331_10014392 3300031250 Bacteria 4214
245 Ga0265327_10012744 3300031251 Bacteria 5644
246 Ga0265316_10027045 3300031344 Bacteria 4759
247 Ga0307408_100334603 3300031548 Bacteria 1280
248 Ga0265313_10005262 3300031595 Bacteria 9580
249 Ga0265314_10015874 3300031711 Bacteria 5964
250 Ga0265342_10036407 3300031712 Bacteria 3007
251 Ga0307410_10307721 3300031852 Bacteria 1253
252 Ga0307416_100698275 3300032002 Bacteria 1103
253 Ga0307415_100399283 3300032126 Bacteria 1173
254 Ga0373926_0056878 3300035083 Unclassified 1420
255 Ga0373944_0005822 3300035089 Bacteria 3260
256 Ga0373936_0147602 3300035113 Unclassified 1018
257 Ga0373945_0005353 3300035116 Bacteria 4109
258 Ga0373945_0024145 3300035116 Bacteria 2105
259 Ga0373943_0000948 3300035170 Bacteria 12836
260 Ga0373943_0005005 3300035170 Bacteria 5977
261 Ga0373943_0016833 3300035170 Bacteria 3340
262 Ga0373946_0001987 3300035171 Bacteria 7155
263 Ga0373946_0052504 3300035171 Bacteria 1710
264 Ga0373927_0035435 3300035695 Bacteria 3245
265 Ga0373927_0050058 3300035695 Bacteria 2701
266 Ga0373947_0011030 3300035725 Bacteria 5185
267 Ga0373947_0032831 3300035725 Bacteria 3061
268 Ga0373925_0012765 3300037068 Bacteria 6086
269 Ga0373925_0026842 3300037068 Bacteria 4216
270 Ga0373925_0146369 3300037068 Bacteria 1852
271 Ga0373925_0481428 3300037068 Bacteria 1018
272 Ga0395900_0134391 3300037418 Bacteria 2534
273 Ga0395900_0331839 3300037418 Bacteria 1499
274 Ga0395900_0625240 3300037418 Archaea 1015
275 Ga0395898_0083596 3300037466 Bacteria 3077
276 Ga0395898_0774820 3300037466 Bacteria 900
277 Ga0395905_0391200 3300037471 Bacteria 1285
278 Ga0395901_0028728 3300038443 Bacteria 5722
279 Ga0395901_0216201 3300038443 Bacteria 2005
280 Ga0395901_0321312 3300038443 Bacteria 1601
281 Ga0395901_0542920 3300038443 Bacteria 1179
282 Ga0436365_1208113 3300039437 Bacteria 2689
283 Ga0436363_0592935 3300039450 Bacteria 924
284 Ga0436363_0806319 3300039450 Bacteria 870
285 Ga0466972_0294472 3300044658 Unclassified 758
286 Ga0466966_0006004 3300044684 Bacteria 8017
287 Ga0466966_0091168 3300044684 Bacteria 1892
288 Ga0466963_0001104 3300044694 Bacteria 14058
289 Ga0466963_0009647 3300044694 Bacteria 5819
290 Ga0466963_0016032 3300044694 Bacteria 4653
291 Ga0466963_0053085 3300044694 Bacteria 2691
292 Ga0466963_0136020 3300044694 Bacteria 1700
293 Ga0466964_0004892 3300044706 Bacteria 4951
294 Ga0466964_0008108 3300044706 Bacteria 3940
295 Ga0466964_0324646 3300044706 Bacteria 783
296 Ga0466971_0000594 3300044719 Bacteria 14344
297 Ga0466971_0051810 3300044719 Bacteria 1848
298 Ga0466971_0283867 3300044719 Unclassified 793
299 Ga0466968_0056809 3300044735 Bacteria 1682
300 Ga0466970_0036379 3300044765 Unclassified 2608
301 Ga0466957_0000965 3300044842 Bacteria 14764
302 Ga0466957_0390028 3300044842 Bacteria 951
303 Ga0466957_0507361 3300044842 Bacteria 837
304 Ga0466959_0007029 3300045049 Bacteria 7866
305 Ga0466959_0014461 3300045049 Bacteria 5735
306 Ga0466959_0044574 3300045049 Bacteria 3268
307 Ga0466959_0462501 3300045049 Bacteria 859
308 Ga0466958_0001260 3300045836 Bacteria 11862
309 Ga0466958_0016073 3300045836 Bacteria 4304
310 Ga0466958_0021158 3300045836 Bacteria 3797
311 Ga0466958_0042614 3300045836 Bacteria 2733
312 Ga0466967_0002964 3300045976 Bacteria 10850
313 Ga0466967_0008918 3300045976 Bacteria 7402
314 Ga0466967_0024277 3300045976 Bacteria 4982
315 Ga0466967_0033830 3300045976 Bacteria 4331
316 Ga0466967_0042543 3300045976 Bacteria 3926
317 Ga0466967_0071536 3300045976 Bacteria 3106
318 Ga0466967_0151716 3300045976 Bacteria 2166
319 Ga0466967_0192433 3300045976 Bacteria 1928
320 Ga0466967_0399195 3300045976 Bacteria 1337
321 Ga0495629_0000994 3300046459 Bacteria 22717
322 Ga0495629_0020903 3300046459 Bacteria 4672
323 Ga0495641_0000793 3300046461 Bacteria 26791
324 Ga0495641_0042598 3300046461 Unclassified 2103
325 Ga0495641_0059623 3300046461 Unclassified 1725
326 Ga0495641_0098013 3300046461 Bacteria 1308
327 Ga0495653_0046507 3300046463 Bacteria 3360
328 Ga0495653_0073341 3300046463 Bacteria 2554
329 Ga0495582_0004168 3300046473 Bacteria 8126
330 Ga0495582_0029886 3300046473 Bacteria 2991
331 Ga0495582_0053103 3300046473 Bacteria 2235
332 Ga0495639_0120988 3300046475 Bacteria 1249
333 Ga0495662_0003248 3300046476 Bacteria 8215
334 Ga0495662_0046779 3300046476 Bacteria 2089
335 Ga0495664_0303582 3300046477 Bacteria 963
336 Ga0495594_0089185 3300046499 Bacteria 1727
337 Ga0495608_0203871 3300046511 Unclassified 1245
338 Ga0495618_0056832 3300046514 Bacteria 2477
339 Ga0495630_0059935 3300046517 Bacteria 2856
340 Ga0495630_0060303 3300046517 Bacteria 2847
341 Ga0495630_0065773 3300046517 Bacteria 2724
342 Ga0495630_0131076 3300046517 Bacteria 1904
343 Ga0495665_0001332 3300046531 Bacteria 13180
344 Ga0495665_0086753 3300046531 Unclassified 1645
345 Ga0495665_0264555 3300046531 Bacteria 884
346 Ga0495640_0014295 3300046533 Bacteria 6011
347 Ga0495640_0092340 3300046533 Bacteria 1996
348 Ga0495586_0102564 3300046535 Bacteria 1588
349 Ga0495645_0051568 3300046543 Bacteria 2993
350 Ga0495667_0072118 3300046559 Bacteria 2251
351 Ga0495634_0016958 3300046642 Bacteria 5202
352 Ga0495634_0039723 3300046642 Bacteria 3203
353 Ga0495635_0017522 3300046663 Bacteria 5002
354 Ga0495635_0056640 3300046663 Bacteria 2698
355 Ga0495657_0032891 3300046675 Bacteria 3615
356 Ga0495646_0087143 3300046680 Bacteria 1810
357 Ga0495647_0196117 3300046681 Bacteria 884
358 Ga0495658_0000379 3300046683 Bacteria 24931
359 Ga0495658_0011720 3300046683 Bacteria 4418
360 Ga0495613_0001753 3300046689 Bacteria 16515
361 Ga0495613_0055239 3300046689 Bacteria 2918
362 Ga0495624_0086321 3300046690 Bacteria 1938
363 Ga0495600_0041814 3300046809 Bacteria 2988
364 Ga0495600_0056166 3300046809 Unclassified 2572
365 Ga0495600_0115061 3300046809 Bacteria 1751
366 Ga0495581_0002043 3300047315 Bacteria 11350
367 Ga0495581_0088259 3300047315 Bacteria 1798
368 Ga0495604_0077165 3300047317 Bacteria 2504
369 Ga0495674_0034090 3300047319 Bacteria 4606
370 Ga0495676_0002172 3300047321 Bacteria 17365
371 Ga0495676_0039707 3300047321 Bacteria 3894
372 Ga0495676_0181016 3300047321 Bacteria 1477
373 Ga0495680_0036714 3300047322 Bacteria 3931
374 Ga0495680_0104974 3300047322 Bacteria 2101
375 Ga0495680_0189729 3300047322 Unclassified 1479
376 Ga0495684_0067986 3300047471 Bacteria 2709
377 Ga0495602_0374061 3300048088 Bacteria 1022
378 Ga0495614_0011626 3300048089 Bacteria 3870
379 Ga0496100_0014411 3300048903 Bacteria 4590
380 Ga0496100_0015773 3300048903 Bacteria 4418
381 Ga0496100_0191206 3300048903 Bacteria 1486
382 Ga0496101_0010731 3300048904 Bacteria 6058
383 Ga0496101_0018591 3300048904 Bacteria 4728
384 Ga0496101_0024995 3300048904 Bacteria 4140
385 Ga0496102_0038668 3300048905 Bacteria 4307
386 Ga0496102_0057760 3300048905 Bacteria 3544
387 Ga0496103_0003329 3300048906 Bacteria 9830
388 Ga0496103_0241649 3300048906 Unclassified 1162
389 Ga0496104_0188560 3300048907 Bacteria 1973
390 Ga0496105_0132744 3300048908 Bacteria 2052
391 Ga0496105_0214517 3300048908 Unclassified 1568
392 Ga0496106_0006675 3300048909 Bacteria 8544
393 Ga0496106_0040068 3300048909 Bacteria 3507
394 Ga0496107_0011114 3300048910 Bacteria 6263
395 Ga0496107_0141042 3300048910 Bacteria 1781
396 Ga0496108_0051259 3300048911 Bacteria 3457
397 Ga0496112_0006292 3300048915 Bacteria 10415
398 Ga0496112_0007087 3300048915 Bacteria 9908
399 Ga0496112_0025847 3300048915 Bacteria 5642
400 Ga0496112_0456570 3300048915 Bacteria 1215
401 Ga0496113_0184139 3300048916 Bacteria 1656
402 Ga0496114_0004206 3300048917 Bacteria 11154
403 Ga0496114_0025622 3300048917 Bacteria 4822
404 Ga0496114_0177534 3300048917 Bacteria 1859
405 Ga0496115_0004249 3300048918 Bacteria 10358
406 Ga0496115_0011590 3300048918 Bacteria 6611
407 Ga0496115_0095467 3300048918 Bacteria 2434
408 Ga0501067_0049362 3300049583 Bacteria 2332
409 Ga0501067_0068871 3300049583 Bacteria 1959
410 Ga0501069_0001571 3300049585 Bacteria 11282
411 Ga0501069_0024391 3300049585 Bacteria 3299
412 Ga0501070_0196685 3300049586 Bacteria 1656
413 Ga0501035_0532703 3300049822 Bacteria 964
414 nmdc:mga0n895_66521_c1 3300050512 Bacteria 3569
415 nmdc:mga0rr50_10604_c1 3300050513 Bacteria 5419
416 nmdc:mga08x19_364086_c1 3300050514 Bacteria 1011
417 nmdc:mga0a205_20179_c2 3300050515 Bacteria 4384
418 Ga0495601_0098861 3300053077 Bacteria 1883
419 Ga0495655_0004561 3300053083 Bacteria 2377
420 Ga0495595_0022921 3300053084 Bacteria 2745
421 Ga0495595_0027082 3300053084 Bacteria 2551
422 Ga0495619_0004115 3300053085 Bacteria 9302
423 Ga0495619_0006528 3300053085 Bacteria 7384
424 Ga0466962_0000708 3300061719 Bacteria 14840
425 Ga0466959_0098640
426 Ga0070658_10035053
427 Ga0070658_10042742
428 Ga0070658_10239892
429 Ga0070683_100031547
430 Ga0070683_100077438
431 Ga0070683_100084104
432 Ga0070683_100142925
433 Ga0070690_100026117
434 Ga0070680_100060477
435 Ga0070680_100135596
436 Ga0070680_100180161
437 Ga0070680_100195843
438 Ga0070680_100223514
439 Ga0070682_100068640
440 Ga0070682_100130722
441 Ga0068868_100063646
442 Ga0068868_100621902
443 Ga0070660_100019504
444 Ga0070660_100051168
445 Ga0070660_100081411
446 Ga0070660_100116775
447 Ga0070660_100289982
448 Ga0070689_100065714
449 Ga0070661_100006256
450 Ga0070661_100006849
451 Ga0070692_10052317
452 Ga0070668_100040362
453 Ga0070669_100097047
454 Ga0070675_100076913
455 Ga0070674_100018721
456 Ga0070673_100194055
457 Ga0070659_100011282
458 Ga0070709_10006500
459 Ga0070713_100149227
460 Ga0070701_10005276
461 Ga0070711_100021568
462 Ga0070700_100067624
463 Ga0070694_100006011
464 Ga0070663_100124403
465 Ga0070663_100231376
466 Ga0070678_100001665
467 Ga0070678_100127651
468 Ga0070681_10004247
469 Ga0070681_10008490
470 Ga0070681_10028993
471 Ga0070681_10049751
472 Ga0070681_10061919
473 Ga0070681_10093363
474 Ga0070681_10098071
475 Ga0070681_10276692
476 Ga0070681_10284975
477 Ga0068867_100000419
478 Ga0070685_10105156
479 Ga0070685_10353866
480 Ga0070707_100295195
481 Ga0070699_100078338
482 Ga0070679_100064030
483 Ga0070679_100071266
484 Ga0070679_100094128
485 Ga0070679_100203308
486 Ga0070679_100206013
487 Ga0070684_100068863
488 Ga0070684_100201473
489 Ga0068853_100012231
490 Ga0068853_100460778
491 Ga0070686_100006394
492 Ga0070693_100026077
493 Ga0070665_100121600
494 Ga0070704_100011069
495 Ga0068855_100013130
496 Ga0068855_100058468
497 Ga0068855_100102239
498 Ga0068855_100135165
499 Ga0068855_100164646
500 Ga0070664_100539747
501 Ga0068857_100141946
502 Ga0068854_100098094
503 Ga0068856_100006515
504 Ga0068856_100014290
505 Ga0068856_100157301
506 Ga0068856_100444011
507 Ga0070702_100004263
508 Ga0068852_100335420
509 Ga0068852_100884896
510 Ga0068859_100043645
511 Ga0068866_10001799
512 Ga0068861_100014718
513 Ga0068863_100553499
514 Ga0068860_100365114
515 Ga0068862_100053553
516 Ga0081455_10036701
517 Ga0070715_10084495
518 Ga0070716_100042773
519 Ga0070712_100020648
520 Ga0097621_100005304
521 Ga0068871_100003722
522 Ga0075433_10041996
523 Ga0075434_100018510
524 Ga0068865_100000269
525 Ga0075436_100488458
526 Ga0097620_100043643
527 Ga0075435_100029614
528 Ga0105240_10104814
529 Ga0105240_10123093
530 Ga0105240_10124892
531 Ga0105240_10956295
532 Ga0105245_10008137
533 Ga0105245_10196274
534 Ga0105245_10672893
535 Ga0105243_10011092
536 Ga0105241_10022389
537 Ga0105242_10012809
538 Ga0105248_10012514
539 Ga0105238_10029238
540 Ga0105249_10003662
541 Ga0105239_10059946
542 Ga0105239_10248419
543 Ga0105239_10272306
544 Ga0105246_10059871
545 Ga0157373_10029236
546 Ga0157371_10059602
547 Ga0157371_10354953
548 Ga0157370_10040599
549 Ga0157370_10042864
550 Ga0157370_10147260
551 Ga0157370_10165920
552 Ga0157369_10006129
553 Ga0157369_10018632
554 Ga0157369_10036065
555 Ga0157369_10037075
556 Ga0157369_10140321
557 Ga0157369_10148781
558 Ga0157374_10067402
559 Ga0157374_10081747
560 Ga0157378_10011528
561 Ga0163162_10028626
562 Ga0157372_10016430
563 Ga0157372_10052141
564 Ga0157372_10067351
565 Ga0157372_10134473
566 Ga0157372_10456846
567 Ga0157372_10630330
568 Ga0157375_10023843
569 Ga0157380_10019261
570 Ga0157376_10007465
571 Ga0206356_10516456
572 Ga0206354_11248505
573 Ga0206353_10206590
574 Ga0206353_12011239
575 Ga0207692_10005834
576 Ga0207642_10001615
577 Ga0207699_10007552
578 Ga0207705_10049149
579 Ga0207684_10224887
580 Ga0207654_10153865
581 Ga0207707_10002473
582 Ga0207707_10017502
583 Ga0207707_10079753
584 Ga0207707_10289024
585 Ga0207695_10085059
586 Ga0207671_10054617
587 Ga0207671_10094550
588 Ga0207693_10001049
589 Ga0207693_10152503
590 Ga0207660_10008507
591 Ga0207660_10074988
592 Ga0207660_10093018
593 Ga0207660_10093505
594 Ga0207660_10175377
595 Ga0207657_10005734
596 Ga0207657_10011769
597 Ga0207657_10038519
598 Ga0207657_10043543
599 Ga0207657_10089392
600 Ga0207657_10089472
601 Ga0207649_10009939
602 Ga0207652_10008151
603 Ga0207652_10039928
604 Ga0207652_10067465
605 Ga0207652_10072066
606 Ga0207652_10086258
607 Ga0207652_10102301
608 Ga0207652_10149467
609 Ga0207652_10401346
610 Ga0207646_10227758
611 Ga0207646_10400285
612 Ga0207681_10074391
613 Ga0207694_10060554
614 Ga0207687_10011064
615 Ga0207687_10477375
616 Ga0207686_10007895
617 Ga0207709_10002279
618 Ga0207670_10013688
619 Ga0207669_10071648
620 Ga0207704_10010665
621 Ga0207665_10026002
622 Ga0207665_10028937
623 Ga0207661_10057740
624 Ga0207661_10083539
625 Ga0207661_10361487
626 Ga0207679_10544805
627 Ga0207667_10024089
628 Ga0207667_10063012
629 Ga0207667_10066609
630 Ga0207667_10260033
631 Ga0207712_10008520
632 Ga0207640_10094654
633 Ga0207677_10058769
634 Ga0207677_10257014
635 Ga0207677_10277635
636 Ga0207677_10427057
637 Ga0207639_10064081
638 Ga0207639_10527768
639 Ga0207639_10655478
640 Ga0207678_10168472
641 Ga0207678_10306094
642 Ga0207708_10001945
643 Ga0207702_10011217
644 Ga0207702_10015873
645 Ga0207702_10062164
646 Ga0207641_10353153
647 Ga0207648_10000729
648 Ga0207674_10080249
649 Ga0207674_10092707
650 Ga0207675_100036337
651 Ga0207683_10000371
652 Ga0207698_10285282
653 Ga0207698_10363942
654 Ga0207698_10572950
655 Ga0268266_10151534
656 Ga0268265_10197544
657 Ga0265326_10097526
658 Ga0265334_10012155
659 Ga0265322_10039955
660 Ga0265338_10019418
661 Ga0265338_10058891
662 Ga0265330_10013863
663 Ga0265330_10175150
664 Ga0265320_10071352
665 Ga0265325_10011163
666 Ga0265340_10061899
667 Ga0265339_10017306
668 Ga0265331_10014392
669 Ga0265327_10012744
670 Ga0265316_10027045
671 Ga0307408_100334603
672 Ga0265313_10005262
673 Ga0265314_10015874
674 Ga0265342_10036407
675 Ga0307410_10307721
676 Ga0307416_100698275
677 Ga0307415_100399283
678 Ga0373926_0056878
679 Ga0373944_0005822
680 Ga0373936_0147602
681 Ga0373945_0005353
682 Ga0373945_0024145
683 Ga0373943_0000948
684 Ga0373943_0005005
685 Ga0373943_0016833
686 Ga0373946_0001987
687 Ga0373946_0052504
688 Ga0373927_0035435
689 Ga0373927_0050058
690 Ga0373947_0011030
691 Ga0373947_0032831
692 Ga0373925_0012765
693 Ga0373925_0026842
694 Ga0373925_0146369
695 Ga0373925_0481428
696 Ga0395900_0134391
697 Ga0395900_0331839
698 Ga0395900_0625240
699 Ga0395898_0083596
700 Ga0395898_0774820
701 Ga0395905_0391200
702 Ga0395901_0028728
703 Ga0395901_0216201
704 Ga0395901_0321312
705 Ga0395901_0542920
706 Ga0436365_1208113
707 Ga0436363_0592935
708 Ga0436363_0806319
709 Ga0466972_0294472
710 Ga0466966_0006004
711 Ga0466966_0091168
712 Ga0466963_0001104
713 Ga0466963_0009647
714 Ga0466963_0016032
715 Ga0466963_0053085
716 Ga0466963_0136020
717 Ga0466964_0004892
718 Ga0466964_0008108
719 Ga0466964_0324646
720 Ga0466971_0000594
721 Ga0466971_0051810
722 Ga0466971_0283867
723 Ga0466968_0056809
724 Ga0466970_0036379
725 Ga0466957_0000965
726 Ga0466957_0390028
727 Ga0466957_0507361
728 Ga0466959_0007029
729 Ga0466959_0014461
730 Ga0466959_0044574
731 Ga0466959_0462501
732 Ga0466958_0001260
733 Ga0466958_0016073
734 Ga0466958_0021158
735 Ga0466958_0042614
736 Ga0466967_0002964
737 Ga0466967_0008918
738 Ga0466967_0024277
739 Ga0466967_0033830
740 Ga0466967_0042543
741 Ga0466967_0071536
742 Ga0466967_0151716
743 Ga0466967_0192433
744 Ga0466967_0399195
745 Ga0495629_0000994
746 Ga0495629_0020903
747 Ga0495641_0000793
748 Ga0495641_0042598
749 Ga0495641_0059623
750 Ga0495641_0098013
751 Ga0495653_0046507
752 Ga0495653_0073341
753 Ga0495582_0004168
754 Ga0495582_0029886
755 Ga0495582_0053103
756 Ga0495639_0120988
757 Ga0495662_0003248
758 Ga0495662_0046779
759 Ga0495664_0303582
760 Ga0495594_0089185
761 Ga0495608_0203871
762 Ga0495618_0056832
763 Ga0495630_0059935
764 Ga0495630_0060303
765 Ga0495630_0065773
766 Ga0495630_0131076
767 Ga0495665_0001332
768 Ga0495665_0086753
769 Ga0495665_0264555
770 Ga0495640_0014295
771 Ga0495640_0092340
772 Ga0495586_0102564
773 Ga0495645_0051568
774 Ga0495667_0072118
775 Ga0495634_0016958
776 Ga0495634_0039723
777 Ga0495635_0017522
778 Ga0495635_0056640
779 Ga0495657_0032891
780 Ga0495646_0087143
781 Ga0495647_0196117
782 Ga0495658_0000379
783 Ga0495658_0011720
784 Ga0495613_0001753
785 Ga0495613_0055239
786 Ga0495624_0086321
787 Ga0495600_0041814
788 Ga0495600_0056166
789 Ga0495600_0115061
790 Ga0495581_0002043
791 Ga0495581_0088259
792 Ga0495604_0077165
793 Ga0495674_0034090
794 Ga0495676_0002172
795 Ga0495676_0039707
796 Ga0495676_0181016
797 Ga0495680_0036714
798 Ga0495680_0104974
799 Ga0495680_0189729
800 Ga0495684_0067986
801 Ga0495602_0374061
802 Ga0495614_0011626
803 Ga0496100_0014411
804 Ga0496100_0015773
805 Ga0496100_0191206
806 Ga0496101_0010731
807 Ga0496101_0018591
808 Ga0496101_0024995
809 Ga0496102_0038668
810 Ga0496102_0057760
811 Ga0496103_0003329
812 Ga0496103_0241649
813 Ga0496104_0188560
814 Ga0496105_0132744
815 Ga0496105_0214517
816 Ga0496106_0006675
817 Ga0496106_0040068
818 Ga0496107_0011114
819 Ga0496107_0141042
820 Ga0496108_0051259
821 Ga0496112_0006292
822 Ga0496112_0007087
823 Ga0496112_0025847
824 Ga0496112_0456570
825 Ga0496113_0184139
826 Ga0496114_0004206
827 Ga0496114_0025622
828 Ga0496114_0177534
829 Ga0496115_0004249
830 Ga0496115_0011590
831 Ga0496115_0095467
832 Ga0501067_0049362
833 Ga0501067_0068871
834 Ga0501069_0001571
835 Ga0501069_0024391
836 Ga0501070_0196685
837 Ga0501035_0532703
838 nmdc:mga0n895_66521_c1
839 nmdc:mga0rr50_10604_c1
840 nmdc:mga08x19_364086_c1
841 nmdc:mga0a205_20179_c2
842 Ga0495601_0098861
843 Ga0495655_0004561
844 Ga0495595_0022921
845 Ga0495595_0027082
846 Ga0495619_0004115
847 Ga0495619_0006528
848 Ga0466962_0000708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10418

DHODB_Fe-S_bind

Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B

175

208

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7c3a-assembly3.cif.gz_C ferredoxin reductase in carbazole 1,9a-dioxygenase 0.8508 4 182
3ddy-assembly1.cif.gz_A structure of lumazine protein, an optical transponder of luminescent bacteria 0.8131 8 87
5ogx-assembly1.cif.gz_A crystal structure of amycolatopsis cytochrome p450 reductase gcob. 0.8008 1 182
1ep1-assembly1.cif.gz_B crystal structure of lactococcus lactis dihydroorotate dehydrogenase b 0.7959 6 213
4wqm-assembly1.cif.gz_A structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant 0.7958 4 179
ID Description Score Start End Superfamily
1ep1B01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8798 6 93 2.40.30.10
1a8pA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8439 6 87 2.40.30.10
2xncA01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8424 7 91 2.40.30.10
5ufaC01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8349 6 87 2.40.30.10
af_A0A494BAW1_1266_1366_2.40.30.10 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Translation factors 0.8284 7 93 2.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W0G7D8-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9742 5 101 GO:0016491
AF-A0A7V8XG79-F1-model_v4 Oxidoreductase 0.9602 1 125 GO:0016491
AF-A0A7W0G7D8-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9549 5 101 GO:0016491
AF-A0A7V9BDL7-F1-model_v4 FAD-binding FR-type domain-containing protein 0.9474 5 85 GO:0016491
AF-A0A7V8XG79-F1-model_v4 Oxidoreductase 0.9455 1 125 GO:0016491

Map