F440718
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 424 | 250 | 418 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1110744|Ga0081540_11107442 |
| Length | 210 |
| Sequence | MPGMPPPAADERQSLLEFLRFNQNAFFAVAYGLSDEQARSTPSVSTLSIGGLIKHAAGVQKGWAQRAAFAPDFPPRDERPMEEIVAEYADQYLMRDDETLEHLLDELRKQNEETLRVFAEADLYTRVPVPHDVPWFPQDIDHWSVRWVALHLIEELTRHAGHADIVRELVDGTAGLRAGTSNLPGGDQAWWESYRARLQRVAELSTDRGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 2 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 3 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 4 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 5 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 6 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 7 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 10 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 85 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 172 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 173 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 174 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 175 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 176 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 177 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 178 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 181 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 184 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 199 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 200 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 201 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 202 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 203 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 204 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 207 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 208 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 209 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 213 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 214 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 215 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 216 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 239 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 242 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 243 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 244 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 245 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 246 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 247 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 248 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 249 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 250 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.58 |
| Metatranscriptomes | 0 |
| Isolates | 1.42 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.31 |
| Nodule | 0.24 |
| Rhizoplane | 9.91 |
| Rhizosphere | 75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1011250 | 3300001977 | Bacteria | 1317 |
| 2 | JGI24737J22298_10050680 | 3300001990 | Bacteria | 1261 |
| 3 | JGI24743J22301_10000444 | 3300001991 | Bacteria | 4730 |
| 4 | JGI24745J21846_1000671 | 3300002073 | Bacteria | 3087 |
| 5 | JGI24749J21850_1015499 | 3300002076 | Bacteria | 1069 |
| 6 | JGI24744J21845_10000472 | 3300002077 | Bacteria | 7140 |
| 7 | JGI24744J21845_10002773 | 3300002077 | Bacteria | 3579 |
| 8 | Ga0070676_10012022 | 3300005328 | Bacteria | 4718 |
| 9 | Ga0070683_100440986 | 3300005329 | Bacteria | 1242 |
| 10 | Ga0070690_100072521 | 3300005330 | Bacteria | 2239 |
| 11 | Ga0070677_10103181 | 3300005333 | Bacteria | 1261 |
| 12 | Ga0068869_100186290 | 3300005334 | Bacteria | 1629 |
| 13 | Ga0070666_10074530 | 3300005335 | Bacteria | 2313 |
| 14 | Ga0070666_10373530 | 3300005335 | Bacteria | 1023 |
| 15 | Ga0068868_100001453 | 3300005338 | Bacteria | 16341 |
| 16 | Ga0068868_100016326 | 3300005338 | Bacteria | 5512 |
| 17 | Ga0068868_100218963 | 3300005338 | Bacteria | 1593 |
| 18 | Ga0068868_100680550 | 3300005338 | Bacteria | 918 |
| 19 | Ga0070660_100218419 | 3300005339 | Bacteria | 1549 |
| 20 | Ga0070691_10008585 | 3300005341 | Bacteria | 4678 |
| 21 | Ga0070691_10228877 | 3300005341 | Bacteria | 988 |
| 22 | Ga0070691_10239641 | 3300005341 | Bacteria | 968 |
| 23 | Ga0070687_100053168 | 3300005343 | Bacteria | 2105 |
| 24 | Ga0070687_100251677 | 3300005343 | Bacteria | 1098 |
| 25 | Ga0070668_100006407 | 3300005347 | Bacteria | 8722 |
| 26 | Ga0070669_100627304 | 3300005353 | Bacteria | 902 |
| 27 | Ga0070675_100789085 | 3300005354 | Bacteria | 868 |
| 28 | Ga0070671_100104015 | 3300005355 | Bacteria | 2383 |
| 29 | Ga0070671_100744681 | 3300005355 | Bacteria | 851 |
| 30 | Ga0070674_100007936 | 3300005356 | Bacteria | 6284 |
| 31 | Ga0070674_100654901 | 3300005356 | Bacteria | 893 |
| 32 | Ga0070673_100104101 | 3300005364 | Bacteria | 2343 |
| 33 | Ga0070688_100238480 | 3300005365 | Bacteria | 1289 |
| 34 | Ga0070659_100080318 | 3300005366 | Bacteria | 2604 |
| 35 | Ga0070659_100173257 | 3300005366 | Bacteria | 1768 |
| 36 | Ga0070667_100003133 | 3300005367 | Bacteria | 14200 |
| 37 | Ga0070667_100494275 | 3300005367 | Bacteria | 1121 |
| 38 | Ga0070703_10022147 | 3300005406 | Bacteria | 1863 |
| 39 | Ga0070709_10020567 | 3300005434 | Bacteria | 3830 |
| 40 | Ga0070709_10024767 | 3300005434 | Bacteria | 3537 |
| 41 | Ga0070714_100463717 | 3300005435 | Bacteria | 1205 |
| 42 | Ga0070714_101090857 | 3300005435 | Bacteria | 778 |
| 43 | Ga0070713_100041868 | 3300005436 | Bacteria | 3734 |
| 44 | Ga0070713_100139409 | 3300005436 | Bacteria | 2147 |
| 45 | Ga0070710_10001014 | 3300005437 | Bacteria | 13321 |
| 46 | Ga0070701_10036479 | 3300005438 | Bacteria | 2477 |
| 47 | Ga0070711_100000280 | 3300005439 | Bacteria | 26351 |
| 48 | Ga0070711_100096702 | 3300005439 | Bacteria | 2140 |
| 49 | Ga0070705_100179158 | 3300005440 | Bacteria | 1434 |
| 50 | Ga0070700_100004174 | 3300005441 | Bacteria | 7533 |
| 51 | Ga0070700_100049175 | 3300005441 | Bacteria | 2616 |
| 52 | Ga0070694_100006083 | 3300005444 | Bacteria | 7322 |
| 53 | Ga0070708_100782472 | 3300005445 | Bacteria | 897 |
| 54 | Ga0070663_100002851 | 3300005455 | Bacteria | 9828 |
| 55 | Ga0070663_100022570 | 3300005455 | Bacteria | 4209 |
| 56 | Ga0070678_100000626 | 3300005456 | Bacteria | 17350 |
| 57 | Ga0070678_100625694 | 3300005456 | Bacteria | 963 |
| 58 | Ga0068867_100000835 | 3300005459 | Bacteria | 20725 |
| 59 | Ga0068867_101354430 | 3300005459 | Bacteria | 658 |
| 60 | Ga0070685_10029477 | 3300005466 | Bacteria | 3049 |
| 61 | Ga0070685_10359211 | 3300005466 | Bacteria | 998 |
| 62 | Ga0070707_100420023 | 3300005468 | Bacteria | 1298 |
| 63 | Ga0070684_100144900 | 3300005535 | Bacteria | 2149 |
| 64 | Ga0070697_100821620 | 3300005536 | Bacteria | 823 |
| 65 | Ga0068853_100011755 | 3300005539 | Bacteria | 7115 |
| 66 | Ga0070672_100100581 | 3300005543 | Bacteria | 2345 |
| 67 | Ga0070686_100040113 | 3300005544 | Bacteria | 2920 |
| 68 | Ga0070695_100080609 | 3300005545 | Bacteria | 2152 |
| 69 | Ga0070696_100041424 | 3300005546 | Bacteria | 3182 |
| 70 | Ga0070696_100112038 | 3300005546 | Bacteria | 1966 |
| 71 | Ga0070693_100001856 | 3300005547 | Bacteria | 9655 |
| 72 | Ga0070693_100123822 | 3300005547 | Bacteria | 1607 |
| 73 | Ga0070693_100844752 | 3300005547 | Bacteria | 682 |
| 74 | Ga0070665_100028263 | 3300005548 | Bacteria | 5648 |
| 75 | Ga0070665_100149567 | 3300005548 | Bacteria | 2338 |
| 76 | Ga0070665_101228472 | 3300005548 | Bacteria | 760 |
| 77 | Ga0070704_100012290 | 3300005549 | Bacteria | 5286 |
| 78 | Ga0070704_100135587 | 3300005549 | Bacteria | 1914 |
| 79 | Ga0070704_100988686 | 3300005549 | Bacteria | 760 |
| 80 | Ga0068855_100041253 | 3300005563 | Bacteria | 5471 |
| 81 | Ga0068854_100000551 | 3300005578 | Bacteria | 22591 |
| 82 | Ga0068854_100160510 | 3300005578 | Bacteria | 1740 |
| 83 | Ga0068856_100222756 | 3300005614 | Bacteria | 1902 |
| 84 | Ga0070702_100000921 | 3300005615 | Bacteria | 11514 |
| 85 | Ga0068852_100045499 | 3300005616 | Bacteria | 3733 |
| 86 | Ga0068852_100122541 | 3300005616 | Bacteria | 2383 |
| 87 | Ga0068859_100096139 | 3300005617 | Bacteria | 3015 |
| 88 | Ga0068859_100239718 | 3300005617 | Bacteria | 1902 |
| 89 | Ga0068866_10007520 | 3300005718 | Bacteria | 4564 |
| 90 | Ga0068861_100012218 | 3300005719 | Bacteria | 5987 |
| 91 | Ga0068861_100030369 | 3300005719 | Bacteria | 3959 |
| 92 | Ga0068870_10142640 | 3300005840 | Bacteria | 1403 |
| 93 | Ga0068863_100639133 | 3300005841 | Bacteria | 1055 |
| 94 | Ga0068858_100021054 | 3300005842 | Bacteria | 6091 |
| 95 | Ga0068858_100284552 | 3300005842 | Bacteria | 1575 |
| 96 | Ga0068860_100001259 | 3300005843 | Bacteria | 27632 |
| 97 | Ga0068860_100047670 | 3300005843 | Bacteria | 4083 |
| 98 | Ga0068860_100170286 | 3300005843 | Bacteria | 2103 |
| 99 | Ga0068862_100063531 | 3300005844 | Bacteria | 3177 |
| 100 | Ga0081455_10038392 | 3300005937 | Bacteria | 4241 |
| 101 | Ga0081538_10065408 | 3300005981 | Bacteria | 2047 |
| 102 | Ga0081540_1110744 | 3300005983 | Bacteria | 1161 |
| 103 | Ga0070717_10991503 | 3300006028 | Bacteria | 765 |
| 104 | Ga0075365_10054183 | 3300006038 | Bacteria | 2659 |
| 105 | Ga0075363_100189806 | 3300006048 | Bacteria | 1172 |
| 106 | Ga0075364_10020084 | 3300006051 | Bacteria | 4200 |
| 107 | Ga0075364_10622824 | 3300006051 | Bacteria | 737 |
| 108 | Ga0070715_10000966 | 3300006163 | Bacteria | 8012 |
| 109 | Ga0070716_100026066 | 3300006173 | Bacteria | 3126 |
| 110 | Ga0070712_100000899 | 3300006175 | Bacteria | 17814 |
| 111 | Ga0070712_100003164 | 3300006175 | Bacteria | 10143 |
| 112 | Ga0075367_10299417 | 3300006178 | Bacteria | 1012 |
| 113 | Ga0075367_10439320 | 3300006178 | Bacteria | 827 |
| 114 | Ga0075369_10002129 | 3300006186 | Bacteria | 6998 |
| 115 | Ga0075369_10002208 | 3300006186 | Bacteria | 6892 |
| 116 | Ga0075369_10006876 | 3300006186 | Bacteria | 4319 |
| 117 | Ga0075369_10032605 | 3300006186 | Bacteria | 2204 |
| 118 | Ga0097621_100116191 | 3300006237 | Bacteria | 2265 |
| 119 | Ga0075370_10055685 | 3300006353 | Bacteria | 2247 |
| 120 | Ga0075370_10159152 | 3300006353 | Bacteria | 1325 |
| 121 | Ga0068871_100220462 | 3300006358 | Bacteria | 1643 |
| 122 | Ga0075430_100021855 | 3300006846 | Bacteria | 5437 |
| 123 | Ga0075430_100290996 | 3300006846 | Bacteria | 1351 |
| 124 | Ga0068865_100001854 | 3300006881 | Bacteria | 12409 |
| 125 | Ga0068865_100121125 | 3300006881 | Bacteria | 1945 |
| 126 | Ga0097620_100096128 | 3300006931 | Bacteria | 3015 |
| 127 | Ga0097620_100239721 | 3300006931 | Bacteria | 1902 |
| 128 | Ga0105250_10090533 | 3300009092 | Bacteria | 1244 |
| 129 | Ga0105245_10017664 | 3300009098 | Bacteria | 6227 |
| 130 | Ga0105245_10047102 | 3300009098 | Bacteria | 3853 |
| 131 | Ga0105245_10341867 | 3300009098 | Bacteria | 1480 |
| 132 | Ga0105247_10001612 | 3300009101 | Bacteria | 15971 |
| 133 | Ga0105247_10622907 | 3300009101 | Bacteria | 803 |
| 134 | Ga0105243_10013360 | 3300009148 | Bacteria | 6211 |
| 135 | Ga0105243_10183824 | 3300009148 | Bacteria | 1820 |
| 136 | Ga0105241_10160408 | 3300009174 | Bacteria | 1848 |
| 137 | Ga0105242_10002300 | 3300009176 | Bacteria | 15088 |
| 138 | Ga0105242_10105959 | 3300009176 | Bacteria | 2388 |
| 139 | Ga0105248_10004806 | 3300009177 | Bacteria | 14951 |
| 140 | Ga0105237_10025156 | 3300009545 | Bacteria | 6090 |
| 141 | Ga0105237_10143692 | 3300009545 | Bacteria | 2380 |
| 142 | Ga0105237_11005720 | 3300009545 | Bacteria | 840 |
| 143 | Ga0105238_10446767 | 3300009551 | Bacteria | 1290 |
| 144 | Ga0105238_11191741 | 3300009551 | Bacteria | 786 |
| 145 | Ga0105249_10001128 | 3300009553 | Bacteria | 23740 |
| 146 | Ga0105249_10127895 | 3300009553 | Bacteria | 2421 |
| 147 | Ga0105249_10732259 | 3300009553 | Bacteria | 1050 |
| 148 | Ga0105239_10012717 | 3300010375 | Bacteria | 9365 |
| 149 | Ga0105246_10131243 | 3300011119 | Bacteria | 1872 |
| 150 | Ga0105246_10279991 | 3300011119 | Bacteria | 1337 |
| 151 | Ga0157371_10205117 | 3300013102 | Bacteria | 1414 |
| 152 | Ga0157369_10229067 | 3300013105 | Bacteria | 1943 |
| 153 | Ga0157374_10038816 | 3300013296 | Bacteria | 4379 |
| 154 | Ga0157378_10001538 | 3300013297 | Bacteria | 20847 |
| 155 | Ga0157378_10893198 | 3300013297 | Bacteria | 919 |
| 156 | Ga0163162_10023272 | 3300013306 | Bacteria | 6113 |
| 157 | Ga0163162_10993923 | 3300013306 | Bacteria | 948 |
| 158 | Ga0157372_10016361 | 3300013307 | Bacteria | 7957 |
| 159 | Ga0157375_10001296 | 3300013308 | Bacteria | 21510 |
| 160 | Ga0157375_10108676 | 3300013308 | Bacteria | 2869 |
| 161 | Ga0157380_10012747 | 3300014326 | Bacteria | 6105 |
| 162 | Ga0157377_10004472 | 3300014745 | Bacteria | 6445 |
| 163 | Ga0157377_10144191 | 3300014745 | Bacteria | 1466 |
| 164 | Ga0157379_10075650 | 3300014968 | Bacteria | 3015 |
| 165 | Ga0163161_10005267 | 3300017792 | Bacteria | 9003 |
| 166 | Ga0163161_10028599 | 3300017792 | Bacteria | 3959 |
| 167 | Ga0213876_10009975 | 3300021384 | Bacteria | 5104 |
| 168 | Ga0213876_10013880 | 3300021384 | Bacteria | 4269 |
| 169 | Ga0213875_10018290 | 3300021388 | Bacteria | 3379 |
| 170 | Ga0207653_10021879 | 3300025885 | Bacteria | 2029 |
| 171 | Ga0207682_10191357 | 3300025893 | Bacteria | 938 |
| 172 | Ga0207692_10003160 | 3300025898 | Bacteria | 6392 |
| 173 | Ga0207692_10534546 | 3300025898 | Bacteria | 747 |
| 174 | Ga0207642_10000244 | 3300025899 | Bacteria | 16163 |
| 175 | Ga0207642_10011989 | 3300025899 | Bacteria | 3114 |
| 176 | Ga0207710_10021270 | 3300025900 | Bacteria | 2779 |
| 177 | Ga0207688_10002485 | 3300025901 | Bacteria | 9922 |
| 178 | Ga0207688_10021188 | 3300025901 | Bacteria | 3551 |
| 179 | Ga0207680_10046828 | 3300025903 | Bacteria | 2558 |
| 180 | Ga0207647_10126835 | 3300025904 | Bacteria | 1502 |
| 181 | Ga0207699_10078807 | 3300025906 | Bacteria | 2036 |
| 182 | Ga0207699_10472288 | 3300025906 | Bacteria | 902 |
| 183 | Ga0207645_10077039 | 3300025907 | Bacteria | 2136 |
| 184 | Ga0207643_10071949 | 3300025908 | Bacteria | 1991 |
| 185 | Ga0207654_10159369 | 3300025911 | Bacteria | 1456 |
| 186 | Ga0207671_10024709 | 3300025914 | Bacteria | 4513 |
| 187 | Ga0207671_10080547 | 3300025914 | Bacteria | 2441 |
| 188 | Ga0207693_10000638 | 3300025915 | Bacteria | 31340 |
| 189 | Ga0207693_10002063 | 3300025915 | Bacteria | 17557 |
| 190 | Ga0207663_10000215 | 3300025916 | Bacteria | 25655 |
| 191 | Ga0207663_10315899 | 3300025916 | Bacteria | 1172 |
| 192 | Ga0207663_10447130 | 3300025916 | Bacteria | 996 |
| 193 | Ga0207662_10067860 | 3300025918 | Bacteria | 2152 |
| 194 | Ga0207657_10172223 | 3300025919 | Bacteria | 1753 |
| 195 | Ga0207657_10181405 | 3300025919 | Bacteria | 1702 |
| 196 | Ga0207649_10382443 | 3300025920 | Bacteria | 1049 |
| 197 | Ga0207681_10008948 | 3300025923 | Bacteria | 6114 |
| 198 | Ga0207681_10130714 | 3300025923 | Bacteria | 1856 |
| 199 | Ga0207694_10895228 | 3300025924 | Bacteria | 750 |
| 200 | Ga0207687_10007421 | 3300025927 | Bacteria | 7220 |
| 201 | Ga0207687_10068338 | 3300025927 | Bacteria | 2531 |
| 202 | Ga0207644_10059227 | 3300025931 | Bacteria | 2770 |
| 203 | Ga0207706_10411861 | 3300025933 | Bacteria | 1171 |
| 204 | Ga0207686_10242385 | 3300025934 | Bacteria | 1313 |
| 205 | Ga0207686_10293309 | 3300025934 | Bacteria | 1205 |
| 206 | Ga0207709_10018535 | 3300025935 | Bacteria | 3899 |
| 207 | Ga0207709_10137084 | 3300025935 | Bacteria | 1677 |
| 208 | Ga0207670_10112489 | 3300025936 | Bacteria | 1965 |
| 209 | Ga0207669_10000271 | 3300025937 | Bacteria | 23694 |
| 210 | Ga0207669_10418658 | 3300025937 | Bacteria | 1054 |
| 211 | Ga0207704_10001344 | 3300025938 | Bacteria | 10972 |
| 212 | Ga0207665_10009948 | 3300025939 | Bacteria | 6241 |
| 213 | Ga0207665_10012819 | 3300025939 | Bacteria | 5512 |
| 214 | Ga0207689_10129864 | 3300025942 | Bacteria | 2074 |
| 215 | Ga0207661_10301028 | 3300025944 | Bacteria | 1438 |
| 216 | Ga0207667_10328234 | 3300025949 | Bacteria | 1562 |
| 217 | Ga0207651_10060881 | 3300025960 | Bacteria | 2623 |
| 218 | Ga0207712_10006159 | 3300025961 | Bacteria | 7563 |
| 219 | Ga0207712_10547581 | 3300025961 | Bacteria | 995 |
| 220 | Ga0207668_10004088 | 3300025972 | Bacteria | 8571 |
| 221 | Ga0207640_10004670 | 3300025981 | Bacteria | 7435 |
| 222 | Ga0207640_10230852 | 3300025981 | Bacteria | 1423 |
| 223 | Ga0207658_10002751 | 3300025986 | Bacteria | 12686 |
| 224 | Ga0207658_10466231 | 3300025986 | Bacteria | 1120 |
| 225 | Ga0207677_10016402 | 3300026023 | Bacteria | 4387 |
| 226 | Ga0207677_10030643 | 3300026023 | Bacteria | 3436 |
| 227 | Ga0207677_10366817 | 3300026023 | Bacteria | 1211 |
| 228 | Ga0207703_10002729 | 3300026035 | Bacteria | 15127 |
| 229 | Ga0207703_10071873 | 3300026035 | Bacteria | 2858 |
| 230 | Ga0207639_10008405 | 3300026041 | Bacteria | 7073 |
| 231 | Ga0207639_10596419 | 3300026041 | Bacteria | 1018 |
| 232 | Ga0207678_10008697 | 3300026067 | Bacteria | 8939 |
| 233 | Ga0207678_10016320 | 3300026067 | Bacteria | 6519 |
| 234 | Ga0207678_10078934 | 3300026067 | Bacteria | 2819 |
| 235 | Ga0207708_10008676 | 3300026075 | Bacteria | 7524 |
| 236 | Ga0207708_10015025 | 3300026075 | Bacteria | 5802 |
| 237 | Ga0207702_10442852 | 3300026078 | Bacteria | 1259 |
| 238 | Ga0207641_10440243 | 3300026088 | Bacteria | 1258 |
| 239 | Ga0207648_10001982 | 3300026089 | Bacteria | 22367 |
| 240 | Ga0207676_10348522 | 3300026095 | Bacteria | 1369 |
| 241 | Ga0207675_100003213 | 3300026118 | Bacteria | 16025 |
| 242 | Ga0207675_100138610 | 3300026118 | Bacteria | 2310 |
| 243 | Ga0207675_100179340 | 3300026118 | Bacteria | 2028 |
| 244 | Ga0207675_100696180 | 3300026118 | Bacteria | 1025 |
| 245 | Ga0207675_100957824 | 3300026118 | Bacteria | 873 |
| 246 | Ga0207683_10000874 | 3300026121 | Bacteria | 27618 |
| 247 | Ga0207683_10094198 | 3300026121 | Bacteria | 2669 |
| 248 | Ga0207698_10093802 | 3300026142 | Bacteria | 2466 |
| 249 | Ga0207698_10266581 | 3300026142 | Bacteria | 1576 |
| 250 | Ga0268266_10075534 | 3300028379 | Bacteria | 2927 |
| 251 | Ga0268266_10383239 | 3300028379 | Bacteria | 1326 |
| 252 | Ga0268266_10894315 | 3300028379 | Bacteria | 859 |
| 253 | Ga0268265_10048422 | 3300028380 | Bacteria | 3190 |
| 254 | Ga0268265_10050506 | 3300028380 | Bacteria | 3134 |
| 255 | Ga0268264_10002334 | 3300028381 | Bacteria | 16769 |
| 256 | Ga0268264_10482353 | 3300028381 | Bacteria | 1206 |
| 257 | Ga0268264_10582534 | 3300028381 | Bacteria | 1101 |
| 258 | Ga0307409_101720900 | 3300031995 | Bacteria | 656 |
| 259 | Ga0307416_100948497 | 3300032002 | Bacteria | 962 |
| 260 | Ga0373931_0112176 | 3300035691 | Bacteria | 1548 |
| 261 | Ga0436364_0699371 | 3300037853 | Bacteria | 4336 |
| 262 | Ga0436364_0946484 | 3300037853 | Bacteria | 1723 |
| 263 | Ga0436364_1124629 | 3300037853 | Bacteria | 7056 |
| 264 | Ga0436365_0437998 | 3300039437 | Bacteria | 29340 |
| 265 | Ga0436365_0440716 | 3300039437 | Bacteria | 15038 |
| 266 | Ga0436365_0681434 | 3300039437 | Bacteria | 1597 |
| 267 | Ga0436365_1122234 | 3300039437 | Bacteria | 14155 |
| 268 | Ga0436363_0172568 | 3300039450 | Bacteria | 676 |
| 269 | Ga0436363_1676298 | 3300039450 | Bacteria | 1017 |
| 270 | Ga0439461_0005667 | 3300041410 | Bacteria | 2141 |
| 271 | Ga0439466_0014371 | 3300041411 | Bacteria | 2884 |
| 272 | Ga0439466_0080398 | 3300041411 | Bacteria | 1028 |
| 273 | Ga0439465_0005561 | 3300041413 | Bacteria | 4017 |
| 274 | Ga0439465_0107896 | 3300041413 | Bacteria | 966 |
| 275 | Ga0439431_0038034 | 3300041997 | Bacteria | 1216 |
| 276 | Ga0439445_0005335 | 3300042004 | Bacteria | 2927 |
| 277 | Ga0439445_0010081 | 3300042004 | Bacteria | 2231 |
| 278 | Ga0439434_0084787 | 3300042435 | Bacteria | 1008 |
| 279 | Ga0439459_0016602 | 3300042438 | Bacteria | 1362 |
| 280 | Ga0466969_0181239 | 3300044656 | Bacteria | 964 |
| 281 | Ga0466965_0092658 | 3300044683 | Bacteria | 1538 |
| 282 | Ga0466966_0003701 | 3300044684 | Bacteria | 10082 |
| 283 | Ga0466966_0024064 | 3300044684 | Bacteria | 3986 |
| 284 | Ga0466966_0084336 | 3300044684 | Bacteria | 1976 |
| 285 | Ga0466966_0599465 | 3300044684 | Bacteria | 663 |
| 286 | Ga0466961_0121425 | 3300044693 | Bacteria | 1640 |
| 287 | Ga0466963_0031021 | 3300044694 | Bacteria | 3453 |
| 288 | Ga0466963_0104129 | 3300044694 | Bacteria | 1944 |
| 289 | Ga0466963_0936216 | 3300044694 | Bacteria | 610 |
| 290 | Ga0466964_0395572 | 3300044706 | Bacteria | 721 |
| 291 | Ga0466971_0030636 | 3300044719 | Bacteria | 2408 |
| 292 | Ga0466971_0099747 | 3300044719 | Bacteria | 1334 |
| 293 | Ga0466968_0006930 | 3300044735 | Bacteria | 4291 |
| 294 | Ga0466968_0063649 | 3300044735 | Bacteria | 1594 |
| 295 | Ga0466968_0323826 | 3300044735 | Bacteria | 745 |
| 296 | Ga0466970_0011211 | 3300044765 | Bacteria | 4567 |
| 297 | Ga0466970_0019606 | 3300044765 | Bacteria | 3507 |
| 298 | Ga0466970_0025776 | 3300044765 | Bacteria | 3080 |
| 299 | Ga0466957_0023416 | 3300044842 | Bacteria | 3651 |
| 300 | Ga0466957_0067930 | 3300044842 | Bacteria | 2200 |
| 301 | Ga0466957_0075437 | 3300044842 | Bacteria | 2092 |
| 302 | Ga0466957_0079857 | 3300044842 | Bacteria | 2036 |
| 303 | Ga0466960_0000524 | 3300044901 | Bacteria | 13143 |
| 304 | Ga0466960_0004253 | 3300044901 | Bacteria | 5577 |
| 305 | Ga0466960_0021153 | 3300044901 | Bacteria | 2892 |
| 306 | Ga0466959_0014120 | 3300045049 | Bacteria | 5796 |
| 307 | Ga0466958_0050102 | 3300045836 | Bacteria | 2528 |
| 308 | Ga0466958_0105300 | 3300045836 | Bacteria | 1757 |
| 309 | Ga0466958_0346260 | 3300045836 | Bacteria | 956 |
| 310 | Ga0466967_0015451 | 3300045976 | Bacteria | 5984 |
| 311 | Ga0466967_0033996 | 3300045976 | Bacteria | 4321 |
| 312 | Ga0466967_0052634 | 3300045976 | Bacteria | 3575 |
| 313 | Ga0466967_0154139 | 3300045976 | Bacteria | 2150 |
| 314 | Ga0466967_0660700 | 3300045976 | Bacteria | 1034 |
| 315 | Ga0495638_0013470 | 3300046460 | Bacteria | 5566 |
| 316 | Ga0495638_0072658 | 3300046460 | Bacteria | 2101 |
| 317 | Ga0495672_0142282 | 3300047320 | Bacteria | 1252 |
| 318 | Ga0495626_0075845 | 3300048091 | Bacteria | 1502 |
| 319 | Ga0496100_0015136 | 3300048903 | Bacteria | 4500 |
| 320 | Ga0496100_0023709 | 3300048903 | Bacteria | 3733 |
| 321 | Ga0496100_0067024 | 3300048903 | Bacteria | 2383 |
| 322 | Ga0496101_0000172 | 3300048904 | Bacteria | 53462 |
| 323 | Ga0496101_0001046 | 3300048904 | Bacteria | 16358 |
| 324 | Ga0496101_0060047 | 3300048904 | Bacteria | 2758 |
| 325 | Ga0496101_0805095 | 3300048904 | Bacteria | 741 |
| 326 | Ga0496101_0924982 | 3300048904 | Bacteria | 686 |
| 327 | Ga0496102_0000003 | 3300048905 | Bacteria | 592263 |
| 328 | Ga0496102_0020134 | 3300048905 | Bacteria | 5891 |
| 329 | Ga0496102_0034019 | 3300048905 | Bacteria | 4583 |
| 330 | Ga0496102_0045839 | 3300048905 | Bacteria | 3970 |
| 331 | Ga0496102_0175535 | 3300048905 | Bacteria | 2017 |
| 332 | Ga0496103_0000012 | 3300048906 | Bacteria | 301778 |
| 333 | Ga0496103_0015221 | 3300048906 | Bacteria | 4573 |
| 334 | Ga0496103_0686781 | 3300048906 | Bacteria | 649 |
| 335 | Ga0496104_0106502 | 3300048907 | Bacteria | 2687 |
| 336 | Ga0496104_0225499 | 3300048907 | Bacteria | 1786 |
| 337 | Ga0496105_0096567 | 3300048908 | Bacteria | 2441 |
| 338 | Ga0496106_0002202 | 3300048909 | Bacteria | 14552 |
| 339 | Ga0496106_0034302 | 3300048909 | Bacteria | 3790 |
| 340 | Ga0496106_0054709 | 3300048909 | Bacteria | 3015 |
| 341 | Ga0496107_0011929 | 3300048910 | Bacteria | 6068 |
| 342 | Ga0496107_0044602 | 3300048910 | Bacteria | 3188 |
| 343 | Ga0496108_0000687 | 3300048911 | Bacteria | 26194 |
| 344 | Ga0496108_0064031 | 3300048911 | Bacteria | 3097 |
| 345 | Ga0496108_0531950 | 3300048911 | Bacteria | 1026 |
| 346 | Ga0496109_0002791 | 3300048912 | Bacteria | 14627 |
| 347 | Ga0496109_0187129 | 3300048912 | Bacteria | 1945 |
| 348 | Ga0496110_0054171 | 3300048913 | Bacteria | 3528 |
| 349 | Ga0496111_0266721 | 3300048914 | Bacteria | 1270 |
| 350 | Ga0496112_0061803 | 3300048915 | Bacteria | 3693 |
| 351 | Ga0496112_0194499 | 3300048915 | Bacteria | 1989 |
| 352 | Ga0496112_0201250 | 3300048915 | Bacteria | 1951 |
| 353 | Ga0496112_0312371 | 3300048915 | Bacteria | 1517 |
| 354 | Ga0496112_0741130 | 3300048915 | Bacteria | 909 |
| 355 | Ga0496113_0827103 | 3300048916 | Bacteria | 735 |
| 356 | Ga0496114_0001860 | 3300048917 | Bacteria | 15987 |
| 357 | Ga0496114_0120251 | 3300048917 | Bacteria | 2258 |
| 358 | Ga0496114_0193338 | 3300048917 | Bacteria | 1781 |
| 359 | Ga0496115_0000584 | 3300048918 | Bacteria | 27971 |
| 360 | Ga0496115_0270236 | 3300048918 | Bacteria | 1397 |
| 361 | Ga0496116_0000040 | 3300048919 | Bacteria | 346900 |
| 362 | Ga0496117_0000003 | 3300048920 | Bacteria | 1881097 |
| 363 | Ga0496118_0000001 | 3300048921 | Bacteria | 1881100 |
| 364 | Ga0496118_0000452 | 3300048921 | Bacteria | 67982 |
| 365 | Ga0496119_0000591 | 3300048922 | Bacteria | 49100 |
| 366 | Ga0496119_0023085 | 3300048922 | Bacteria | 4427 |
| 367 | Ga0496120_0000293 | 3300048923 | Bacteria | 83834 |
| 368 | Ga0496120_0055759 | 3300048923 | Bacteria | 2233 |
| 369 | Ga0496121_0000019 | 3300048924 | Bacteria | 499976 |
| 370 | Ga0496123_0135145 | 3300048926 | Bacteria | 1358 |
| 371 | Ga0496125_0068019 | 3300048928 | Bacteria | 2804 |
| 372 | Ga0496126_0008979 | 3300048929 | Bacteria | 10697 |
| 373 | Ga0496126_0016585 | 3300048929 | Bacteria | 7362 |
| 374 | Ga0496126_0087550 | 3300048929 | Bacteria | 2744 |
| 375 | Ga0496126_0412264 | 3300048929 | Bacteria | 1094 |
| 376 | Ga0501031_0561182 | 3300049568 | Bacteria | 735 |
| 377 | Ga0501032_0001855 | 3300049569 | Bacteria | 16721 |
| 378 | Ga0501033_0012173 | 3300049570 | Bacteria | 6566 |
| 379 | Ga0501034_0003235 | 3300049571 | Bacteria | 18642 |
| 380 | Ga0501036_0330281 | 3300049572 | Bacteria | 1274 |
| 381 | Ga0501037_0037184 | 3300049573 | Bacteria | 3588 |
| 382 | Ga0501043_0017523 | 3300049579 | Bacteria | 5616 |
| 383 | Ga0501046_0000969 | 3300049580 | Bacteria | 28158 |
| 384 | Ga0501047_0003181 | 3300049581 | Bacteria | 15564 |
| 385 | Ga0501047_0659771 | 3300049581 | Bacteria | 865 |
| 386 | Ga0501048_0004345 | 3300049582 | Bacteria | 10789 |
| 387 | Ga0501069_0005667 | 3300049585 | Bacteria | 6505 |
| 388 | Ga0501070_0001271 | 3300049586 | Bacteria | 22663 |
| 389 | Ga0501070_0029281 | 3300049586 | Bacteria | 4619 |
| 390 | Ga0501070_0467161 | 3300049586 | Bacteria | 1016 |
| 391 | Ga0501035_0001201 | 3300049822 | Bacteria | 26999 |
| 392 | Ga0501035_0358338 | 3300049822 | Bacteria | 1219 |
| 393 | Ga0501044_0002283 | 3300049823 | Bacteria | 21835 |
| 394 | Ga0501044_0610743 | 3300049823 | Bacteria | 983 |
| 395 | nmdc:mga03n38_146535_c1 | 3300050490 | Bacteria | 1184 |
| 396 | nmdc:mga00v17_117947_c1 | 3300050491 | Bacteria | 1688 |
| 397 | nmdc:mga00v17_2227_c1 | 3300050491 | Bacteria | 9954 |
| 398 | nmdc:mga0yw44_56352_c1 | 3300050492 | Bacteria | 2394 |
| 399 | nmdc:mga06z11_266237_c1 | 3300050494 | Bacteria | 1012 |
| 400 | nmdc:mga07m45_120644_c1 | 3300050496 | Bacteria | 1514 |
| 401 | nmdc:mga07m45_203489_c1 | 3300050496 | Bacteria | 1152 |
| 402 | nmdc:mga0qj67_267578_c1 | 3300050509 | Bacteria | 1386 |
| 403 | nmdc:mga0qj67_27086_c1 | 3300050509 | Bacteria | 4440 |
| 404 | nmdc:mga0qj67_272615_c1 | 3300050509 | Bacteria | 1372 |
| 405 | nmdc:mga0sz30_12554_c1 | 3300050516 | Bacteria | 3298 |
| 406 | nmdc:mga0sz30_22037_c1 | 3300050516 | Bacteria | 2582 |
| 407 | nmdc:mga0sz30_2281_c1 | 3300050516 | Bacteria | 6853 |
| 408 | nmdc:mga0sz30_2817_c1 | 3300050516 | Bacteria | 6209 |
| 409 | Ga0500643_009573 | 3300053087 | Bacteria | 3691 |
| 410 | Ga0500641_0188657 | 3300053096 | Bacteria | 883 |
| 411 | Ga0500562_001236 | 3300053108 | Bacteria | 6292 |
| 412 | Ga0500642_0128415 | 3300053130 | Bacteria | 1187 |
| 413 | Ga0500559_0064178 | 3300053136 | Bacteria | 1643 |
| 414 | Ga0500568_0136457 | 3300053139 | Bacteria | 910 |
| 415 | Ga0500577_0107447 | 3300053142 | Bacteria | 1148 |
| 416 | Ga0500645_000070 | 3300053730 | Bacteria | 79917 |
| 417 | Ga0466962_0077931 | 3300061719 | Bacteria | 1584 |
| 418 | Ga0466962_0078248 | 3300061719 | Bacteria | 1581 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045836 | Ga0466958_0346260 | Ga0466958_0346260_13_528 | 161 |
| 2 | 3300006186 | Ga0075369_10006876 | Ga0075369_100068764 | 168 |
| 3 | 3300041411 | Ga0439466_0014371 | Ga0439466_0014371_805_1413 | 168 |
| 4 | 3300041413 | Ga0439465_0005561 | Ga0439465_0005561_1460_2068 | 168 |
| 5 | 3300042004 | Ga0439445_0010081 | Ga0439445_0010081_742_1350 | 168 |
| 6 | 3300050516 | nmdc:mga0sz30_12554_c1 | nmdc:mga0sz30_12554_c1_1646_2245 | 168 |
| 7 | 3300049586 | Ga0501070_0029281 | Ga0501070_0029281_1984_2592 | 170 |
| 8 | 3300005445 | Ga0070708_100782472 | Ga0070708_1007824721 | 173 |
| 9 | 3300047320 | Ga0495672_0142282 | Ga0495672_0142282_514_1113 | 173 |
| 10 | 3300031995 | Ga0307409_101720900 | Ga0307409_1017209001 | 174 |
| 11 | 3300050491 | nmdc:mga00v17_117947_c1 | nmdc:mga00v17_117947_c1_109_702 | 174 |
| 12 | 3300041410 | Ga0439461_0005667 | Ga0439461_0005667_1574_2131 | 175 |
| 13 | 3300041411 | Ga0439466_0080398 | Ga0439466_0080398_111_668 | 175 |
| 14 | 3300041413 | Ga0439465_0107896 | Ga0439465_0107896_109_666 | 175 |
| 15 | 3300042004 | Ga0439445_0005335 | Ga0439445_0005335_2344_2901 | 175 |
| 16 | 3300050509 | nmdc:mga0qj67_27086_c1 | nmdc:mga0qj67_27086_c1_158_715 | 175 |
| 17 | 3300050496 | nmdc:mga07m45_120644_c1 | nmdc:mga07m45_120644_c1_905_1483 | 176 |
| 18 | 3300006051 | Ga0075364_10622824 | Ga0075364_106228242 | 177 |
| 19 | 3300050509 | nmdc:mga0qj67_267578_c1 | nmdc:mga0qj67_267578_c1_674_1270 | 178 |
| 20 | 3300045976 | Ga0466967_0660700 | Ga0466967_0660700_438_1010 | 180 |
| 21 | 3300005338 | Ga0068868_100680550 | Ga0068868_1006805501 | 182 |
| 22 | 3300044706 | Ga0466964_0395572 | Ga0466964_0395572_92_685 | 182 |
| 23 | 3300045976 | Ga0466967_0154139 | Ga0466967_0154139_396_989 | 182 |
| 24 | 3300044694 | Ga0466963_0936216 | Ga0466963_0936216_12_593 | 183 |
| 25 | iso_pu_bacteria | 2738541274 | 2738704708 | 184 |
| 26 | iso_pu_bacteria | 2738543028 | 2739329877 | 184 |
| 27 | iso_pu_bacteria | 2902792274 | 2902792905 | 184 |
| 28 | iso_pu_bacteria | 2902837492 | 2902841836 | 184 |
| 29 | 3300005468 | Ga0070707_100420023 | Ga0070707_1004200231 | 185 |
| 30 | 3300009098 | Ga0105245_10341867 | Ga0105245_103418672 | 185 |
| 31 | 3300009551 | Ga0105238_11191741 | Ga0105238_111917412 | 185 |
| 32 | 3300011119 | Ga0105246_10131243 | Ga0105246_101312432 | 185 |
| 33 | 3300039450 | Ga0436363_0172568 | Ga0436363_0172568_12_599 | 185 |
| 34 | 3300048911 | Ga0496108_0064031 | Ga0496108_0064031_2496_3083 | 185 |
| 35 | 3300048912 | Ga0496109_0187129 | Ga0496109_0187129_1087_1674 | 185 |
| 36 | 3300048914 | Ga0496111_0266721 | Ga0496111_0266721_98_685 | 185 |
| 37 | 3300048915 | Ga0496112_0312371 | Ga0496112_0312371_454_1041 | 185 |
| 38 | 3300048916 | Ga0496113_0827103 | Ga0496113_0827103_18_605 | 185 |
| 39 | 3300005436 | Ga0070713_100139409 | Ga0070713_1001394092 | 186 |
| 40 | 3300044683 | Ga0466965_0092658 | Ga0466965_0092658_580_1170 | 186 |
| 41 | 3300044684 | Ga0466966_0599465 | Ga0466966_0599465_17_607 | 186 |
| 42 | 3300044735 | Ga0466968_0006930 | Ga0466968_0006930_623_1213 | 186 |
| 43 | 3300044765 | Ga0466970_0019606 | Ga0466970_0019606_2614_3204 | 186 |
| 44 | 3300044765 | Ga0466970_0025776 | Ga0466970_0025776_1265_1855 | 186 |
| 45 | 3300044842 | Ga0466957_0075437 | Ga0466957_0075437_161_751 | 186 |
| 46 | 3300044901 | Ga0466960_0004253 | Ga0466960_0004253_4408_4998 | 186 |
| 47 | 3300048904 | Ga0496101_0060047 | Ga0496101_0060047_1950_2540 | 186 |
| 48 | 3300048915 | Ga0496112_0194499 | Ga0496112_0194499_660_1250 | 186 |
| 49 | 3300048921 | Ga0496118_0000452 | Ga0496118_0000452_34593_35183 | 186 |
| 50 | 3300048923 | Ga0496120_0055759 | Ga0496120_0055759_1168_1758 | 186 |
| 51 | 3300048926 | Ga0496123_0135145 | Ga0496123_0135145_746_1336 | 186 |
| 52 | 3300048929 | Ga0496126_0087550 | Ga0496126_0087550_330_920 | 186 |
| 53 | iso_pu_bacteria | 2842134933 | 2842136702 | 186 |
| 54 | iso_pu_bacteria | 2929212328 | 2929213690 | 186 |
| 55 | 3300005455 | Ga0070663_100022570 | Ga0070663_1000225702 | 187 |
| 56 | 3300005617 | Ga0068859_100096139 | Ga0068859_1000961391 | 187 |
| 57 | 3300006028 | Ga0070717_10991503 | Ga0070717_109915031 | 187 |
| 58 | 3300006931 | Ga0097620_100096128 | Ga0097620_1000961281 | 187 |
| 59 | 3300009092 | Ga0105250_10090533 | Ga0105250_100905331 | 187 |
| 60 | 3300009098 | Ga0105245_10017664 | Ga0105245_100176645 | 187 |
| 61 | 3300009098 | Ga0105245_10047102 | Ga0105245_100471021 | 187 |
| 62 | 3300009101 | Ga0105247_10001612 | Ga0105247_1000161214 | 187 |
| 63 | 3300009148 | Ga0105243_10013360 | Ga0105243_100133605 | 187 |
| 64 | 3300009148 | Ga0105243_10183824 | Ga0105243_101838242 | 187 |
| 65 | 3300009174 | Ga0105241_10160408 | Ga0105241_101604082 | 187 |
| 66 | 3300009176 | Ga0105242_10002300 | Ga0105242_1000230014 | 187 |
| 67 | 3300009176 | Ga0105242_10105959 | Ga0105242_101059593 | 187 |
| 68 | 3300009177 | Ga0105248_10004806 | Ga0105248_1000480614 | 187 |
| 69 | 3300009545 | Ga0105237_10025156 | Ga0105237_100251564 | 187 |
| 70 | 3300009545 | Ga0105237_11005720 | Ga0105237_110057202 | 187 |
| 71 | 3300009551 | Ga0105238_10446767 | Ga0105238_104467672 | 187 |
| 72 | 3300009553 | Ga0105249_10001128 | Ga0105249_1000112818 | 187 |
| 73 | 3300009553 | Ga0105249_10127895 | Ga0105249_101278952 | 187 |
| 74 | 3300009553 | Ga0105249_10732259 | Ga0105249_107322591 | 187 |
| 75 | 3300010375 | Ga0105239_10012717 | Ga0105239_100127174 | 187 |
| 76 | 3300011119 | Ga0105246_10279991 | Ga0105246_102799912 | 187 |
| 77 | 3300013102 | Ga0157371_10205117 | Ga0157371_102051172 | 187 |
| 78 | 3300013105 | Ga0157369_10229067 | Ga0157369_102290672 | 187 |
| 79 | 3300013296 | Ga0157374_10038816 | Ga0157374_100388165 | 187 |
| 80 | 3300013297 | Ga0157378_10001538 | Ga0157378_1000153818 | 187 |
| 81 | 3300013297 | Ga0157378_10893198 | Ga0157378_108931981 | 187 |
| 82 | 3300013306 | Ga0163162_10023272 | Ga0163162_100232724 | 187 |
| 83 | 3300013306 | Ga0163162_10993923 | Ga0163162_109939231 | 187 |
| 84 | 3300013307 | Ga0157372_10016361 | Ga0157372_100163617 | 187 |
| 85 | 3300013308 | Ga0157375_10001296 | Ga0157375_1000129619 | 187 |
| 86 | 3300013308 | Ga0157375_10108676 | Ga0157375_101086762 | 187 |
| 87 | 3300014326 | Ga0157380_10012747 | Ga0157380_100127475 | 187 |
| 88 | 3300014745 | Ga0157377_10004472 | Ga0157377_100044724 | 187 |
| 89 | 3300014745 | Ga0157377_10144191 | Ga0157377_101441912 | 187 |
| 90 | 3300014968 | Ga0157379_10075650 | Ga0157379_100756502 | 187 |
| 91 | 3300021384 | Ga0213876_10009975 | Ga0213876_100099755 | 187 |
| 92 | 3300021384 | Ga0213876_10013880 | Ga0213876_100138802 | 187 |
| 93 | 3300021388 | Ga0213875_10018290 | Ga0213875_100182902 | 187 |
| 94 | 3300026023 | Ga0207677_10030643 | Ga0207677_100306434 | 187 |
| 95 | 3300026035 | Ga0207703_10071873 | Ga0207703_100718732 | 187 |
| 96 | 3300026118 | Ga0207675_100179340 | Ga0207675_1001793403 | 187 |
| 97 | 3300035691 | Ga0373931_0112176 | Ga0373931_0112176_811_1404 | 187 |
| 98 | 3300037853 | Ga0436364_1124629 | Ga0436364_1124629_872_1465 | 187 |
| 99 | 3300039437 | Ga0436365_0437998 | Ga0436365_0437998_13872_14465 | 187 |
| 100 | 3300039437 | Ga0436365_0440716 | Ga0436365_0440716_890_1483 | 187 |
| 101 | 3300044656 | Ga0466969_0181239 | Ga0466969_0181239_22_615 | 187 |
| 102 | 3300044694 | Ga0466963_0031021 | Ga0466963_0031021_389_982 | 187 |
| 103 | 3300044735 | Ga0466968_0323826 | Ga0466968_0323826_95_688 | 187 |
| 104 | 3300044901 | Ga0466960_0021153 | Ga0466960_0021153_25_636 | 187 |
| 105 | 3300048903 | Ga0496100_0067024 | Ga0496100_0067024_430_1023 | 187 |
| 106 | 3300048904 | Ga0496101_0001046 | Ga0496101_0001046_14119_14712 | 187 |
| 107 | 3300048905 | Ga0496102_0020134 | Ga0496102_0020134_3671_4264 | 187 |
| 108 | 3300048905 | Ga0496102_0034019 | Ga0496102_0034019_63_656 | 187 |
| 109 | 3300048905 | Ga0496102_0175535 | Ga0496102_0175535_1306_1899 | 187 |
| 110 | 3300048906 | Ga0496103_0015221 | Ga0496103_0015221_2344_2937 | 187 |
| 111 | 3300048907 | Ga0496104_0225499 | Ga0496104_0225499_497_1090 | 187 |
| 112 | 3300048909 | Ga0496106_0002202 | Ga0496106_0002202_13433_14026 | 187 |
| 113 | 3300048910 | Ga0496107_0011929 | Ga0496107_0011929_2409_3002 | 187 |
| 114 | 3300048910 | Ga0496107_0044602 | Ga0496107_0044602_296_889 | 187 |
| 115 | 3300048911 | Ga0496108_0000687 | Ga0496108_0000687_13913_14506 | 187 |
| 116 | 3300048912 | Ga0496109_0002791 | Ga0496109_0002791_6139_6732 | 187 |
| 117 | 3300048913 | Ga0496110_0054171 | Ga0496110_0054171_2071_2664 | 187 |
| 118 | 3300048915 | Ga0496112_0061803 | Ga0496112_0061803_238_831 | 187 |
| 119 | 3300048915 | Ga0496112_0741130 | Ga0496112_0741130_170_781 | 187 |
| 120 | 3300048917 | Ga0496114_0001860 | Ga0496114_0001860_1645_2238 | 187 |
| 121 | 3300048917 | Ga0496114_0120251 | Ga0496114_0120251_452_1045 | 187 |
| 122 | 3300048918 | Ga0496115_0000584 | Ga0496115_0000584_18417_19010 | 187 |
| 123 | 3300048918 | Ga0496115_0270236 | Ga0496115_0270236_58_651 | 187 |
| 124 | 3300048929 | Ga0496126_0008979 | Ga0496126_0008979_3807_4400 | 187 |
| 125 | 3300049586 | Ga0501070_0467161 | Ga0501070_0467161_412_1005 | 187 |
| 126 | 3300049822 | Ga0501035_0358338 | Ga0501035_0358338_583_1176 | 187 |
| 127 | 3300050490 | nmdc:mga03n38_146535_c1 | nmdc:mga03n38_146535_c1_521_1132 | 187 |
| 128 | 3300050509 | nmdc:mga0qj67_272615_c1 | nmdc:mga0qj67_272615_c1_42_641 | 187 |
| 129 | 3300050516 | nmdc:mga0sz30_2281_c1 | nmdc:mga0sz30_2281_c1_5837_6430 | 187 |
| 130 | 3300053130 | Ga0500642_0128415 | Ga0500642_0128415_296_889 | 187 |
| 131 | 3300005329 | Ga0070683_100440986 | Ga0070683_1004409862 | 188 |
| 132 | 3300005338 | Ga0068868_100218963 | Ga0068868_1002189632 | 188 |
| 133 | 3300005466 | Ga0070685_10359211 | Ga0070685_103592112 | 188 |
| 134 | 3300005535 | Ga0070684_100144900 | Ga0070684_1001449002 | 188 |
| 135 | 3300005547 | Ga0070693_100844752 | Ga0070693_1008447521 | 188 |
| 136 | 3300005548 | Ga0070665_101228472 | Ga0070665_1012284721 | 188 |
| 137 | 3300005983 | Ga0081540_1110744 | Ga0081540_11107442 | 188 |
| 138 | 3300006038 | Ga0075365_10054183 | Ga0075365_100541831 | 188 |
| 139 | 3300006048 | Ga0075363_100189806 | Ga0075363_1001898062 | 188 |
| 140 | 3300006051 | Ga0075364_10020084 | Ga0075364_100200843 | 188 |
| 141 | 3300006178 | Ga0075367_10299417 | Ga0075367_102994172 | 188 |
| 142 | 3300006353 | Ga0075370_10055685 | Ga0075370_100556853 | 188 |
| 143 | 3300009101 | Ga0105247_10622907 | Ga0105247_106229072 | 188 |
| 144 | 3300009545 | Ga0105237_10143692 | Ga0105237_101436922 | 188 |
| 145 | 3300025914 | Ga0207671_10024709 | Ga0207671_100247095 | 188 |
| 146 | 3300025944 | Ga0207661_10301028 | Ga0207661_103010282 | 188 |
| 147 | 3300025949 | Ga0207667_10328234 | Ga0207667_103282342 | 188 |
| 148 | 3300026023 | Ga0207677_10366817 | Ga0207677_103668172 | 188 |
| 149 | 3300026067 | Ga0207678_10078934 | Ga0207678_100789343 | 188 |
| 150 | 3300026095 | Ga0207676_10348522 | Ga0207676_103485222 | 188 |
| 151 | 3300028379 | Ga0268266_10894315 | Ga0268266_108943152 | 188 |
| 152 | 3300042438 | Ga0439459_0016602 | Ga0439459_0016602_41_637 | 188 |
| 153 | 3300046460 | Ga0495638_0072658 | Ga0495638_0072658_284_880 | 188 |
| 154 | 3300048903 | Ga0496100_0015136 | Ga0496100_0015136_2360_2956 | 188 |
| 155 | 3300048904 | Ga0496101_0000172 | Ga0496101_0000172_15092_15688 | 188 |
| 156 | 3300048904 | Ga0496101_0805095 | Ga0496101_0805095_121_717 | 188 |
| 157 | 3300048905 | Ga0496102_0000003 | Ga0496102_0000003_298801_299397 | 188 |
| 158 | 3300048906 | Ga0496103_0000012 | Ga0496103_0000012_8313_8909 | 188 |
| 159 | 3300048909 | Ga0496106_0034302 | Ga0496106_0034302_448_1044 | 188 |
| 160 | 3300048911 | Ga0496108_0531950 | Ga0496108_0531950_174_770 | 188 |
| 161 | 3300048919 | Ga0496116_0000040 | Ga0496116_0000040_53441_54037 | 188 |
| 162 | 3300048920 | Ga0496117_0000003 | Ga0496117_0000003_292867_293463 | 188 |
| 163 | 3300048921 | Ga0496118_0000001 | Ga0496118_0000001_292870_293466 | 188 |
| 164 | 3300048922 | Ga0496119_0000591 | Ga0496119_0000591_36232_36828 | 188 |
| 165 | 3300048922 | Ga0496119_0023085 | Ga0496119_0023085_3800_4396 | 188 |
| 166 | 3300048923 | Ga0496120_0000293 | Ga0496120_0000293_29786_30382 | 188 |
| 167 | 3300048924 | Ga0496121_0000019 | Ga0496121_0000019_308219_308815 | 188 |
| 168 | 3300048928 | Ga0496125_0068019 | Ga0496125_0068019_1375_1971 | 188 |
| 169 | 3300048929 | Ga0496126_0016585 | Ga0496126_0016585_766_1362 | 188 |
| 170 | 3300050491 | nmdc:mga00v17_2227_c1 | nmdc:mga00v17_2227_c1_6992_7588 | 188 |
| 171 | 3300050492 | nmdc:mga0yw44_56352_c1 | nmdc:mga0yw44_56352_c1_1685_2281 | 188 |
| 172 | 3300050494 | nmdc:mga06z11_266237_c1 | nmdc:mga06z11_266237_c1_382_978 | 188 |
| 173 | 3300050496 | nmdc:mga07m45_203489_c1 | nmdc:mga07m45_203489_c1_258_854 | 188 |
| 174 | 3300050516 | nmdc:mga0sz30_22037_c1 | nmdc:mga0sz30_22037_c1_307_903 | 188 |
| 175 | 3300053087 | Ga0500643_009573 | Ga0500643_009573_2112_2708 | 188 |
| 176 | 3300053096 | Ga0500641_0188657 | Ga0500641_0188657_209_805 | 188 |
| 177 | 3300053136 | Ga0500559_0064178 | Ga0500559_0064178_55_651 | 188 |
| 178 | 3300053139 | Ga0500568_0136457 | Ga0500568_0136457_197_793 | 188 |
| 179 | 3300053730 | Ga0500645_000070 | Ga0500645_000070_64620_65216 | 188 |
| 180 | 3300005435 | Ga0070714_100463717 | Ga0070714_1004637172 | 189 |
| 181 | 3300005440 | Ga0070705_100179158 | Ga0070705_1001791581 | 189 |
| 182 | 3300006846 | Ga0075430_100021855 | Ga0075430_1000218553 | 189 |
| 183 | 3300032002 | Ga0307416_100948497 | Ga0307416_1009484972 | 189 |
| 184 | 3300041997 | Ga0439431_0038034 | Ga0439431_0038034_60_659 | 189 |
| 185 | 3300042435 | Ga0439434_0084787 | Ga0439434_0084787_253_852 | 189 |
| 186 | 3300044694 | Ga0466963_0104129 | Ga0466963_0104129_17_631 | 189 |
| 187 | 3300044719 | Ga0466971_0030636 | Ga0466971_0030636_710_1327 | 189 |
| 188 | 3300044842 | Ga0466957_0079857 | Ga0466957_0079857_1022_1636 | 189 |
| 189 | 3300044901 | Ga0466960_0000524 | Ga0466960_0000524_3217_3831 | 189 |
| 190 | 3300045836 | Ga0466958_0050102 | Ga0466958_0050102_1204_1818 | 189 |
| 191 | 3300045976 | Ga0466967_0033996 | Ga0466967_0033996_657_1271 | 189 |
| 192 | 3300049568 | Ga0501031_0561182 | Ga0501031_0561182_18_632 | 189 |
| 193 | 3300049569 | Ga0501032_0001855 | Ga0501032_0001855_9347_9961 | 189 |
| 194 | 3300049570 | Ga0501033_0012173 | Ga0501033_0012173_3213_3827 | 189 |
| 195 | 3300049571 | Ga0501034_0003235 | Ga0501034_0003235_7455_8069 | 189 |
| 196 | 3300049572 | Ga0501036_0330281 | Ga0501036_0330281_415_1029 | 189 |
| 197 | 3300049573 | Ga0501037_0037184 | Ga0501037_0037184_1085_1699 | 189 |
| 198 | 3300049579 | Ga0501043_0017523 | Ga0501043_0017523_3970_4584 | 189 |
| 199 | 3300049580 | Ga0501046_0000969 | Ga0501046_0000969_24023_24637 | 189 |
| 200 | 3300049581 | Ga0501047_0003181 | Ga0501047_0003181_12557_13171 | 189 |
| 201 | 3300049581 | Ga0501047_0659771 | Ga0501047_0659771_106_708 | 189 |
| 202 | 3300049582 | Ga0501048_0004345 | Ga0501048_0004345_3300_3914 | 189 |
| 203 | 3300049585 | Ga0501069_0005667 | Ga0501069_0005667_5661_6275 | 189 |
| 204 | 3300049586 | Ga0501070_0001271 | Ga0501070_0001271_6389_7003 | 189 |
| 205 | 3300049822 | Ga0501035_0001201 | Ga0501035_0001201_12641_13255 | 189 |
| 206 | 3300049823 | Ga0501044_0002283 | Ga0501044_0002283_7327_7941 | 189 |
| 207 | 3300061719 | Ga0466962_0077931 | Ga0466962_0077931_373_990 | 189 |
| 208 | 3300061719 | Ga0466962_0078248 | Ga0466962_0078248_302_916 | 189 |
| 209 | 3300001977 | JGI24746J21847_1011250 | JGI24746J21847_10112502 | 190 |
| 210 | 3300001990 | JGI24737J22298_10050680 | JGI24737J22298_100506802 | 190 |
| 211 | 3300001991 | JGI24743J22301_10000444 | JGI24743J22301_100004444 | 190 |
| 212 | 3300002073 | JGI24745J21846_1000671 | JGI24745J21846_10006713 | 190 |
| 213 | 3300002076 | JGI24749J21850_1015499 | JGI24749J21850_10154992 | 190 |
| 214 | 3300002077 | JGI24744J21845_10000472 | JGI24744J21845_100004724 | 190 |
| 215 | 3300002077 | JGI24744J21845_10002773 | JGI24744J21845_100027733 | 190 |
| 216 | 3300005328 | Ga0070676_10012022 | Ga0070676_100120221 | 190 |
| 217 | 3300005330 | Ga0070690_100072521 | Ga0070690_1000725213 | 190 |
| 218 | 3300005333 | Ga0070677_10103181 | Ga0070677_101031812 | 190 |
| 219 | 3300005334 | Ga0068869_100186290 | Ga0068869_1001862902 | 190 |
| 220 | 3300005335 | Ga0070666_10074530 | Ga0070666_100745301 | 190 |
| 221 | 3300005335 | Ga0070666_10373530 | Ga0070666_103735302 | 190 |
| 222 | 3300005338 | Ga0068868_100001453 | Ga0068868_1000014533 | 190 |
| 223 | 3300005338 | Ga0068868_100016326 | Ga0068868_1000163264 | 190 |
| 224 | 3300005339 | Ga0070660_100218419 | Ga0070660_1002184193 | 190 |
| 225 | 3300005341 | Ga0070691_10008585 | Ga0070691_100085853 | 190 |
| 226 | 3300005341 | Ga0070691_10228877 | Ga0070691_102288772 | 190 |
| 227 | 3300005341 | Ga0070691_10239641 | Ga0070691_102396412 | 190 |
| 228 | 3300005343 | Ga0070687_100053168 | Ga0070687_1000531682 | 190 |
| 229 | 3300005343 | Ga0070687_100251677 | Ga0070687_1002516772 | 190 |
| 230 | 3300005347 | Ga0070668_100006407 | Ga0070668_1000064073 | 190 |
| 231 | 3300005353 | Ga0070669_100627304 | Ga0070669_1006273041 | 190 |
| 232 | 3300005354 | Ga0070675_100789085 | Ga0070675_1007890851 | 190 |
| 233 | 3300005355 | Ga0070671_100104015 | Ga0070671_1001040153 | 190 |
| 234 | 3300005355 | Ga0070671_100744681 | Ga0070671_1007446811 | 190 |
| 235 | 3300005356 | Ga0070674_100007936 | Ga0070674_1000079366 | 190 |
| 236 | 3300005356 | Ga0070674_100654901 | Ga0070674_1006549011 | 190 |
| 237 | 3300005364 | Ga0070673_100104101 | Ga0070673_1001041012 | 190 |
| 238 | 3300005365 | Ga0070688_100238480 | Ga0070688_1002384801 | 190 |
| 239 | 3300005366 | Ga0070659_100080318 | Ga0070659_1000803182 | 190 |
| 240 | 3300005366 | Ga0070659_100173257 | Ga0070659_1001732573 | 190 |
| 241 | 3300005367 | Ga0070667_100003133 | Ga0070667_1000031331 | 190 |
| 242 | 3300005367 | Ga0070667_100494275 | Ga0070667_1004942751 | 190 |
| 243 | 3300005406 | Ga0070703_10022147 | Ga0070703_100221472 | 190 |
| 244 | 3300005434 | Ga0070709_10020567 | Ga0070709_100205674 | 190 |
| 245 | 3300005434 | Ga0070709_10024767 | Ga0070709_100247673 | 190 |
| 246 | 3300005435 | Ga0070714_101090857 | Ga0070714_1010908571 | 190 |
| 247 | 3300005436 | Ga0070713_100041868 | Ga0070713_1000418682 | 190 |
| 248 | 3300005437 | Ga0070710_10001014 | Ga0070710_100010147 | 190 |
| 249 | 3300005438 | Ga0070701_10036479 | Ga0070701_100364792 | 190 |
| 250 | 3300005439 | Ga0070711_100000280 | Ga0070711_1000002803 | 190 |
| 251 | 3300005439 | Ga0070711_100096702 | Ga0070711_1000967022 | 190 |
| 252 | 3300005441 | Ga0070700_100004174 | Ga0070700_1000041746 | 190 |
| 253 | 3300005441 | Ga0070700_100049175 | Ga0070700_1000491753 | 190 |
| 254 | 3300005444 | Ga0070694_100006083 | Ga0070694_1000060837 | 190 |
| 255 | 3300005455 | Ga0070663_100002851 | Ga0070663_1000028513 | 190 |
| 256 | 3300005456 | Ga0070678_100000626 | Ga0070678_10000062615 | 190 |
| 257 | 3300005456 | Ga0070678_100625694 | Ga0070678_1006256941 | 190 |
| 258 | 3300005459 | Ga0068867_100000835 | Ga0068867_1000008353 | 190 |
| 259 | 3300005459 | Ga0068867_101354430 | Ga0068867_1013544301 | 190 |
| 260 | 3300005466 | Ga0070685_10029477 | Ga0070685_100294773 | 190 |
| 261 | 3300005536 | Ga0070697_100821620 | Ga0070697_1008216201 | 190 |
| 262 | 3300005539 | Ga0068853_100011755 | Ga0068853_1000117553 | 190 |
| 263 | 3300005543 | Ga0070672_100100581 | Ga0070672_1001005813 | 190 |
| 264 | 3300005544 | Ga0070686_100040113 | Ga0070686_1000401133 | 190 |
| 265 | 3300005545 | Ga0070695_100080609 | Ga0070695_1000806093 | 190 |
| 266 | 3300005546 | Ga0070696_100041424 | Ga0070696_1000414243 | 190 |
| 267 | 3300005546 | Ga0070696_100112038 | Ga0070696_1001120383 | 190 |
| 268 | 3300005547 | Ga0070693_100001856 | Ga0070693_1000018562 | 190 |
| 269 | 3300005547 | Ga0070693_100123822 | Ga0070693_1001238222 | 190 |
| 270 | 3300005548 | Ga0070665_100028263 | Ga0070665_1000282632 | 190 |
| 271 | 3300005548 | Ga0070665_100149567 | Ga0070665_1001495673 | 190 |
| 272 | 3300005549 | Ga0070704_100012290 | Ga0070704_1000122904 | 190 |
| 273 | 3300005549 | Ga0070704_100135587 | Ga0070704_1001355872 | 190 |
| 274 | 3300005549 | Ga0070704_100988686 | Ga0070704_1009886861 | 190 |
| 275 | 3300005563 | Ga0068855_100041253 | Ga0068855_1000412533 | 190 |
| 276 | 3300005578 | Ga0068854_100000551 | Ga0068854_1000005514 | 190 |
| 277 | 3300005578 | Ga0068854_100160510 | Ga0068854_1001605102 | 190 |
| 278 | 3300005614 | Ga0068856_100222756 | Ga0068856_1002227563 | 190 |
| 279 | 3300005615 | Ga0070702_100000921 | Ga0070702_10000092110 | 190 |
| 280 | 3300005616 | Ga0068852_100045499 | Ga0068852_1000454993 | 190 |
| 281 | 3300005616 | Ga0068852_100122541 | Ga0068852_1001225412 | 190 |
| 282 | 3300005617 | Ga0068859_100239718 | Ga0068859_1002397183 | 190 |
| 283 | 3300005718 | Ga0068866_10007520 | Ga0068866_100075202 | 190 |
| 284 | 3300005719 | Ga0068861_100012218 | Ga0068861_1000122184 | 190 |
| 285 | 3300005719 | Ga0068861_100030369 | Ga0068861_1000303693 | 190 |
| 286 | 3300005840 | Ga0068870_10142640 | Ga0068870_101426403 | 190 |
| 287 | 3300005841 | Ga0068863_100639133 | Ga0068863_1006391332 | 190 |
| 288 | 3300005842 | Ga0068858_100021054 | Ga0068858_1000210545 | 190 |
| 289 | 3300005842 | Ga0068858_100284552 | Ga0068858_1002845522 | 190 |
| 290 | 3300005843 | Ga0068860_100001259 | Ga0068860_1000012594 | 190 |
| 291 | 3300005843 | Ga0068860_100047670 | Ga0068860_1000476705 | 190 |
| 292 | 3300005843 | Ga0068860_100170286 | Ga0068860_1001702863 | 190 |
| 293 | 3300005844 | Ga0068862_100063531 | Ga0068862_1000635312 | 190 |
| 294 | 3300005937 | Ga0081455_10038392 | Ga0081455_100383923 | 190 |
| 295 | 3300005981 | Ga0081538_10065408 | Ga0081538_100654081 | 190 |
| 296 | 3300006163 | Ga0070715_10000966 | Ga0070715_100009663 | 190 |
| 297 | 3300006173 | Ga0070716_100026066 | Ga0070716_1000260663 | 190 |
| 298 | 3300006175 | Ga0070712_100000899 | Ga0070712_1000008993 | 190 |
| 299 | 3300006175 | Ga0070712_100003164 | Ga0070712_1000031642 | 190 |
| 300 | 3300006178 | Ga0075367_10439320 | Ga0075367_104393202 | 190 |
| 301 | 3300006186 | Ga0075369_10002129 | Ga0075369_100021296 | 190 |
| 302 | 3300006186 | Ga0075369_10002208 | Ga0075369_100022082 | 190 |
| 303 | 3300006186 | Ga0075369_10032605 | Ga0075369_100326053 | 190 |
| 304 | 3300006237 | Ga0097621_100116191 | Ga0097621_1001161913 | 190 |
| 305 | 3300006353 | Ga0075370_10159152 | Ga0075370_101591522 | 190 |
| 306 | 3300006358 | Ga0068871_100220462 | Ga0068871_1002204623 | 190 |
| 307 | 3300006846 | Ga0075430_100290996 | Ga0075430_1002909961 | 190 |
| 308 | 3300006881 | Ga0068865_100001854 | Ga0068865_1000018544 | 190 |
| 309 | 3300006881 | Ga0068865_100121125 | Ga0068865_1001211252 | 190 |
| 310 | 3300006931 | Ga0097620_100239721 | Ga0097620_1002397213 | 190 |
| 311 | 3300017792 | Ga0163161_10005267 | Ga0163161_100052673 | 190 |
| 312 | 3300017792 | Ga0163161_10028599 | Ga0163161_100285995 | 190 |
| 313 | 3300025885 | Ga0207653_10021879 | Ga0207653_100218792 | 190 |
| 314 | 3300025893 | Ga0207682_10191357 | Ga0207682_101913571 | 190 |
| 315 | 3300025898 | Ga0207692_10003160 | Ga0207692_100031603 | 190 |
| 316 | 3300025898 | Ga0207692_10534546 | Ga0207692_105345461 | 190 |
| 317 | 3300025899 | Ga0207642_10000244 | Ga0207642_1000024413 | 190 |
| 318 | 3300025899 | Ga0207642_10011989 | Ga0207642_100119893 | 190 |
| 319 | 3300025900 | Ga0207710_10021270 | Ga0207710_100212703 | 190 |
| 320 | 3300025901 | Ga0207688_10002485 | Ga0207688_100024853 | 190 |
| 321 | 3300025901 | Ga0207688_10021188 | Ga0207688_100211885 | 190 |
| 322 | 3300025903 | Ga0207680_10046828 | Ga0207680_100468282 | 190 |
| 323 | 3300025904 | Ga0207647_10126835 | Ga0207647_101268352 | 190 |
| 324 | 3300025906 | Ga0207699_10078807 | Ga0207699_100788072 | 190 |
| 325 | 3300025906 | Ga0207699_10472288 | Ga0207699_104722882 | 190 |
| 326 | 3300025907 | Ga0207645_10077039 | Ga0207645_100770391 | 190 |
| 327 | 3300025908 | Ga0207643_10071949 | Ga0207643_100719493 | 190 |
| 328 | 3300025911 | Ga0207654_10159369 | Ga0207654_101593692 | 190 |
| 329 | 3300025914 | Ga0207671_10080547 | Ga0207671_100805474 | 190 |
| 330 | 3300025915 | Ga0207693_10000638 | Ga0207693_100006383 | 190 |
| 331 | 3300025915 | Ga0207693_10002063 | Ga0207693_100020638 | 190 |
| 332 | 3300025916 | Ga0207663_10000215 | Ga0207663_1000021517 | 190 |
| 333 | 3300025916 | Ga0207663_10315899 | Ga0207663_103158992 | 190 |
| 334 | 3300025916 | Ga0207663_10447130 | Ga0207663_104471302 | 190 |
| 335 | 3300025918 | Ga0207662_10067860 | Ga0207662_100678602 | 190 |
| 336 | 3300025919 | Ga0207657_10172223 | Ga0207657_101722231 | 190 |
| 337 | 3300025919 | Ga0207657_10181405 | Ga0207657_101814052 | 190 |
| 338 | 3300025920 | Ga0207649_10382443 | Ga0207649_103824431 | 190 |
| 339 | 3300025923 | Ga0207681_10008948 | Ga0207681_100089486 | 190 |
| 340 | 3300025923 | Ga0207681_10130714 | Ga0207681_101307142 | 190 |
| 341 | 3300025924 | Ga0207694_10895228 | Ga0207694_108952282 | 190 |
| 342 | 3300025927 | Ga0207687_10007421 | Ga0207687_100074214 | 190 |
| 343 | 3300025927 | Ga0207687_10068338 | Ga0207687_100683383 | 190 |
| 344 | 3300025931 | Ga0207644_10059227 | Ga0207644_100592273 | 190 |
| 345 | 3300025933 | Ga0207706_10411861 | Ga0207706_104118612 | 190 |
| 346 | 3300025934 | Ga0207686_10242385 | Ga0207686_102423852 | 190 |
| 347 | 3300025934 | Ga0207686_10293309 | Ga0207686_102933092 | 190 |
| 348 | 3300025935 | Ga0207709_10018535 | Ga0207709_100185354 | 190 |
| 349 | 3300025935 | Ga0207709_10137084 | Ga0207709_101370842 | 190 |
| 350 | 3300025936 | Ga0207670_10112489 | Ga0207670_101124892 | 190 |
| 351 | 3300025937 | Ga0207669_10000271 | Ga0207669_1000027114 | 190 |
| 352 | 3300025937 | Ga0207669_10418658 | Ga0207669_104186582 | 190 |
| 353 | 3300025938 | Ga0207704_10001344 | Ga0207704_100013448 | 190 |
| 354 | 3300025939 | Ga0207665_10009948 | Ga0207665_100099485 | 190 |
| 355 | 3300025939 | Ga0207665_10012819 | Ga0207665_100128193 | 190 |
| 356 | 3300025942 | Ga0207689_10129864 | Ga0207689_101298643 | 190 |
| 357 | 3300025960 | Ga0207651_10060881 | Ga0207651_100608812 | 190 |
| 358 | 3300025961 | Ga0207712_10006159 | Ga0207712_100061594 | 190 |
| 359 | 3300025961 | Ga0207712_10547581 | Ga0207712_105475812 | 190 |
| 360 | 3300025972 | Ga0207668_10004088 | Ga0207668_100040884 | 190 |
| 361 | 3300025981 | Ga0207640_10004670 | Ga0207640_100046704 | 190 |
| 362 | 3300025981 | Ga0207640_10230852 | Ga0207640_102308522 | 190 |
| 363 | 3300025986 | Ga0207658_10002751 | Ga0207658_100027517 | 190 |
| 364 | 3300025986 | Ga0207658_10466231 | Ga0207658_104662312 | 190 |
| 365 | 3300026023 | Ga0207677_10016402 | Ga0207677_100164024 | 190 |
| 366 | 3300026035 | Ga0207703_10002729 | Ga0207703_100027296 | 190 |
| 367 | 3300026041 | Ga0207639_10008405 | Ga0207639_100084052 | 190 |
| 368 | 3300026041 | Ga0207639_10596419 | Ga0207639_105964192 | 190 |
| 369 | 3300026067 | Ga0207678_10008697 | Ga0207678_100086971 | 190 |
| 370 | 3300026067 | Ga0207678_10016320 | Ga0207678_100163205 | 190 |
| 371 | 3300026075 | Ga0207708_10008676 | Ga0207708_100086766 | 190 |
| 372 | 3300026075 | Ga0207708_10015025 | Ga0207708_100150254 | 190 |
| 373 | 3300026078 | Ga0207702_10442852 | Ga0207702_104428522 | 190 |
| 374 | 3300026088 | Ga0207641_10440243 | Ga0207641_104402432 | 190 |
| 375 | 3300026089 | Ga0207648_10001982 | Ga0207648_100019823 | 190 |
| 376 | 3300026118 | Ga0207675_100003213 | Ga0207675_10000321314 | 190 |
| 377 | 3300026118 | Ga0207675_100138610 | Ga0207675_1001386102 | 190 |
| 378 | 3300026118 | Ga0207675_100696180 | Ga0207675_1006961801 | 190 |
| 379 | 3300026118 | Ga0207675_100957824 | Ga0207675_1009578242 | 190 |
| 380 | 3300026121 | Ga0207683_10000874 | Ga0207683_100008743 | 190 |
| 381 | 3300026121 | Ga0207683_10094198 | Ga0207683_100941982 | 190 |
| 382 | 3300026142 | Ga0207698_10093802 | Ga0207698_100938022 | 190 |
| 383 | 3300026142 | Ga0207698_10266581 | Ga0207698_102665812 | 190 |
| 384 | 3300028379 | Ga0268266_10075534 | Ga0268266_100755342 | 190 |
| 385 | 3300028379 | Ga0268266_10383239 | Ga0268266_103832392 | 190 |
| 386 | 3300028380 | Ga0268265_10048422 | Ga0268265_100484223 | 190 |
| 387 | 3300028380 | Ga0268265_10050506 | Ga0268265_100505064 | 190 |
| 388 | 3300028381 | Ga0268264_10002334 | Ga0268264_1000233414 | 190 |
| 389 | 3300028381 | Ga0268264_10482353 | Ga0268264_104823532 | 190 |
| 390 | 3300028381 | Ga0268264_10582534 | Ga0268264_105825341 | 190 |
| 391 | 3300037853 | Ga0436364_0699371 | Ga0436364_0699371_1829_2431 | 190 |
| 392 | 3300037853 | Ga0436364_0946484 | Ga0436364_0946484_989_1615 | 190 |
| 393 | 3300039437 | Ga0436365_0681434 | Ga0436365_0681434_854_1456 | 190 |
| 394 | 3300039437 | Ga0436365_1122234 | Ga0436365_1122234_3248_3874 | 190 |
| 395 | 3300039450 | Ga0436363_1676298 | Ga0436363_1676298_30_632 | 190 |
| 396 | 3300044684 | Ga0466966_0003701 | Ga0466966_0003701_5024_5626 | 190 |
| 397 | 3300044684 | Ga0466966_0024064 | Ga0466966_0024064_734_1336 | 190 |
| 398 | 3300044684 | Ga0466966_0084336 | Ga0466966_0084336_1071_1682 | 190 |
| 399 | 3300044693 | Ga0466961_0121425 | Ga0466961_0121425_792_1394 | 190 |
| 400 | 3300044719 | Ga0466971_0099747 | Ga0466971_0099747_172_774 | 190 |
| 401 | 3300044735 | Ga0466968_0063649 | Ga0466968_0063649_484_1095 | 190 |
| 402 | 3300044765 | Ga0466970_0011211 | Ga0466970_0011211_2037_2648 | 190 |
| 403 | 3300044842 | Ga0466957_0023416 | Ga0466957_0023416_1325_1927 | 190 |
| 404 | 3300044842 | Ga0466957_0067930 | Ga0466957_0067930_381_992 | 190 |
| 405 | 3300045049 | Ga0466959_0014120 | Ga0466959_0014120_2260_2871 | 190 |
| 406 | 3300045836 | Ga0466958_0105300 | Ga0466958_0105300_361_963 | 190 |
| 407 | 3300045976 | Ga0466967_0015451 | Ga0466967_0015451_4606_5208 | 190 |
| 408 | 3300045976 | Ga0466967_0052634 | Ga0466967_0052634_2575_3177 | 190 |
| 409 | 3300046460 | Ga0495638_0013470 | Ga0495638_0013470_198_800 | 190 |
| 410 | 3300048091 | Ga0495626_0075845 | Ga0495626_0075845_173_775 | 190 |
| 411 | 3300048903 | Ga0496100_0023709 | Ga0496100_0023709_1310_1912 | 190 |
| 412 | 3300048904 | Ga0496101_0924982 | Ga0496101_0924982_59_670 | 190 |
| 413 | 3300048905 | Ga0496102_0045839 | Ga0496102_0045839_1402_2004 | 190 |
| 414 | 3300048906 | Ga0496103_0686781 | Ga0496103_0686781_18_620 | 190 |
| 415 | 3300048907 | Ga0496104_0106502 | Ga0496104_0106502_440_1042 | 190 |
| 416 | 3300048908 | Ga0496105_0096567 | Ga0496105_0096567_1411_2013 | 190 |
| 417 | 3300048909 | Ga0496106_0054709 | Ga0496106_0054709_589_1191 | 190 |
| 418 | 3300048915 | Ga0496112_0201250 | Ga0496112_0201250_799_1401 | 190 |
| 419 | 3300048917 | Ga0496114_0193338 | Ga0496114_0193338_69_671 | 190 |
| 420 | 3300048929 | Ga0496126_0412264 | Ga0496126_0412264_68_670 | 190 |
| 421 | 3300049823 | Ga0501044_0610743 | Ga0501044_0610743_357_971 | 190 |
| 422 | 3300050516 | nmdc:mga0sz30_2817_c1 | nmdc:mga0sz30_2817_c1_2893_3501 | 190 |
| 423 | 3300053108 | Ga0500562_001236 | Ga0500562_001236_5664_6266 | 190 |
| 424 | 3300053142 | Ga0500577_0107447 | Ga0500577_0107447_536_1138 | 190 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iz2-assembly1.cif.gz_A | crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 | 0.769 | 7 | 164 |
| 2nsg-assembly1.cif.gz_A | crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant | 0.7534 | 10 | 151 |
| 5cof-assembly1.cif.gz_A | crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 | 0.7532 | 12 | 161 |
| 2nsf-assembly1.cif.gz_A | crystal structure of the mycothiol-dependent maleylpyruvate isomerase | 0.7527 | 10 | 151 |
| 2yqy-assembly1.cif.gz_A | crystal structure of tt2238, a four-helix bundle protein | 0.7443 | 11 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5civA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7538 | 8 | 163 | 1.20.120.450 |
| 2nsgA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7534 | 10 | 151 | 1.20.120.450 |
| 2ou6A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7397 | 1 | 160 | 1.20.120.450 |
| 5cofA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7278 | 12 | 161 | 1.20.120.450 |
| 5cogA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7236 | 8 | 153 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1A3NKP4-F1-model_v4 | DinB family protein | 0.9188 | 8 | 185 |
|
| AF-A0A2S9FH80-F1-model_v4 | DinB family protein | 0.8836 | 1 | 143 |
|
| AF-A0A6I6GFS1-F1-model_v4 | DinB-like domain-containing protein | 0.879 | 1 | 174 |
|
| AF-A0A5C4LYS5-F1-model_v4 | DinB family protein | 0.8656 | 1 | 187 |
|
| AF-A0A7Y9JR28-F1-model_v4 | Putative glyoxalase superfamily protein PhnB | 0.8641 | 1 | 187 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar