F440718

General Info

Members Datasets Scaffolds Average Seq Length
424 250 418 196

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1110744|Ga0081540_11107442
Length 210
Sequence MPGMPPPAADERQSLLEFLRFNQNAFFAVAYGLSDEQARSTPSVSTLSIGGLIKHAAGVQKGWAQRAAFAPDFPPRDERPMEEIVAEYADQYLMRDDETLEHLLDELRKQNEETLRVFAEADLYTRVPVPHDVPWFPQDIDHWSVRWVALHLIEELTRHAGHADIVRELVDGTAGLRAGTSNLPGGDQAWWESYRARLQRVAELSTDRGT

Samples

Sample ID Description Type Environment
1 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
2 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
6 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
7 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
10 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
173 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
174 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
181 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0
Isolates 1.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.31
Nodule 0.24
Rhizoplane 9.91
Rhizosphere 75
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1011250 3300001977 Bacteria 1317
2 JGI24737J22298_10050680 3300001990 Bacteria 1261
3 JGI24743J22301_10000444 3300001991 Bacteria 4730
4 JGI24745J21846_1000671 3300002073 Bacteria 3087
5 JGI24749J21850_1015499 3300002076 Bacteria 1069
6 JGI24744J21845_10000472 3300002077 Bacteria 7140
7 JGI24744J21845_10002773 3300002077 Bacteria 3579
8 Ga0070676_10012022 3300005328 Bacteria 4718
9 Ga0070683_100440986 3300005329 Bacteria 1242
10 Ga0070690_100072521 3300005330 Bacteria 2239
11 Ga0070677_10103181 3300005333 Bacteria 1261
12 Ga0068869_100186290 3300005334 Bacteria 1629
13 Ga0070666_10074530 3300005335 Bacteria 2313
14 Ga0070666_10373530 3300005335 Bacteria 1023
15 Ga0068868_100001453 3300005338 Bacteria 16341
16 Ga0068868_100016326 3300005338 Bacteria 5512
17 Ga0068868_100218963 3300005338 Bacteria 1593
18 Ga0068868_100680550 3300005338 Bacteria 918
19 Ga0070660_100218419 3300005339 Bacteria 1549
20 Ga0070691_10008585 3300005341 Bacteria 4678
21 Ga0070691_10228877 3300005341 Bacteria 988
22 Ga0070691_10239641 3300005341 Bacteria 968
23 Ga0070687_100053168 3300005343 Bacteria 2105
24 Ga0070687_100251677 3300005343 Bacteria 1098
25 Ga0070668_100006407 3300005347 Bacteria 8722
26 Ga0070669_100627304 3300005353 Bacteria 902
27 Ga0070675_100789085 3300005354 Bacteria 868
28 Ga0070671_100104015 3300005355 Bacteria 2383
29 Ga0070671_100744681 3300005355 Bacteria 851
30 Ga0070674_100007936 3300005356 Bacteria 6284
31 Ga0070674_100654901 3300005356 Bacteria 893
32 Ga0070673_100104101 3300005364 Bacteria 2343
33 Ga0070688_100238480 3300005365 Bacteria 1289
34 Ga0070659_100080318 3300005366 Bacteria 2604
35 Ga0070659_100173257 3300005366 Bacteria 1768
36 Ga0070667_100003133 3300005367 Bacteria 14200
37 Ga0070667_100494275 3300005367 Bacteria 1121
38 Ga0070703_10022147 3300005406 Bacteria 1863
39 Ga0070709_10020567 3300005434 Bacteria 3830
40 Ga0070709_10024767 3300005434 Bacteria 3537
41 Ga0070714_100463717 3300005435 Bacteria 1205
42 Ga0070714_101090857 3300005435 Bacteria 778
43 Ga0070713_100041868 3300005436 Bacteria 3734
44 Ga0070713_100139409 3300005436 Bacteria 2147
45 Ga0070710_10001014 3300005437 Bacteria 13321
46 Ga0070701_10036479 3300005438 Bacteria 2477
47 Ga0070711_100000280 3300005439 Bacteria 26351
48 Ga0070711_100096702 3300005439 Bacteria 2140
49 Ga0070705_100179158 3300005440 Bacteria 1434
50 Ga0070700_100004174 3300005441 Bacteria 7533
51 Ga0070700_100049175 3300005441 Bacteria 2616
52 Ga0070694_100006083 3300005444 Bacteria 7322
53 Ga0070708_100782472 3300005445 Bacteria 897
54 Ga0070663_100002851 3300005455 Bacteria 9828
55 Ga0070663_100022570 3300005455 Bacteria 4209
56 Ga0070678_100000626 3300005456 Bacteria 17350
57 Ga0070678_100625694 3300005456 Bacteria 963
58 Ga0068867_100000835 3300005459 Bacteria 20725
59 Ga0068867_101354430 3300005459 Bacteria 658
60 Ga0070685_10029477 3300005466 Bacteria 3049
61 Ga0070685_10359211 3300005466 Bacteria 998
62 Ga0070707_100420023 3300005468 Bacteria 1298
63 Ga0070684_100144900 3300005535 Bacteria 2149
64 Ga0070697_100821620 3300005536 Bacteria 823
65 Ga0068853_100011755 3300005539 Bacteria 7115
66 Ga0070672_100100581 3300005543 Bacteria 2345
67 Ga0070686_100040113 3300005544 Bacteria 2920
68 Ga0070695_100080609 3300005545 Bacteria 2152
69 Ga0070696_100041424 3300005546 Bacteria 3182
70 Ga0070696_100112038 3300005546 Bacteria 1966
71 Ga0070693_100001856 3300005547 Bacteria 9655
72 Ga0070693_100123822 3300005547 Bacteria 1607
73 Ga0070693_100844752 3300005547 Bacteria 682
74 Ga0070665_100028263 3300005548 Bacteria 5648
75 Ga0070665_100149567 3300005548 Bacteria 2338
76 Ga0070665_101228472 3300005548 Bacteria 760
77 Ga0070704_100012290 3300005549 Bacteria 5286
78 Ga0070704_100135587 3300005549 Bacteria 1914
79 Ga0070704_100988686 3300005549 Bacteria 760
80 Ga0068855_100041253 3300005563 Bacteria 5471
81 Ga0068854_100000551 3300005578 Bacteria 22591
82 Ga0068854_100160510 3300005578 Bacteria 1740
83 Ga0068856_100222756 3300005614 Bacteria 1902
84 Ga0070702_100000921 3300005615 Bacteria 11514
85 Ga0068852_100045499 3300005616 Bacteria 3733
86 Ga0068852_100122541 3300005616 Bacteria 2383
87 Ga0068859_100096139 3300005617 Bacteria 3015
88 Ga0068859_100239718 3300005617 Bacteria 1902
89 Ga0068866_10007520 3300005718 Bacteria 4564
90 Ga0068861_100012218 3300005719 Bacteria 5987
91 Ga0068861_100030369 3300005719 Bacteria 3959
92 Ga0068870_10142640 3300005840 Bacteria 1403
93 Ga0068863_100639133 3300005841 Bacteria 1055
94 Ga0068858_100021054 3300005842 Bacteria 6091
95 Ga0068858_100284552 3300005842 Bacteria 1575
96 Ga0068860_100001259 3300005843 Bacteria 27632
97 Ga0068860_100047670 3300005843 Bacteria 4083
98 Ga0068860_100170286 3300005843 Bacteria 2103
99 Ga0068862_100063531 3300005844 Bacteria 3177
100 Ga0081455_10038392 3300005937 Bacteria 4241
101 Ga0081538_10065408 3300005981 Bacteria 2047
102 Ga0081540_1110744 3300005983 Bacteria 1161
103 Ga0070717_10991503 3300006028 Bacteria 765
104 Ga0075365_10054183 3300006038 Bacteria 2659
105 Ga0075363_100189806 3300006048 Bacteria 1172
106 Ga0075364_10020084 3300006051 Bacteria 4200
107 Ga0075364_10622824 3300006051 Bacteria 737
108 Ga0070715_10000966 3300006163 Bacteria 8012
109 Ga0070716_100026066 3300006173 Bacteria 3126
110 Ga0070712_100000899 3300006175 Bacteria 17814
111 Ga0070712_100003164 3300006175 Bacteria 10143
112 Ga0075367_10299417 3300006178 Bacteria 1012
113 Ga0075367_10439320 3300006178 Bacteria 827
114 Ga0075369_10002129 3300006186 Bacteria 6998
115 Ga0075369_10002208 3300006186 Bacteria 6892
116 Ga0075369_10006876 3300006186 Bacteria 4319
117 Ga0075369_10032605 3300006186 Bacteria 2204
118 Ga0097621_100116191 3300006237 Bacteria 2265
119 Ga0075370_10055685 3300006353 Bacteria 2247
120 Ga0075370_10159152 3300006353 Bacteria 1325
121 Ga0068871_100220462 3300006358 Bacteria 1643
122 Ga0075430_100021855 3300006846 Bacteria 5437
123 Ga0075430_100290996 3300006846 Bacteria 1351
124 Ga0068865_100001854 3300006881 Bacteria 12409
125 Ga0068865_100121125 3300006881 Bacteria 1945
126 Ga0097620_100096128 3300006931 Bacteria 3015
127 Ga0097620_100239721 3300006931 Bacteria 1902
128 Ga0105250_10090533 3300009092 Bacteria 1244
129 Ga0105245_10017664 3300009098 Bacteria 6227
130 Ga0105245_10047102 3300009098 Bacteria 3853
131 Ga0105245_10341867 3300009098 Bacteria 1480
132 Ga0105247_10001612 3300009101 Bacteria 15971
133 Ga0105247_10622907 3300009101 Bacteria 803
134 Ga0105243_10013360 3300009148 Bacteria 6211
135 Ga0105243_10183824 3300009148 Bacteria 1820
136 Ga0105241_10160408 3300009174 Bacteria 1848
137 Ga0105242_10002300 3300009176 Bacteria 15088
138 Ga0105242_10105959 3300009176 Bacteria 2388
139 Ga0105248_10004806 3300009177 Bacteria 14951
140 Ga0105237_10025156 3300009545 Bacteria 6090
141 Ga0105237_10143692 3300009545 Bacteria 2380
142 Ga0105237_11005720 3300009545 Bacteria 840
143 Ga0105238_10446767 3300009551 Bacteria 1290
144 Ga0105238_11191741 3300009551 Bacteria 786
145 Ga0105249_10001128 3300009553 Bacteria 23740
146 Ga0105249_10127895 3300009553 Bacteria 2421
147 Ga0105249_10732259 3300009553 Bacteria 1050
148 Ga0105239_10012717 3300010375 Bacteria 9365
149 Ga0105246_10131243 3300011119 Bacteria 1872
150 Ga0105246_10279991 3300011119 Bacteria 1337
151 Ga0157371_10205117 3300013102 Bacteria 1414
152 Ga0157369_10229067 3300013105 Bacteria 1943
153 Ga0157374_10038816 3300013296 Bacteria 4379
154 Ga0157378_10001538 3300013297 Bacteria 20847
155 Ga0157378_10893198 3300013297 Bacteria 919
156 Ga0163162_10023272 3300013306 Bacteria 6113
157 Ga0163162_10993923 3300013306 Bacteria 948
158 Ga0157372_10016361 3300013307 Bacteria 7957
159 Ga0157375_10001296 3300013308 Bacteria 21510
160 Ga0157375_10108676 3300013308 Bacteria 2869
161 Ga0157380_10012747 3300014326 Bacteria 6105
162 Ga0157377_10004472 3300014745 Bacteria 6445
163 Ga0157377_10144191 3300014745 Bacteria 1466
164 Ga0157379_10075650 3300014968 Bacteria 3015
165 Ga0163161_10005267 3300017792 Bacteria 9003
166 Ga0163161_10028599 3300017792 Bacteria 3959
167 Ga0213876_10009975 3300021384 Bacteria 5104
168 Ga0213876_10013880 3300021384 Bacteria 4269
169 Ga0213875_10018290 3300021388 Bacteria 3379
170 Ga0207653_10021879 3300025885 Bacteria 2029
171 Ga0207682_10191357 3300025893 Bacteria 938
172 Ga0207692_10003160 3300025898 Bacteria 6392
173 Ga0207692_10534546 3300025898 Bacteria 747
174 Ga0207642_10000244 3300025899 Bacteria 16163
175 Ga0207642_10011989 3300025899 Bacteria 3114
176 Ga0207710_10021270 3300025900 Bacteria 2779
177 Ga0207688_10002485 3300025901 Bacteria 9922
178 Ga0207688_10021188 3300025901 Bacteria 3551
179 Ga0207680_10046828 3300025903 Bacteria 2558
180 Ga0207647_10126835 3300025904 Bacteria 1502
181 Ga0207699_10078807 3300025906 Bacteria 2036
182 Ga0207699_10472288 3300025906 Bacteria 902
183 Ga0207645_10077039 3300025907 Bacteria 2136
184 Ga0207643_10071949 3300025908 Bacteria 1991
185 Ga0207654_10159369 3300025911 Bacteria 1456
186 Ga0207671_10024709 3300025914 Bacteria 4513
187 Ga0207671_10080547 3300025914 Bacteria 2441
188 Ga0207693_10000638 3300025915 Bacteria 31340
189 Ga0207693_10002063 3300025915 Bacteria 17557
190 Ga0207663_10000215 3300025916 Bacteria 25655
191 Ga0207663_10315899 3300025916 Bacteria 1172
192 Ga0207663_10447130 3300025916 Bacteria 996
193 Ga0207662_10067860 3300025918 Bacteria 2152
194 Ga0207657_10172223 3300025919 Bacteria 1753
195 Ga0207657_10181405 3300025919 Bacteria 1702
196 Ga0207649_10382443 3300025920 Bacteria 1049
197 Ga0207681_10008948 3300025923 Bacteria 6114
198 Ga0207681_10130714 3300025923 Bacteria 1856
199 Ga0207694_10895228 3300025924 Bacteria 750
200 Ga0207687_10007421 3300025927 Bacteria 7220
201 Ga0207687_10068338 3300025927 Bacteria 2531
202 Ga0207644_10059227 3300025931 Bacteria 2770
203 Ga0207706_10411861 3300025933 Bacteria 1171
204 Ga0207686_10242385 3300025934 Bacteria 1313
205 Ga0207686_10293309 3300025934 Bacteria 1205
206 Ga0207709_10018535 3300025935 Bacteria 3899
207 Ga0207709_10137084 3300025935 Bacteria 1677
208 Ga0207670_10112489 3300025936 Bacteria 1965
209 Ga0207669_10000271 3300025937 Bacteria 23694
210 Ga0207669_10418658 3300025937 Bacteria 1054
211 Ga0207704_10001344 3300025938 Bacteria 10972
212 Ga0207665_10009948 3300025939 Bacteria 6241
213 Ga0207665_10012819 3300025939 Bacteria 5512
214 Ga0207689_10129864 3300025942 Bacteria 2074
215 Ga0207661_10301028 3300025944 Bacteria 1438
216 Ga0207667_10328234 3300025949 Bacteria 1562
217 Ga0207651_10060881 3300025960 Bacteria 2623
218 Ga0207712_10006159 3300025961 Bacteria 7563
219 Ga0207712_10547581 3300025961 Bacteria 995
220 Ga0207668_10004088 3300025972 Bacteria 8571
221 Ga0207640_10004670 3300025981 Bacteria 7435
222 Ga0207640_10230852 3300025981 Bacteria 1423
223 Ga0207658_10002751 3300025986 Bacteria 12686
224 Ga0207658_10466231 3300025986 Bacteria 1120
225 Ga0207677_10016402 3300026023 Bacteria 4387
226 Ga0207677_10030643 3300026023 Bacteria 3436
227 Ga0207677_10366817 3300026023 Bacteria 1211
228 Ga0207703_10002729 3300026035 Bacteria 15127
229 Ga0207703_10071873 3300026035 Bacteria 2858
230 Ga0207639_10008405 3300026041 Bacteria 7073
231 Ga0207639_10596419 3300026041 Bacteria 1018
232 Ga0207678_10008697 3300026067 Bacteria 8939
233 Ga0207678_10016320 3300026067 Bacteria 6519
234 Ga0207678_10078934 3300026067 Bacteria 2819
235 Ga0207708_10008676 3300026075 Bacteria 7524
236 Ga0207708_10015025 3300026075 Bacteria 5802
237 Ga0207702_10442852 3300026078 Bacteria 1259
238 Ga0207641_10440243 3300026088 Bacteria 1258
239 Ga0207648_10001982 3300026089 Bacteria 22367
240 Ga0207676_10348522 3300026095 Bacteria 1369
241 Ga0207675_100003213 3300026118 Bacteria 16025
242 Ga0207675_100138610 3300026118 Bacteria 2310
243 Ga0207675_100179340 3300026118 Bacteria 2028
244 Ga0207675_100696180 3300026118 Bacteria 1025
245 Ga0207675_100957824 3300026118 Bacteria 873
246 Ga0207683_10000874 3300026121 Bacteria 27618
247 Ga0207683_10094198 3300026121 Bacteria 2669
248 Ga0207698_10093802 3300026142 Bacteria 2466
249 Ga0207698_10266581 3300026142 Bacteria 1576
250 Ga0268266_10075534 3300028379 Bacteria 2927
251 Ga0268266_10383239 3300028379 Bacteria 1326
252 Ga0268266_10894315 3300028379 Bacteria 859
253 Ga0268265_10048422 3300028380 Bacteria 3190
254 Ga0268265_10050506 3300028380 Bacteria 3134
255 Ga0268264_10002334 3300028381 Bacteria 16769
256 Ga0268264_10482353 3300028381 Bacteria 1206
257 Ga0268264_10582534 3300028381 Bacteria 1101
258 Ga0307409_101720900 3300031995 Bacteria 656
259 Ga0307416_100948497 3300032002 Bacteria 962
260 Ga0373931_0112176 3300035691 Bacteria 1548
261 Ga0436364_0699371 3300037853 Bacteria 4336
262 Ga0436364_0946484 3300037853 Bacteria 1723
263 Ga0436364_1124629 3300037853 Bacteria 7056
264 Ga0436365_0437998 3300039437 Bacteria 29340
265 Ga0436365_0440716 3300039437 Bacteria 15038
266 Ga0436365_0681434 3300039437 Bacteria 1597
267 Ga0436365_1122234 3300039437 Bacteria 14155
268 Ga0436363_0172568 3300039450 Bacteria 676
269 Ga0436363_1676298 3300039450 Bacteria 1017
270 Ga0439461_0005667 3300041410 Bacteria 2141
271 Ga0439466_0014371 3300041411 Bacteria 2884
272 Ga0439466_0080398 3300041411 Bacteria 1028
273 Ga0439465_0005561 3300041413 Bacteria 4017
274 Ga0439465_0107896 3300041413 Bacteria 966
275 Ga0439431_0038034 3300041997 Bacteria 1216
276 Ga0439445_0005335 3300042004 Bacteria 2927
277 Ga0439445_0010081 3300042004 Bacteria 2231
278 Ga0439434_0084787 3300042435 Bacteria 1008
279 Ga0439459_0016602 3300042438 Bacteria 1362
280 Ga0466969_0181239 3300044656 Bacteria 964
281 Ga0466965_0092658 3300044683 Bacteria 1538
282 Ga0466966_0003701 3300044684 Bacteria 10082
283 Ga0466966_0024064 3300044684 Bacteria 3986
284 Ga0466966_0084336 3300044684 Bacteria 1976
285 Ga0466966_0599465 3300044684 Bacteria 663
286 Ga0466961_0121425 3300044693 Bacteria 1640
287 Ga0466963_0031021 3300044694 Bacteria 3453
288 Ga0466963_0104129 3300044694 Bacteria 1944
289 Ga0466963_0936216 3300044694 Bacteria 610
290 Ga0466964_0395572 3300044706 Bacteria 721
291 Ga0466971_0030636 3300044719 Bacteria 2408
292 Ga0466971_0099747 3300044719 Bacteria 1334
293 Ga0466968_0006930 3300044735 Bacteria 4291
294 Ga0466968_0063649 3300044735 Bacteria 1594
295 Ga0466968_0323826 3300044735 Bacteria 745
296 Ga0466970_0011211 3300044765 Bacteria 4567
297 Ga0466970_0019606 3300044765 Bacteria 3507
298 Ga0466970_0025776 3300044765 Bacteria 3080
299 Ga0466957_0023416 3300044842 Bacteria 3651
300 Ga0466957_0067930 3300044842 Bacteria 2200
301 Ga0466957_0075437 3300044842 Bacteria 2092
302 Ga0466957_0079857 3300044842 Bacteria 2036
303 Ga0466960_0000524 3300044901 Bacteria 13143
304 Ga0466960_0004253 3300044901 Bacteria 5577
305 Ga0466960_0021153 3300044901 Bacteria 2892
306 Ga0466959_0014120 3300045049 Bacteria 5796
307 Ga0466958_0050102 3300045836 Bacteria 2528
308 Ga0466958_0105300 3300045836 Bacteria 1757
309 Ga0466958_0346260 3300045836 Bacteria 956
310 Ga0466967_0015451 3300045976 Bacteria 5984
311 Ga0466967_0033996 3300045976 Bacteria 4321
312 Ga0466967_0052634 3300045976 Bacteria 3575
313 Ga0466967_0154139 3300045976 Bacteria 2150
314 Ga0466967_0660700 3300045976 Bacteria 1034
315 Ga0495638_0013470 3300046460 Bacteria 5566
316 Ga0495638_0072658 3300046460 Bacteria 2101
317 Ga0495672_0142282 3300047320 Bacteria 1252
318 Ga0495626_0075845 3300048091 Bacteria 1502
319 Ga0496100_0015136 3300048903 Bacteria 4500
320 Ga0496100_0023709 3300048903 Bacteria 3733
321 Ga0496100_0067024 3300048903 Bacteria 2383
322 Ga0496101_0000172 3300048904 Bacteria 53462
323 Ga0496101_0001046 3300048904 Bacteria 16358
324 Ga0496101_0060047 3300048904 Bacteria 2758
325 Ga0496101_0805095 3300048904 Bacteria 741
326 Ga0496101_0924982 3300048904 Bacteria 686
327 Ga0496102_0000003 3300048905 Bacteria 592263
328 Ga0496102_0020134 3300048905 Bacteria 5891
329 Ga0496102_0034019 3300048905 Bacteria 4583
330 Ga0496102_0045839 3300048905 Bacteria 3970
331 Ga0496102_0175535 3300048905 Bacteria 2017
332 Ga0496103_0000012 3300048906 Bacteria 301778
333 Ga0496103_0015221 3300048906 Bacteria 4573
334 Ga0496103_0686781 3300048906 Bacteria 649
335 Ga0496104_0106502 3300048907 Bacteria 2687
336 Ga0496104_0225499 3300048907 Bacteria 1786
337 Ga0496105_0096567 3300048908 Bacteria 2441
338 Ga0496106_0002202 3300048909 Bacteria 14552
339 Ga0496106_0034302 3300048909 Bacteria 3790
340 Ga0496106_0054709 3300048909 Bacteria 3015
341 Ga0496107_0011929 3300048910 Bacteria 6068
342 Ga0496107_0044602 3300048910 Bacteria 3188
343 Ga0496108_0000687 3300048911 Bacteria 26194
344 Ga0496108_0064031 3300048911 Bacteria 3097
345 Ga0496108_0531950 3300048911 Bacteria 1026
346 Ga0496109_0002791 3300048912 Bacteria 14627
347 Ga0496109_0187129 3300048912 Bacteria 1945
348 Ga0496110_0054171 3300048913 Bacteria 3528
349 Ga0496111_0266721 3300048914 Bacteria 1270
350 Ga0496112_0061803 3300048915 Bacteria 3693
351 Ga0496112_0194499 3300048915 Bacteria 1989
352 Ga0496112_0201250 3300048915 Bacteria 1951
353 Ga0496112_0312371 3300048915 Bacteria 1517
354 Ga0496112_0741130 3300048915 Bacteria 909
355 Ga0496113_0827103 3300048916 Bacteria 735
356 Ga0496114_0001860 3300048917 Bacteria 15987
357 Ga0496114_0120251 3300048917 Bacteria 2258
358 Ga0496114_0193338 3300048917 Bacteria 1781
359 Ga0496115_0000584 3300048918 Bacteria 27971
360 Ga0496115_0270236 3300048918 Bacteria 1397
361 Ga0496116_0000040 3300048919 Bacteria 346900
362 Ga0496117_0000003 3300048920 Bacteria 1881097
363 Ga0496118_0000001 3300048921 Bacteria 1881100
364 Ga0496118_0000452 3300048921 Bacteria 67982
365 Ga0496119_0000591 3300048922 Bacteria 49100
366 Ga0496119_0023085 3300048922 Bacteria 4427
367 Ga0496120_0000293 3300048923 Bacteria 83834
368 Ga0496120_0055759 3300048923 Bacteria 2233
369 Ga0496121_0000019 3300048924 Bacteria 499976
370 Ga0496123_0135145 3300048926 Bacteria 1358
371 Ga0496125_0068019 3300048928 Bacteria 2804
372 Ga0496126_0008979 3300048929 Bacteria 10697
373 Ga0496126_0016585 3300048929 Bacteria 7362
374 Ga0496126_0087550 3300048929 Bacteria 2744
375 Ga0496126_0412264 3300048929 Bacteria 1094
376 Ga0501031_0561182 3300049568 Bacteria 735
377 Ga0501032_0001855 3300049569 Bacteria 16721
378 Ga0501033_0012173 3300049570 Bacteria 6566
379 Ga0501034_0003235 3300049571 Bacteria 18642
380 Ga0501036_0330281 3300049572 Bacteria 1274
381 Ga0501037_0037184 3300049573 Bacteria 3588
382 Ga0501043_0017523 3300049579 Bacteria 5616
383 Ga0501046_0000969 3300049580 Bacteria 28158
384 Ga0501047_0003181 3300049581 Bacteria 15564
385 Ga0501047_0659771 3300049581 Bacteria 865
386 Ga0501048_0004345 3300049582 Bacteria 10789
387 Ga0501069_0005667 3300049585 Bacteria 6505
388 Ga0501070_0001271 3300049586 Bacteria 22663
389 Ga0501070_0029281 3300049586 Bacteria 4619
390 Ga0501070_0467161 3300049586 Bacteria 1016
391 Ga0501035_0001201 3300049822 Bacteria 26999
392 Ga0501035_0358338 3300049822 Bacteria 1219
393 Ga0501044_0002283 3300049823 Bacteria 21835
394 Ga0501044_0610743 3300049823 Bacteria 983
395 nmdc:mga03n38_146535_c1 3300050490 Bacteria 1184
396 nmdc:mga00v17_117947_c1 3300050491 Bacteria 1688
397 nmdc:mga00v17_2227_c1 3300050491 Bacteria 9954
398 nmdc:mga0yw44_56352_c1 3300050492 Bacteria 2394
399 nmdc:mga06z11_266237_c1 3300050494 Bacteria 1012
400 nmdc:mga07m45_120644_c1 3300050496 Bacteria 1514
401 nmdc:mga07m45_203489_c1 3300050496 Bacteria 1152
402 nmdc:mga0qj67_267578_c1 3300050509 Bacteria 1386
403 nmdc:mga0qj67_27086_c1 3300050509 Bacteria 4440
404 nmdc:mga0qj67_272615_c1 3300050509 Bacteria 1372
405 nmdc:mga0sz30_12554_c1 3300050516 Bacteria 3298
406 nmdc:mga0sz30_22037_c1 3300050516 Bacteria 2582
407 nmdc:mga0sz30_2281_c1 3300050516 Bacteria 6853
408 nmdc:mga0sz30_2817_c1 3300050516 Bacteria 6209
409 Ga0500643_009573 3300053087 Bacteria 3691
410 Ga0500641_0188657 3300053096 Bacteria 883
411 Ga0500562_001236 3300053108 Bacteria 6292
412 Ga0500642_0128415 3300053130 Bacteria 1187
413 Ga0500559_0064178 3300053136 Bacteria 1643
414 Ga0500568_0136457 3300053139 Bacteria 910
415 Ga0500577_0107447 3300053142 Bacteria 1148
416 Ga0500645_000070 3300053730 Bacteria 79917
417 Ga0466962_0077931 3300061719 Bacteria 1584
418 Ga0466962_0078248 3300061719 Bacteria 1581

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0346260 Ga0466958_0346260_13_528 161
2 3300006186 Ga0075369_10006876 Ga0075369_100068764 168
3 3300041411 Ga0439466_0014371 Ga0439466_0014371_805_1413 168
4 3300041413 Ga0439465_0005561 Ga0439465_0005561_1460_2068 168
5 3300042004 Ga0439445_0010081 Ga0439445_0010081_742_1350 168
6 3300050516 nmdc:mga0sz30_12554_c1 nmdc:mga0sz30_12554_c1_1646_2245 168
7 3300049586 Ga0501070_0029281 Ga0501070_0029281_1984_2592 170
8 3300005445 Ga0070708_100782472 Ga0070708_1007824721 173
9 3300047320 Ga0495672_0142282 Ga0495672_0142282_514_1113 173
10 3300031995 Ga0307409_101720900 Ga0307409_1017209001 174
11 3300050491 nmdc:mga00v17_117947_c1 nmdc:mga00v17_117947_c1_109_702 174
12 3300041410 Ga0439461_0005667 Ga0439461_0005667_1574_2131 175
13 3300041411 Ga0439466_0080398 Ga0439466_0080398_111_668 175
14 3300041413 Ga0439465_0107896 Ga0439465_0107896_109_666 175
15 3300042004 Ga0439445_0005335 Ga0439445_0005335_2344_2901 175
16 3300050509 nmdc:mga0qj67_27086_c1 nmdc:mga0qj67_27086_c1_158_715 175
17 3300050496 nmdc:mga07m45_120644_c1 nmdc:mga07m45_120644_c1_905_1483 176
18 3300006051 Ga0075364_10622824 Ga0075364_106228242 177
19 3300050509 nmdc:mga0qj67_267578_c1 nmdc:mga0qj67_267578_c1_674_1270 178
20 3300045976 Ga0466967_0660700 Ga0466967_0660700_438_1010 180
21 3300005338 Ga0068868_100680550 Ga0068868_1006805501 182
22 3300044706 Ga0466964_0395572 Ga0466964_0395572_92_685 182
23 3300045976 Ga0466967_0154139 Ga0466967_0154139_396_989 182
24 3300044694 Ga0466963_0936216 Ga0466963_0936216_12_593 183
25 iso_pu_bacteria 2738541274 2738704708 184
26 iso_pu_bacteria 2738543028 2739329877 184
27 iso_pu_bacteria 2902792274 2902792905 184
28 iso_pu_bacteria 2902837492 2902841836 184
29 3300005468 Ga0070707_100420023 Ga0070707_1004200231 185
30 3300009098 Ga0105245_10341867 Ga0105245_103418672 185
31 3300009551 Ga0105238_11191741 Ga0105238_111917412 185
32 3300011119 Ga0105246_10131243 Ga0105246_101312432 185
33 3300039450 Ga0436363_0172568 Ga0436363_0172568_12_599 185
34 3300048911 Ga0496108_0064031 Ga0496108_0064031_2496_3083 185
35 3300048912 Ga0496109_0187129 Ga0496109_0187129_1087_1674 185
36 3300048914 Ga0496111_0266721 Ga0496111_0266721_98_685 185
37 3300048915 Ga0496112_0312371 Ga0496112_0312371_454_1041 185
38 3300048916 Ga0496113_0827103 Ga0496113_0827103_18_605 185
39 3300005436 Ga0070713_100139409 Ga0070713_1001394092 186
40 3300044683 Ga0466965_0092658 Ga0466965_0092658_580_1170 186
41 3300044684 Ga0466966_0599465 Ga0466966_0599465_17_607 186
42 3300044735 Ga0466968_0006930 Ga0466968_0006930_623_1213 186
43 3300044765 Ga0466970_0019606 Ga0466970_0019606_2614_3204 186
44 3300044765 Ga0466970_0025776 Ga0466970_0025776_1265_1855 186
45 3300044842 Ga0466957_0075437 Ga0466957_0075437_161_751 186
46 3300044901 Ga0466960_0004253 Ga0466960_0004253_4408_4998 186
47 3300048904 Ga0496101_0060047 Ga0496101_0060047_1950_2540 186
48 3300048915 Ga0496112_0194499 Ga0496112_0194499_660_1250 186
49 3300048921 Ga0496118_0000452 Ga0496118_0000452_34593_35183 186
50 3300048923 Ga0496120_0055759 Ga0496120_0055759_1168_1758 186
51 3300048926 Ga0496123_0135145 Ga0496123_0135145_746_1336 186
52 3300048929 Ga0496126_0087550 Ga0496126_0087550_330_920 186
53 iso_pu_bacteria 2842134933 2842136702 186
54 iso_pu_bacteria 2929212328 2929213690 186
55 3300005455 Ga0070663_100022570 Ga0070663_1000225702 187
56 3300005617 Ga0068859_100096139 Ga0068859_1000961391 187
57 3300006028 Ga0070717_10991503 Ga0070717_109915031 187
58 3300006931 Ga0097620_100096128 Ga0097620_1000961281 187
59 3300009092 Ga0105250_10090533 Ga0105250_100905331 187
60 3300009098 Ga0105245_10017664 Ga0105245_100176645 187
61 3300009098 Ga0105245_10047102 Ga0105245_100471021 187
62 3300009101 Ga0105247_10001612 Ga0105247_1000161214 187
63 3300009148 Ga0105243_10013360 Ga0105243_100133605 187
64 3300009148 Ga0105243_10183824 Ga0105243_101838242 187
65 3300009174 Ga0105241_10160408 Ga0105241_101604082 187
66 3300009176 Ga0105242_10002300 Ga0105242_1000230014 187
67 3300009176 Ga0105242_10105959 Ga0105242_101059593 187
68 3300009177 Ga0105248_10004806 Ga0105248_1000480614 187
69 3300009545 Ga0105237_10025156 Ga0105237_100251564 187
70 3300009545 Ga0105237_11005720 Ga0105237_110057202 187
71 3300009551 Ga0105238_10446767 Ga0105238_104467672 187
72 3300009553 Ga0105249_10001128 Ga0105249_1000112818 187
73 3300009553 Ga0105249_10127895 Ga0105249_101278952 187
74 3300009553 Ga0105249_10732259 Ga0105249_107322591 187
75 3300010375 Ga0105239_10012717 Ga0105239_100127174 187
76 3300011119 Ga0105246_10279991 Ga0105246_102799912 187
77 3300013102 Ga0157371_10205117 Ga0157371_102051172 187
78 3300013105 Ga0157369_10229067 Ga0157369_102290672 187
79 3300013296 Ga0157374_10038816 Ga0157374_100388165 187
80 3300013297 Ga0157378_10001538 Ga0157378_1000153818 187
81 3300013297 Ga0157378_10893198 Ga0157378_108931981 187
82 3300013306 Ga0163162_10023272 Ga0163162_100232724 187
83 3300013306 Ga0163162_10993923 Ga0163162_109939231 187
84 3300013307 Ga0157372_10016361 Ga0157372_100163617 187
85 3300013308 Ga0157375_10001296 Ga0157375_1000129619 187
86 3300013308 Ga0157375_10108676 Ga0157375_101086762 187
87 3300014326 Ga0157380_10012747 Ga0157380_100127475 187
88 3300014745 Ga0157377_10004472 Ga0157377_100044724 187
89 3300014745 Ga0157377_10144191 Ga0157377_101441912 187
90 3300014968 Ga0157379_10075650 Ga0157379_100756502 187
91 3300021384 Ga0213876_10009975 Ga0213876_100099755 187
92 3300021384 Ga0213876_10013880 Ga0213876_100138802 187
93 3300021388 Ga0213875_10018290 Ga0213875_100182902 187
94 3300026023 Ga0207677_10030643 Ga0207677_100306434 187
95 3300026035 Ga0207703_10071873 Ga0207703_100718732 187
96 3300026118 Ga0207675_100179340 Ga0207675_1001793403 187
97 3300035691 Ga0373931_0112176 Ga0373931_0112176_811_1404 187
98 3300037853 Ga0436364_1124629 Ga0436364_1124629_872_1465 187
99 3300039437 Ga0436365_0437998 Ga0436365_0437998_13872_14465 187
100 3300039437 Ga0436365_0440716 Ga0436365_0440716_890_1483 187
101 3300044656 Ga0466969_0181239 Ga0466969_0181239_22_615 187
102 3300044694 Ga0466963_0031021 Ga0466963_0031021_389_982 187
103 3300044735 Ga0466968_0323826 Ga0466968_0323826_95_688 187
104 3300044901 Ga0466960_0021153 Ga0466960_0021153_25_636 187
105 3300048903 Ga0496100_0067024 Ga0496100_0067024_430_1023 187
106 3300048904 Ga0496101_0001046 Ga0496101_0001046_14119_14712 187
107 3300048905 Ga0496102_0020134 Ga0496102_0020134_3671_4264 187
108 3300048905 Ga0496102_0034019 Ga0496102_0034019_63_656 187
109 3300048905 Ga0496102_0175535 Ga0496102_0175535_1306_1899 187
110 3300048906 Ga0496103_0015221 Ga0496103_0015221_2344_2937 187
111 3300048907 Ga0496104_0225499 Ga0496104_0225499_497_1090 187
112 3300048909 Ga0496106_0002202 Ga0496106_0002202_13433_14026 187
113 3300048910 Ga0496107_0011929 Ga0496107_0011929_2409_3002 187
114 3300048910 Ga0496107_0044602 Ga0496107_0044602_296_889 187
115 3300048911 Ga0496108_0000687 Ga0496108_0000687_13913_14506 187
116 3300048912 Ga0496109_0002791 Ga0496109_0002791_6139_6732 187
117 3300048913 Ga0496110_0054171 Ga0496110_0054171_2071_2664 187
118 3300048915 Ga0496112_0061803 Ga0496112_0061803_238_831 187
119 3300048915 Ga0496112_0741130 Ga0496112_0741130_170_781 187
120 3300048917 Ga0496114_0001860 Ga0496114_0001860_1645_2238 187
121 3300048917 Ga0496114_0120251 Ga0496114_0120251_452_1045 187
122 3300048918 Ga0496115_0000584 Ga0496115_0000584_18417_19010 187
123 3300048918 Ga0496115_0270236 Ga0496115_0270236_58_651 187
124 3300048929 Ga0496126_0008979 Ga0496126_0008979_3807_4400 187
125 3300049586 Ga0501070_0467161 Ga0501070_0467161_412_1005 187
126 3300049822 Ga0501035_0358338 Ga0501035_0358338_583_1176 187
127 3300050490 nmdc:mga03n38_146535_c1 nmdc:mga03n38_146535_c1_521_1132 187
128 3300050509 nmdc:mga0qj67_272615_c1 nmdc:mga0qj67_272615_c1_42_641 187
129 3300050516 nmdc:mga0sz30_2281_c1 nmdc:mga0sz30_2281_c1_5837_6430 187
130 3300053130 Ga0500642_0128415 Ga0500642_0128415_296_889 187
131 3300005329 Ga0070683_100440986 Ga0070683_1004409862 188
132 3300005338 Ga0068868_100218963 Ga0068868_1002189632 188
133 3300005466 Ga0070685_10359211 Ga0070685_103592112 188
134 3300005535 Ga0070684_100144900 Ga0070684_1001449002 188
135 3300005547 Ga0070693_100844752 Ga0070693_1008447521 188
136 3300005548 Ga0070665_101228472 Ga0070665_1012284721 188
137 3300005983 Ga0081540_1110744 Ga0081540_11107442 188
138 3300006038 Ga0075365_10054183 Ga0075365_100541831 188
139 3300006048 Ga0075363_100189806 Ga0075363_1001898062 188
140 3300006051 Ga0075364_10020084 Ga0075364_100200843 188
141 3300006178 Ga0075367_10299417 Ga0075367_102994172 188
142 3300006353 Ga0075370_10055685 Ga0075370_100556853 188
143 3300009101 Ga0105247_10622907 Ga0105247_106229072 188
144 3300009545 Ga0105237_10143692 Ga0105237_101436922 188
145 3300025914 Ga0207671_10024709 Ga0207671_100247095 188
146 3300025944 Ga0207661_10301028 Ga0207661_103010282 188
147 3300025949 Ga0207667_10328234 Ga0207667_103282342 188
148 3300026023 Ga0207677_10366817 Ga0207677_103668172 188
149 3300026067 Ga0207678_10078934 Ga0207678_100789343 188
150 3300026095 Ga0207676_10348522 Ga0207676_103485222 188
151 3300028379 Ga0268266_10894315 Ga0268266_108943152 188
152 3300042438 Ga0439459_0016602 Ga0439459_0016602_41_637 188
153 3300046460 Ga0495638_0072658 Ga0495638_0072658_284_880 188
154 3300048903 Ga0496100_0015136 Ga0496100_0015136_2360_2956 188
155 3300048904 Ga0496101_0000172 Ga0496101_0000172_15092_15688 188
156 3300048904 Ga0496101_0805095 Ga0496101_0805095_121_717 188
157 3300048905 Ga0496102_0000003 Ga0496102_0000003_298801_299397 188
158 3300048906 Ga0496103_0000012 Ga0496103_0000012_8313_8909 188
159 3300048909 Ga0496106_0034302 Ga0496106_0034302_448_1044 188
160 3300048911 Ga0496108_0531950 Ga0496108_0531950_174_770 188
161 3300048919 Ga0496116_0000040 Ga0496116_0000040_53441_54037 188
162 3300048920 Ga0496117_0000003 Ga0496117_0000003_292867_293463 188
163 3300048921 Ga0496118_0000001 Ga0496118_0000001_292870_293466 188
164 3300048922 Ga0496119_0000591 Ga0496119_0000591_36232_36828 188
165 3300048922 Ga0496119_0023085 Ga0496119_0023085_3800_4396 188
166 3300048923 Ga0496120_0000293 Ga0496120_0000293_29786_30382 188
167 3300048924 Ga0496121_0000019 Ga0496121_0000019_308219_308815 188
168 3300048928 Ga0496125_0068019 Ga0496125_0068019_1375_1971 188
169 3300048929 Ga0496126_0016585 Ga0496126_0016585_766_1362 188
170 3300050491 nmdc:mga00v17_2227_c1 nmdc:mga00v17_2227_c1_6992_7588 188
171 3300050492 nmdc:mga0yw44_56352_c1 nmdc:mga0yw44_56352_c1_1685_2281 188
172 3300050494 nmdc:mga06z11_266237_c1 nmdc:mga06z11_266237_c1_382_978 188
173 3300050496 nmdc:mga07m45_203489_c1 nmdc:mga07m45_203489_c1_258_854 188
174 3300050516 nmdc:mga0sz30_22037_c1 nmdc:mga0sz30_22037_c1_307_903 188
175 3300053087 Ga0500643_009573 Ga0500643_009573_2112_2708 188
176 3300053096 Ga0500641_0188657 Ga0500641_0188657_209_805 188
177 3300053136 Ga0500559_0064178 Ga0500559_0064178_55_651 188
178 3300053139 Ga0500568_0136457 Ga0500568_0136457_197_793 188
179 3300053730 Ga0500645_000070 Ga0500645_000070_64620_65216 188
180 3300005435 Ga0070714_100463717 Ga0070714_1004637172 189
181 3300005440 Ga0070705_100179158 Ga0070705_1001791581 189
182 3300006846 Ga0075430_100021855 Ga0075430_1000218553 189
183 3300032002 Ga0307416_100948497 Ga0307416_1009484972 189
184 3300041997 Ga0439431_0038034 Ga0439431_0038034_60_659 189
185 3300042435 Ga0439434_0084787 Ga0439434_0084787_253_852 189
186 3300044694 Ga0466963_0104129 Ga0466963_0104129_17_631 189
187 3300044719 Ga0466971_0030636 Ga0466971_0030636_710_1327 189
188 3300044842 Ga0466957_0079857 Ga0466957_0079857_1022_1636 189
189 3300044901 Ga0466960_0000524 Ga0466960_0000524_3217_3831 189
190 3300045836 Ga0466958_0050102 Ga0466958_0050102_1204_1818 189
191 3300045976 Ga0466967_0033996 Ga0466967_0033996_657_1271 189
192 3300049568 Ga0501031_0561182 Ga0501031_0561182_18_632 189
193 3300049569 Ga0501032_0001855 Ga0501032_0001855_9347_9961 189
194 3300049570 Ga0501033_0012173 Ga0501033_0012173_3213_3827 189
195 3300049571 Ga0501034_0003235 Ga0501034_0003235_7455_8069 189
196 3300049572 Ga0501036_0330281 Ga0501036_0330281_415_1029 189
197 3300049573 Ga0501037_0037184 Ga0501037_0037184_1085_1699 189
198 3300049579 Ga0501043_0017523 Ga0501043_0017523_3970_4584 189
199 3300049580 Ga0501046_0000969 Ga0501046_0000969_24023_24637 189
200 3300049581 Ga0501047_0003181 Ga0501047_0003181_12557_13171 189
201 3300049581 Ga0501047_0659771 Ga0501047_0659771_106_708 189
202 3300049582 Ga0501048_0004345 Ga0501048_0004345_3300_3914 189
203 3300049585 Ga0501069_0005667 Ga0501069_0005667_5661_6275 189
204 3300049586 Ga0501070_0001271 Ga0501070_0001271_6389_7003 189
205 3300049822 Ga0501035_0001201 Ga0501035_0001201_12641_13255 189
206 3300049823 Ga0501044_0002283 Ga0501044_0002283_7327_7941 189
207 3300061719 Ga0466962_0077931 Ga0466962_0077931_373_990 189
208 3300061719 Ga0466962_0078248 Ga0466962_0078248_302_916 189
209 3300001977 JGI24746J21847_1011250 JGI24746J21847_10112502 190
210 3300001990 JGI24737J22298_10050680 JGI24737J22298_100506802 190
211 3300001991 JGI24743J22301_10000444 JGI24743J22301_100004444 190
212 3300002073 JGI24745J21846_1000671 JGI24745J21846_10006713 190
213 3300002076 JGI24749J21850_1015499 JGI24749J21850_10154992 190
214 3300002077 JGI24744J21845_10000472 JGI24744J21845_100004724 190
215 3300002077 JGI24744J21845_10002773 JGI24744J21845_100027733 190
216 3300005328 Ga0070676_10012022 Ga0070676_100120221 190
217 3300005330 Ga0070690_100072521 Ga0070690_1000725213 190
218 3300005333 Ga0070677_10103181 Ga0070677_101031812 190
219 3300005334 Ga0068869_100186290 Ga0068869_1001862902 190
220 3300005335 Ga0070666_10074530 Ga0070666_100745301 190
221 3300005335 Ga0070666_10373530 Ga0070666_103735302 190
222 3300005338 Ga0068868_100001453 Ga0068868_1000014533 190
223 3300005338 Ga0068868_100016326 Ga0068868_1000163264 190
224 3300005339 Ga0070660_100218419 Ga0070660_1002184193 190
225 3300005341 Ga0070691_10008585 Ga0070691_100085853 190
226 3300005341 Ga0070691_10228877 Ga0070691_102288772 190
227 3300005341 Ga0070691_10239641 Ga0070691_102396412 190
228 3300005343 Ga0070687_100053168 Ga0070687_1000531682 190
229 3300005343 Ga0070687_100251677 Ga0070687_1002516772 190
230 3300005347 Ga0070668_100006407 Ga0070668_1000064073 190
231 3300005353 Ga0070669_100627304 Ga0070669_1006273041 190
232 3300005354 Ga0070675_100789085 Ga0070675_1007890851 190
233 3300005355 Ga0070671_100104015 Ga0070671_1001040153 190
234 3300005355 Ga0070671_100744681 Ga0070671_1007446811 190
235 3300005356 Ga0070674_100007936 Ga0070674_1000079366 190
236 3300005356 Ga0070674_100654901 Ga0070674_1006549011 190
237 3300005364 Ga0070673_100104101 Ga0070673_1001041012 190
238 3300005365 Ga0070688_100238480 Ga0070688_1002384801 190
239 3300005366 Ga0070659_100080318 Ga0070659_1000803182 190
240 3300005366 Ga0070659_100173257 Ga0070659_1001732573 190
241 3300005367 Ga0070667_100003133 Ga0070667_1000031331 190
242 3300005367 Ga0070667_100494275 Ga0070667_1004942751 190
243 3300005406 Ga0070703_10022147 Ga0070703_100221472 190
244 3300005434 Ga0070709_10020567 Ga0070709_100205674 190
245 3300005434 Ga0070709_10024767 Ga0070709_100247673 190
246 3300005435 Ga0070714_101090857 Ga0070714_1010908571 190
247 3300005436 Ga0070713_100041868 Ga0070713_1000418682 190
248 3300005437 Ga0070710_10001014 Ga0070710_100010147 190
249 3300005438 Ga0070701_10036479 Ga0070701_100364792 190
250 3300005439 Ga0070711_100000280 Ga0070711_1000002803 190
251 3300005439 Ga0070711_100096702 Ga0070711_1000967022 190
252 3300005441 Ga0070700_100004174 Ga0070700_1000041746 190
253 3300005441 Ga0070700_100049175 Ga0070700_1000491753 190
254 3300005444 Ga0070694_100006083 Ga0070694_1000060837 190
255 3300005455 Ga0070663_100002851 Ga0070663_1000028513 190
256 3300005456 Ga0070678_100000626 Ga0070678_10000062615 190
257 3300005456 Ga0070678_100625694 Ga0070678_1006256941 190
258 3300005459 Ga0068867_100000835 Ga0068867_1000008353 190
259 3300005459 Ga0068867_101354430 Ga0068867_1013544301 190
260 3300005466 Ga0070685_10029477 Ga0070685_100294773 190
261 3300005536 Ga0070697_100821620 Ga0070697_1008216201 190
262 3300005539 Ga0068853_100011755 Ga0068853_1000117553 190
263 3300005543 Ga0070672_100100581 Ga0070672_1001005813 190
264 3300005544 Ga0070686_100040113 Ga0070686_1000401133 190
265 3300005545 Ga0070695_100080609 Ga0070695_1000806093 190
266 3300005546 Ga0070696_100041424 Ga0070696_1000414243 190
267 3300005546 Ga0070696_100112038 Ga0070696_1001120383 190
268 3300005547 Ga0070693_100001856 Ga0070693_1000018562 190
269 3300005547 Ga0070693_100123822 Ga0070693_1001238222 190
270 3300005548 Ga0070665_100028263 Ga0070665_1000282632 190
271 3300005548 Ga0070665_100149567 Ga0070665_1001495673 190
272 3300005549 Ga0070704_100012290 Ga0070704_1000122904 190
273 3300005549 Ga0070704_100135587 Ga0070704_1001355872 190
274 3300005549 Ga0070704_100988686 Ga0070704_1009886861 190
275 3300005563 Ga0068855_100041253 Ga0068855_1000412533 190
276 3300005578 Ga0068854_100000551 Ga0068854_1000005514 190
277 3300005578 Ga0068854_100160510 Ga0068854_1001605102 190
278 3300005614 Ga0068856_100222756 Ga0068856_1002227563 190
279 3300005615 Ga0070702_100000921 Ga0070702_10000092110 190
280 3300005616 Ga0068852_100045499 Ga0068852_1000454993 190
281 3300005616 Ga0068852_100122541 Ga0068852_1001225412 190
282 3300005617 Ga0068859_100239718 Ga0068859_1002397183 190
283 3300005718 Ga0068866_10007520 Ga0068866_100075202 190
284 3300005719 Ga0068861_100012218 Ga0068861_1000122184 190
285 3300005719 Ga0068861_100030369 Ga0068861_1000303693 190
286 3300005840 Ga0068870_10142640 Ga0068870_101426403 190
287 3300005841 Ga0068863_100639133 Ga0068863_1006391332 190
288 3300005842 Ga0068858_100021054 Ga0068858_1000210545 190
289 3300005842 Ga0068858_100284552 Ga0068858_1002845522 190
290 3300005843 Ga0068860_100001259 Ga0068860_1000012594 190
291 3300005843 Ga0068860_100047670 Ga0068860_1000476705 190
292 3300005843 Ga0068860_100170286 Ga0068860_1001702863 190
293 3300005844 Ga0068862_100063531 Ga0068862_1000635312 190
294 3300005937 Ga0081455_10038392 Ga0081455_100383923 190
295 3300005981 Ga0081538_10065408 Ga0081538_100654081 190
296 3300006163 Ga0070715_10000966 Ga0070715_100009663 190
297 3300006173 Ga0070716_100026066 Ga0070716_1000260663 190
298 3300006175 Ga0070712_100000899 Ga0070712_1000008993 190
299 3300006175 Ga0070712_100003164 Ga0070712_1000031642 190
300 3300006178 Ga0075367_10439320 Ga0075367_104393202 190
301 3300006186 Ga0075369_10002129 Ga0075369_100021296 190
302 3300006186 Ga0075369_10002208 Ga0075369_100022082 190
303 3300006186 Ga0075369_10032605 Ga0075369_100326053 190
304 3300006237 Ga0097621_100116191 Ga0097621_1001161913 190
305 3300006353 Ga0075370_10159152 Ga0075370_101591522 190
306 3300006358 Ga0068871_100220462 Ga0068871_1002204623 190
307 3300006846 Ga0075430_100290996 Ga0075430_1002909961 190
308 3300006881 Ga0068865_100001854 Ga0068865_1000018544 190
309 3300006881 Ga0068865_100121125 Ga0068865_1001211252 190
310 3300006931 Ga0097620_100239721 Ga0097620_1002397213 190
311 3300017792 Ga0163161_10005267 Ga0163161_100052673 190
312 3300017792 Ga0163161_10028599 Ga0163161_100285995 190
313 3300025885 Ga0207653_10021879 Ga0207653_100218792 190
314 3300025893 Ga0207682_10191357 Ga0207682_101913571 190
315 3300025898 Ga0207692_10003160 Ga0207692_100031603 190
316 3300025898 Ga0207692_10534546 Ga0207692_105345461 190
317 3300025899 Ga0207642_10000244 Ga0207642_1000024413 190
318 3300025899 Ga0207642_10011989 Ga0207642_100119893 190
319 3300025900 Ga0207710_10021270 Ga0207710_100212703 190
320 3300025901 Ga0207688_10002485 Ga0207688_100024853 190
321 3300025901 Ga0207688_10021188 Ga0207688_100211885 190
322 3300025903 Ga0207680_10046828 Ga0207680_100468282 190
323 3300025904 Ga0207647_10126835 Ga0207647_101268352 190
324 3300025906 Ga0207699_10078807 Ga0207699_100788072 190
325 3300025906 Ga0207699_10472288 Ga0207699_104722882 190
326 3300025907 Ga0207645_10077039 Ga0207645_100770391 190
327 3300025908 Ga0207643_10071949 Ga0207643_100719493 190
328 3300025911 Ga0207654_10159369 Ga0207654_101593692 190
329 3300025914 Ga0207671_10080547 Ga0207671_100805474 190
330 3300025915 Ga0207693_10000638 Ga0207693_100006383 190
331 3300025915 Ga0207693_10002063 Ga0207693_100020638 190
332 3300025916 Ga0207663_10000215 Ga0207663_1000021517 190
333 3300025916 Ga0207663_10315899 Ga0207663_103158992 190
334 3300025916 Ga0207663_10447130 Ga0207663_104471302 190
335 3300025918 Ga0207662_10067860 Ga0207662_100678602 190
336 3300025919 Ga0207657_10172223 Ga0207657_101722231 190
337 3300025919 Ga0207657_10181405 Ga0207657_101814052 190
338 3300025920 Ga0207649_10382443 Ga0207649_103824431 190
339 3300025923 Ga0207681_10008948 Ga0207681_100089486 190
340 3300025923 Ga0207681_10130714 Ga0207681_101307142 190
341 3300025924 Ga0207694_10895228 Ga0207694_108952282 190
342 3300025927 Ga0207687_10007421 Ga0207687_100074214 190
343 3300025927 Ga0207687_10068338 Ga0207687_100683383 190
344 3300025931 Ga0207644_10059227 Ga0207644_100592273 190
345 3300025933 Ga0207706_10411861 Ga0207706_104118612 190
346 3300025934 Ga0207686_10242385 Ga0207686_102423852 190
347 3300025934 Ga0207686_10293309 Ga0207686_102933092 190
348 3300025935 Ga0207709_10018535 Ga0207709_100185354 190
349 3300025935 Ga0207709_10137084 Ga0207709_101370842 190
350 3300025936 Ga0207670_10112489 Ga0207670_101124892 190
351 3300025937 Ga0207669_10000271 Ga0207669_1000027114 190
352 3300025937 Ga0207669_10418658 Ga0207669_104186582 190
353 3300025938 Ga0207704_10001344 Ga0207704_100013448 190
354 3300025939 Ga0207665_10009948 Ga0207665_100099485 190
355 3300025939 Ga0207665_10012819 Ga0207665_100128193 190
356 3300025942 Ga0207689_10129864 Ga0207689_101298643 190
357 3300025960 Ga0207651_10060881 Ga0207651_100608812 190
358 3300025961 Ga0207712_10006159 Ga0207712_100061594 190
359 3300025961 Ga0207712_10547581 Ga0207712_105475812 190
360 3300025972 Ga0207668_10004088 Ga0207668_100040884 190
361 3300025981 Ga0207640_10004670 Ga0207640_100046704 190
362 3300025981 Ga0207640_10230852 Ga0207640_102308522 190
363 3300025986 Ga0207658_10002751 Ga0207658_100027517 190
364 3300025986 Ga0207658_10466231 Ga0207658_104662312 190
365 3300026023 Ga0207677_10016402 Ga0207677_100164024 190
366 3300026035 Ga0207703_10002729 Ga0207703_100027296 190
367 3300026041 Ga0207639_10008405 Ga0207639_100084052 190
368 3300026041 Ga0207639_10596419 Ga0207639_105964192 190
369 3300026067 Ga0207678_10008697 Ga0207678_100086971 190
370 3300026067 Ga0207678_10016320 Ga0207678_100163205 190
371 3300026075 Ga0207708_10008676 Ga0207708_100086766 190
372 3300026075 Ga0207708_10015025 Ga0207708_100150254 190
373 3300026078 Ga0207702_10442852 Ga0207702_104428522 190
374 3300026088 Ga0207641_10440243 Ga0207641_104402432 190
375 3300026089 Ga0207648_10001982 Ga0207648_100019823 190
376 3300026118 Ga0207675_100003213 Ga0207675_10000321314 190
377 3300026118 Ga0207675_100138610 Ga0207675_1001386102 190
378 3300026118 Ga0207675_100696180 Ga0207675_1006961801 190
379 3300026118 Ga0207675_100957824 Ga0207675_1009578242 190
380 3300026121 Ga0207683_10000874 Ga0207683_100008743 190
381 3300026121 Ga0207683_10094198 Ga0207683_100941982 190
382 3300026142 Ga0207698_10093802 Ga0207698_100938022 190
383 3300026142 Ga0207698_10266581 Ga0207698_102665812 190
384 3300028379 Ga0268266_10075534 Ga0268266_100755342 190
385 3300028379 Ga0268266_10383239 Ga0268266_103832392 190
386 3300028380 Ga0268265_10048422 Ga0268265_100484223 190
387 3300028380 Ga0268265_10050506 Ga0268265_100505064 190
388 3300028381 Ga0268264_10002334 Ga0268264_1000233414 190
389 3300028381 Ga0268264_10482353 Ga0268264_104823532 190
390 3300028381 Ga0268264_10582534 Ga0268264_105825341 190
391 3300037853 Ga0436364_0699371 Ga0436364_0699371_1829_2431 190
392 3300037853 Ga0436364_0946484 Ga0436364_0946484_989_1615 190
393 3300039437 Ga0436365_0681434 Ga0436365_0681434_854_1456 190
394 3300039437 Ga0436365_1122234 Ga0436365_1122234_3248_3874 190
395 3300039450 Ga0436363_1676298 Ga0436363_1676298_30_632 190
396 3300044684 Ga0466966_0003701 Ga0466966_0003701_5024_5626 190
397 3300044684 Ga0466966_0024064 Ga0466966_0024064_734_1336 190
398 3300044684 Ga0466966_0084336 Ga0466966_0084336_1071_1682 190
399 3300044693 Ga0466961_0121425 Ga0466961_0121425_792_1394 190
400 3300044719 Ga0466971_0099747 Ga0466971_0099747_172_774 190
401 3300044735 Ga0466968_0063649 Ga0466968_0063649_484_1095 190
402 3300044765 Ga0466970_0011211 Ga0466970_0011211_2037_2648 190
403 3300044842 Ga0466957_0023416 Ga0466957_0023416_1325_1927 190
404 3300044842 Ga0466957_0067930 Ga0466957_0067930_381_992 190
405 3300045049 Ga0466959_0014120 Ga0466959_0014120_2260_2871 190
406 3300045836 Ga0466958_0105300 Ga0466958_0105300_361_963 190
407 3300045976 Ga0466967_0015451 Ga0466967_0015451_4606_5208 190
408 3300045976 Ga0466967_0052634 Ga0466967_0052634_2575_3177 190
409 3300046460 Ga0495638_0013470 Ga0495638_0013470_198_800 190
410 3300048091 Ga0495626_0075845 Ga0495626_0075845_173_775 190
411 3300048903 Ga0496100_0023709 Ga0496100_0023709_1310_1912 190
412 3300048904 Ga0496101_0924982 Ga0496101_0924982_59_670 190
413 3300048905 Ga0496102_0045839 Ga0496102_0045839_1402_2004 190
414 3300048906 Ga0496103_0686781 Ga0496103_0686781_18_620 190
415 3300048907 Ga0496104_0106502 Ga0496104_0106502_440_1042 190
416 3300048908 Ga0496105_0096567 Ga0496105_0096567_1411_2013 190
417 3300048909 Ga0496106_0054709 Ga0496106_0054709_589_1191 190
418 3300048915 Ga0496112_0201250 Ga0496112_0201250_799_1401 190
419 3300048917 Ga0496114_0193338 Ga0496114_0193338_69_671 190
420 3300048929 Ga0496126_0412264 Ga0496126_0412264_68_670 190
421 3300049823 Ga0501044_0610743 Ga0501044_0610743_357_971 190
422 3300050516 nmdc:mga0sz30_2817_c1 nmdc:mga0sz30_2817_c1_2893_3501 190
423 3300053108 Ga0500562_001236 Ga0500562_001236_5664_6266 190
424 3300053142 Ga0500577_0107447 Ga0500577_0107447_536_1138 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

14

172

0.94

PF12867

DinB_2

DinB superfamily

19

163

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.769 7 164
2nsg-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase h52a mutant 0.7534 10 151
5cof-assembly1.cif.gz_A crystal structure of uncharacterised protein q1r1x2 from escherichia coli uti89 0.7532 12 161
2nsf-assembly1.cif.gz_A crystal structure of the mycothiol-dependent maleylpyruvate isomerase 0.7527 10 151
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.7443 11 152
ID Description Score Start End Superfamily
5civA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7538 8 163 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7534 10 151 1.20.120.450
2ou6A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7397 1 160 1.20.120.450
5cofA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7278 12 161 1.20.120.450
5cogA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7236 8 153 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A1A3NKP4-F1-model_v4 DinB family protein 0.9188 8 185
AF-A0A2S9FH80-F1-model_v4 DinB family protein 0.8836 1 143
AF-A0A6I6GFS1-F1-model_v4 DinB-like domain-containing protein 0.879 1 174
AF-A0A5C4LYS5-F1-model_v4 DinB family protein 0.8656 1 187
AF-A0A7Y9JR28-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.8641 1 187

Feature Viewer

pLDDT pTM Quality
90.47 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map