F440592

General Info

Members Datasets Scaffolds Average Seq Length
423 213 846 369

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0051369|Ga0495621_0051369_84_1442
Length 452
Sequence MGLVNQVVPKDQLETFTRDYAQTMARNAPLTLKAAKASVDQLVKPAAQRDTAMLDKLIADCFNSEDYQEGVRAFSEKRRPQFKVRVESVDAIAVEIPLTRNFGGSTYSVLKRSTVVTRLRTDAGLVSEVYNGDNREHGAEIVRLIREDLGPRLHGVDVLAIEQIWDDLFTLSHASRDRKTLMEAIACVDCALWDVIGKACSLTVAELLGGKARPMPIISIGGYYMPGKTLADIGREMEAYRRAGMAGCKFKVGGLTPEADAERVQVARDAAGDDFVLAVDANRGWSLGDAVRFAKLVEPLDIRWFEEPCHWHDDAAMMADVRRATRIPVTAGQSEITSQGVRRLLQAGAVDVVNVDASECGGVTEWRRAAALCAATGVEMAHHEESQIARHLMAAAPRGTYVECFADPERDPVWQSMWANRPLIKDGMLGASSDAGFGLVLDDAMVRRYRVA

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
143 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
166 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
167 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
168 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
169 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
170 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
173 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 2508501050 Microvirga lupini Lut6 Isolate Nodule
213 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.24
Rhizoplane 2.36
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 12.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0051369 3300046539 Bacteria 1475
2 JGI25406J46586_10016315 3300003203 Unclassified 3099
3 Ga0070683_100078017 3300005329 Unclassified 3098
4 Ga0070690_100186085 3300005330 Unclassified 1437
5 Ga0070670_100004645 3300005331 Bacteria 11519
6 Ga0070670_100013818 3300005331 Bacteria 6921
7 Ga0068869_100001452 3300005334 Bacteria 14017
8 Ga0068869_100083798 3300005334 Unclassified 2385
9 Ga0068869_100123458 3300005334 Unclassified 1983
10 Ga0070666_10090322 3300005335 Bacteria 2104
11 Ga0070680_100011658 3300005336 Bacteria 6812
12 Ga0070682_100002509 3300005337 Bacteria 10128
13 Ga0070660_100016239 3300005339 Bacteria 5399
14 Ga0070689_100027061 3300005340 Bacteria 4321
15 Ga0070691_10003047 3300005341 Bacteria 7499
16 Ga0070691_10015614 3300005341 Bacteria 3488
17 Ga0070661_100023730 3300005344 Bacteria 4399
18 Ga0070692_10002198 3300005345 Bacteria 7468
19 Ga0070668_100009121 3300005347 Bacteria 7364
20 Ga0070669_100028792 3300005353 Bacteria 4001
21 Ga0070669_100035470 3300005353 Bacteria 3614
22 Ga0070674_100289102 3300005356 Bacteria 1302
23 Ga0070673_100027608 3300005364 Bacteria 4210
24 Ga0070688_100061009 3300005365 Bacteria 2383
25 Ga0070659_100000377 3300005366 Bacteria 33695
26 Ga0070703_10006396 3300005406 Bacteria 3303
27 Ga0070713_100056037 3300005436 Bacteria 3278
28 Ga0070701_10006518 3300005438 Bacteria 4918
29 Ga0070701_10014965 3300005438 Unclassified 3569
30 Ga0070701_10099002 3300005438 Bacteria 1611
31 Ga0070705_100009495 3300005440 Bacteria 4839
32 Ga0070700_100020135 3300005441 Unclassified 3859
33 Ga0070694_100032698 3300005444 Bacteria 3417
34 Ga0070708_100014332 3300005445 Bacteria 6520
35 Ga0070708_100037746 3300005445 Bacteria 4218
36 Ga0070708_100047472 3300005445 Bacteria 3793
37 Ga0070708_100066444 3300005445 Bacteria 3237
38 Ga0070708_100140076 3300005445 Unclassified 2243
39 Ga0070708_100200539 3300005445 Unclassified 1868
40 Ga0070663_100001821 3300005455 Bacteria 11866
41 Ga0070678_100023444 3300005456 Bacteria 4113
42 Ga0070678_100057376 3300005456 Bacteria 2852
43 Ga0070662_100007534 3300005457 Bacteria 7061
44 Ga0070681_10021724 3300005458 Bacteria 6436
45 Ga0070681_10078947 3300005458 Bacteria 3248
46 Ga0070681_10157715 3300005458 Bacteria 2194
47 Ga0068867_100003302 3300005459 Bacteria 11361
48 Ga0068867_100014150 3300005459 Bacteria 5651
49 Ga0068867_100092123 3300005459 Bacteria 2301
50 Ga0070706_100013791 3300005467 Bacteria 7474
51 Ga0070706_100049412 3300005467 Bacteria 3882
52 Ga0070706_100127002 3300005467 Bacteria 2378
53 Ga0070706_100190304 3300005467 Bacteria 1917
54 Ga0070706_100363544 3300005467 Bacteria 1348
55 Ga0070707_100002180 3300005468 Bacteria 18721
56 Ga0070707_100016652 3300005468 Bacteria 6900
57 Ga0070707_100019107 3300005468 Bacteria 6453
58 Ga0070707_100059173 3300005468 Bacteria 3675
59 Ga0070707_100114956 3300005468 Bacteria 2611
60 Ga0070707_100146863 3300005468 Bacteria 2295
61 Ga0070698_100001010 3300005471 Bacteria 30910
62 Ga0070698_100004229 3300005471 Bacteria 15783
63 Ga0070698_100057246 3300005471 Bacteria 3945
64 Ga0070698_100065735 3300005471 Bacteria 3651
65 Ga0070698_100095682 3300005471 Bacteria 2947
66 Ga0070699_100002611 3300005518 Bacteria 16093
67 Ga0070699_100008788 3300005518 Bacteria 8754
68 Ga0070679_100021385 3300005530 Bacteria 6315
69 Ga0070697_100028318 3300005536 Bacteria 4485
70 Ga0070697_100030636 3300005536 Bacteria 4322
71 Ga0070697_100043773 3300005536 Bacteria 3626
72 Ga0070697_100151817 3300005536 Bacteria 1953
73 Ga0068853_100012895 3300005539 Bacteria 6811
74 Ga0070672_100033462 3300005543 Unclassified 3893
75 Ga0070686_100054527 3300005544 Bacteria 2557
76 Ga0070695_100002346 3300005545 Bacteria 10861
77 Ga0070695_100040087 3300005545 Bacteria 2963
78 Ga0070696_100002742 3300005546 Bacteria 11687
79 Ga0070696_100047989 3300005546 Bacteria 2964
80 Ga0070693_100000929 3300005547 Bacteria 12998
81 Ga0070693_100129032 3300005547 Bacteria 1578
82 Ga0070665_100008084 3300005548 Bacteria 10648
83 Ga0070704_100006964 3300005549 Bacteria 6706
84 Ga0070704_100024745 3300005549 Bacteria 3943
85 Ga0070704_100050215 3300005549 Unclassified 2930
86 Ga0068855_100006654 3300005563 Bacteria 14037
87 Ga0070664_100160066 3300005564 Unclassified 1991
88 Ga0070664_100218588 3300005564 Unclassified 1704
89 Ga0070664_100243031 3300005564 Bacteria 1616
90 Ga0068857_100033329 3300005577 Bacteria 4555
91 Ga0068857_100048685 3300005577 Bacteria 3762
92 Ga0068854_100008989 3300005578 Bacteria 6439
93 Ga0068856_100001687 3300005614 Bacteria 23089
94 Ga0068856_100128838 3300005614 Bacteria 2534
95 Ga0068852_100093674 3300005616 Bacteria 2693
96 Ga0068859_100007912 3300005617 Bacteria 10781
97 Ga0068859_100039159 3300005617 Bacteria 4755
98 Ga0068859_100381636 3300005617 Unclassified 1504
99 Ga0068864_100015072 3300005618 Bacteria 6425
100 Ga0068866_10002306 3300005718 Bacteria 7903
101 Ga0068861_100054895 3300005719 Unclassified 3037
102 Ga0068870_10001427 3300005840 Bacteria 9660
103 Ga0068870_10015890 3300005840 Plasmid 3583
104 Ga0068863_100051268 3300005841 Bacteria 3911
105 Ga0068863_100164786 3300005841 Bacteria 2125
106 Ga0068863_100274804 3300005841 Unclassified 1631
107 Ga0068858_100016518 3300005842 Bacteria 6933
108 Ga0068858_100042880 3300005842 Bacteria 4195
109 Ga0068860_100013265 3300005843 Bacteria 8086
110 Ga0068860_100035345 3300005843 Bacteria 4792
111 Ga0068862_100013621 3300005844 Bacteria 6735
112 Ga0068862_100016348 3300005844 Bacteria 6175
113 Ga0068862_100018122 3300005844 Bacteria 5862
114 Ga0068862_100223302 3300005844 Bacteria 1706
115 Ga0081539_10000020 3300005985 Bacteria 366549
116 Ga0081539_10066305 3300005985 Bacteria 1957
117 Ga0070717_10107012 3300006028 Bacteria 2381
118 Ga0097621_100033667 3300006237 Bacteria 4082
119 Ga0068871_100062440 3300006358 Bacteria 3044
120 Ga0075428_100019877 3300006844 Bacteria 7435
121 Ga0075428_100364531 3300006844 Bacteria 1550
122 Ga0075430_100001918 3300006846 Bacteria 17059
123 Ga0075431_100006917 3300006847 Bacteria 11276
124 Ga0075431_100012693 3300006847 Bacteria 8509
125 Ga0075431_100069245 3300006847 Bacteria 3641
126 Ga0075431_100087885 3300006847 Bacteria 3207
127 Ga0075431_100126719 3300006847 Bacteria 2635
128 Ga0075431_100388185 3300006847 Bacteria 1399
129 Ga0075433_10000319 3300006852 Bacteria 29346
130 Ga0075433_10000948 3300006852 Bacteria 20482
131 Ga0075433_10099341 3300006852 Bacteria 2576
132 Ga0075434_100000404 3300006871 Bacteria 31777
133 Ga0075434_100043691 3300006871 Bacteria 4444
134 Ga0075434_100223751 3300006871 Bacteria 1901
135 Ga0075434_100337622 3300006871 Unclassified 1527
136 Ga0075434_100393588 3300006871 Bacteria 1406
137 Ga0075434_100435018 3300006871 Bacteria 1333
138 Ga0075429_100022735 3300006880 Bacteria 5436
139 Ga0075429_100080143 3300006880 Bacteria 2846
140 Ga0075429_100080595 3300006880 Bacteria 2838
141 Ga0075429_100154915 3300006880 Bacteria 2006
142 Ga0075429_100209229 3300006880 Bacteria 1709
143 Ga0075429_100245613 3300006880 Bacteria 1567
144 Ga0068865_100011487 3300006881 Bacteria 5548
145 Ga0075436_100000794 3300006914 Bacteria 20924
146 Ga0075436_100059172 3300006914 Bacteria 2647
147 Ga0075436_100062974 3300006914 Bacteria 2564
148 Ga0097620_100007912 3300006931 Bacteria 10781
149 Ga0097620_100039158 3300006931 Bacteria 4755
150 Ga0097620_100381609 3300006931 Unclassified 1504
151 Ga0075435_100002255 3300007076 Bacteria 12730
152 Ga0075435_100005866 3300007076 Bacteria 8644
153 Ga0075435_100011023 3300007076 Bacteria 6630
154 Ga0075435_100025455 3300007076 Bacteria 4607
155 Ga0099794_10005722 3300007265 Bacteria 5009
156 Ga0099795_10006587 3300007788 Bacteria 3180
157 Ga0111539_10009439 3300009094 Bacteria 12312
158 Ga0111539_10015922 3300009094 Bacteria 9340
159 Ga0111539_10019508 3300009094 Bacteria 8366
160 Ga0114129_10000541 3300009147 Bacteria 46363
161 Ga0114129_10002669 3300009147 Bacteria 24835
162 Ga0114129_10002813 3300009147 Bacteria 24271
163 Ga0114129_10007717 3300009147 Bacteria 15305
164 Ga0114129_10014072 3300009147 Bacteria 11399
165 Ga0114129_10561614 3300009147 Unclassified 1483
166 Ga0105248_10047162 3300009177 Bacteria 4831
167 Ga0105248_10260580 3300009177 Unclassified 1952
168 Ga0105249_10368311 3300009553 Unclassified 1460
169 Ga0105246_10018554 3300011119 Bacteria 4435
170 Ga0157373_10015577 3300013100 Bacteria 5557
171 Ga0157369_10010014 3300013105 Bacteria 10828
172 Ga0157374_10301409 3300013296 Unclassified 1585
173 Ga0163162_10647624 3300013306 Bacteria 1180
174 Ga0157372_10000646 3300013307 Bacteria 38275
175 Ga0157375_10166539 3300013308 Unclassified 2349
176 Ga0157375_10193589 3300013308 Unclassified 2188
177 Ga0157380_10059685 3300014326 Unclassified 3045
178 Ga0182008_10055546 3300014497 Bacteria 1958
179 Ga0157379_10121286 3300014968 Unclassified 2352
180 Ga0163161_10067426 3300017792 Bacteria 2614
181 Ga0163161_10275178 3300017792 Bacteria 1319
182 Ga0213875_10000755 3300021388 Bacteria 24416
183 Ga0213871_10005735 3300021441 Bacteria 2584
184 Ga0207653_10004309 3300025885 Bacteria 4469
185 Ga0207653_10009269 3300025885 Bacteria 3064
186 Ga0207688_10003821 3300025901 Bacteria 8215
187 Ga0207688_10023301 3300025901 Bacteria 3389
188 Ga0207680_10042300 3300025903 Bacteria 2664
189 Ga0207647_10047460 3300025904 Bacteria 2671
190 Ga0207699_10005641 3300025906 Bacteria 6007
191 Ga0207699_10144291 3300025906 Bacteria 1568
192 Ga0207645_10003896 3300025907 Bacteria 11157
193 Ga0207645_10010845 3300025907 Bacteria 6244
194 Ga0207643_10000355 3300025908 Bacteria 30699
195 Ga0207643_10009641 3300025908 Bacteria 5185
196 Ga0207684_10001301 3300025910 Bacteria 27465
197 Ga0207684_10014343 3300025910 Bacteria 6835
198 Ga0207684_10023833 3300025910 Bacteria 5222
199 Ga0207684_10025457 3300025910 Bacteria 5041
200 Ga0207684_10078372 3300025910 Bacteria 2810
201 Ga0207684_10110211 3300025910 Bacteria 2356
202 Ga0207654_10007146 3300025911 Bacteria 5622
203 Ga0207707_10000047 3300025912 Bacteria 118016
204 Ga0207707_10027568 3300025912 Bacteria 4967
205 Ga0207660_10048966 3300025917 Bacteria 2992
206 Ga0207662_10020651 3300025918 Bacteria 3759
207 Ga0207662_10180307 3300025918 Bacteria 1359
208 Ga0207657_10000021 3300025919 Bacteria 155900
209 Ga0207649_10021028 3300025920 Bacteria 3749
210 Ga0207652_10042855 3300025921 Bacteria 3853
211 Ga0207646_10001330 3300025922 Bacteria 30700
212 Ga0207646_10001785 3300025922 Bacteria 26056
213 Ga0207646_10010669 3300025922 Bacteria 8947
214 Ga0207646_10035268 3300025922 Bacteria 4518
215 Ga0207646_10056416 3300025922 Bacteria 3511
216 Ga0207681_10191395 3300025923 Unclassified 1565
217 Ga0207681_10297315 3300025923 Bacteria 1276
218 Ga0207650_10030625 3300025925 Bacteria 3877
219 Ga0207650_10109826 3300025925 Bacteria 2133
220 Ga0207700_10022663 3300025928 Bacteria 4313
221 Ga0207664_10006264 3300025929 Bacteria 8174
222 Ga0207690_10000789 3300025932 Bacteria 20419
223 Ga0207706_10016654 3300025933 Bacteria 6634
224 Ga0207709_10011171 3300025935 Bacteria 4953
225 Ga0207709_10166663 3300025935 Bacteria 1542
226 Ga0207670_10132762 3300025936 Unclassified 1826
227 Ga0207665_10000411 3300025939 Bacteria 29470
228 Ga0207665_10015550 3300025939 Bacteria 4993
229 Ga0207691_10023772 3300025940 Bacteria 5768
230 Ga0207689_10000697 3300025942 Bacteria 32204
231 Ga0207689_10032358 3300025942 Bacteria 4352
232 Ga0207689_10036916 3300025942 Bacteria 4055
233 Ga0207661_10080777 3300025944 Unclassified 2684
234 Ga0207679_10004712 3300025945 Bacteria 8491
235 Ga0207679_10028623 3300025945 Bacteria 3869
236 Ga0207679_10149787 3300025945 Bacteria 1897
237 Ga0207667_10000620 3300025949 Bacteria 45914
238 Ga0207651_10031312 3300025960 Bacteria 3398
239 Ga0207651_10058815 3300025960 Unclassified 2658
240 Ga0207640_10068509 3300025981 Unclassified 2378
241 Ga0207677_10133747 3300026023 Unclassified 1887
242 Ga0207703_10015250 3300026035 Bacteria 5995
243 Ga0207639_10042501 3300026041 Bacteria 3406
244 Ga0207678_10007778 3300026067 Bacteria 9469
245 Ga0207708_10020587 3300026075 Bacteria 4975
246 Ga0207708_10075760 3300026075 Unclassified 2580
247 Ga0207702_10009066 3300026078 Bacteria 8375
248 Ga0207702_10049264 3300026078 Bacteria 3555
249 Ga0207641_10018246 3300026088 Bacteria 5751
250 Ga0207641_10080235 3300026088 Bacteria 2830
251 Ga0207641_10223569 3300026088 Bacteria 1747
252 Ga0207641_10252234 3300026088 Unclassified 1648
253 Ga0207648_10001227 3300026089 Bacteria 28750
254 Ga0207648_10171913 3300026089 Bacteria 1915
255 Ga0207648_10337882 3300026089 Bacteria 1356
256 Ga0207676_10015486 3300026095 Bacteria 5501
257 Ga0207676_10021716 3300026095 Bacteria 4710
258 Ga0207676_10179947 3300026095 Bacteria 1850
259 Ga0207676_10232303 3300026095 Unclassified 1649
260 Ga0207674_10042446 3300026116 Bacteria 4697
261 Ga0207674_10112021 3300026116 Bacteria 2702
262 Ga0207674_10265887 3300026116 Unclassified 1662
263 Ga0207674_10293473 3300026116 Bacteria 1574
264 Ga0207675_100053855 3300026118 Unclassified 3753
265 Ga0207675_100064101 3300026118 Bacteria 3434
266 Ga0207675_100088331 3300026118 Unclassified 2911
267 Ga0207675_100153501 3300026118 Bacteria 2193
268 Ga0209588_1002397 3300027671 Bacteria 5075
269 Ga0207428_10000029 3300027907 Bacteria 241338
270 Ga0207428_10047823 3300027907 Bacteria 3434
271 Ga0207428_10181689 3300027907 Unclassified 1589
272 Ga0268265_10001200 3300028380 Bacteria 22559
273 Ga0268265_10048595 3300028380 Bacteria 3185
274 Ga0268264_10077096 3300028381 Bacteria 2838
275 Ga0265318_10011943 3300028577 Bacteria 3713
276 Ga0265330_10007808 3300031235 Bacteria 5192
277 Ga0265332_10002055 3300031238 Bacteria 10528
278 Ga0265328_10002786 3300031239 Bacteria 7823
279 Ga0265320_10093129 3300031240 Bacteria 1394
280 Ga0265331_10002356 3300031250 Bacteria 12840
281 Ga0265327_10062581 3300031251 Bacteria 1893
282 Ga0265314_10004077 3300031711 Bacteria 13784
283 Ga0265342_10024638 3300031712 Bacteria 3796
284 Ga0307410_10133934 3300031852 Bacteria 1824
285 Ga0307416_100065186 3300032002 Bacteria 2992
286 Ga0307411_10269011 3300032005 Bacteria 1350
287 Ga0373932_0026638 3300035112 Bacteria 1574
288 Ga0373939_0032179 3300035114 Unclassified 1522
289 Ga0373931_0036893 3300035691 Bacteria 2550
290 Ga0373931_0038100 3300035691 Bacteria 2513
291 Ga0373935_0108887 3300035692 Bacteria 1837
292 Ga0373927_0236361 3300035695 Bacteria 1201
293 Ga0395899_0035751 3300037312 Bacteria 3728
294 Ga0395900_0001429 3300037418 Bacteria 28495
295 Ga0395900_0036108 3300037418 Bacteria 5094
296 Ga0395898_0010686 3300037466 Bacteria 9590
297 Ga0436364_0572636 3300037853 Bacteria 21241
298 Ga0436364_1119186 3300037853 Bacteria 34885
299 Ga0436365_0015172 3300039437 Bacteria 3159
300 Ga0439448_0012291 3300042005 Unclassified 2560
301 Ga0439455_0003931 3300042012 Bacteria 2896
302 Ga0439455_0019613 3300042012 Bacteria 1596
303 Ga0450889_000713 3300042144 Bacteria 3588
304 Ga0439458_0016440 3300042157 Unclassified 1683
305 Ga0451577_0019760 3300042876 Bacteria 6190
306 Ga0451577_0102879 3300042876 Unclassified 2552
307 Ga0453683_0039465 3300044673 Bacteria 2967
308 Ga0453683_0059833 3300044673 Unclassified 2381
309 Ga0453684_0075215 3300044712 Bacteria 4246
310 Ga0451576_0011896 3300045051 Bacteria 9840
311 Ga0451576_0031213 3300045051 Bacteria 5683
312 Ga0451576_0179653 3300045051 Bacteria 2209
313 Ga0451576_0219726 3300045051 Bacteria 1984
314 Ga0495580_0004319 3300046472 Bacteria 11947
315 Ga0495580_0236133 3300046472 Unclassified 1254
316 Ga0495584_0125817 3300046491 Bacteria 1299
317 Ga0495656_0125761 3300046615 Bacteria 1215
318 Ga0495669_0042868 3300046684 Bacteria 2013
319 Ga0495669_0108100 3300046684 Bacteria 1297
320 Ga0496101_0091987 3300048904 Bacteria 2258
321 Ga0496102_0132817 3300048905 Unclassified 2331
322 Ga0496104_0002880 3300048907 Bacteria 14829
323 Ga0496106_0035395 3300048909 Bacteria 3734
324 Ga0496106_0123371 3300048909 Bacteria 2027
325 Ga0496108_0031126 3300048911 Bacteria 4425
326 Ga0496112_0021385 3300048915 Bacteria 6152
327 Ga0496112_0152426 3300048915 Bacteria 2279
328 Ga0496112_0276040 3300048915 Bacteria 1628
329 Ga0496115_0009533 3300048918 Bacteria 7211
330 Ga0501036_0061832 3300049572 Bacteria 3172
331 Ga0501038_0339134 3300049574 Bacteria 1172
332 Ga0501039_0032330 3300049575 Bacteria 4033
333 Ga0501039_0065246 3300049575 Bacteria 2824
334 Ga0501040_0035157 3300049576 Bacteria 3397
335 Ga0501040_0040719 3300049576 Bacteria 3162
336 Ga0501040_0062505 3300049576 Bacteria 2562
337 Ga0501041_0002039 3300049577 Bacteria 11366
338 Ga0501041_0007275 3300049577 Bacteria 6499
339 Ga0501041_0007621 3300049577 Bacteria 6358
340 Ga0501042_0005859 3300049578 Bacteria 7942
341 Ga0501042_0031531 3300049578 Bacteria 3750
342 Ga0501048_0087573 3300049582 Bacteria 2197
343 Ga0501071_0029229 3300049587 Bacteria 3889
344 Ga0501072_0022676 3300049588 Bacteria 4871
345 Ga0501072_0137189 3300049588 Bacteria 1950
346 Ga0501074_0095914 3300049590 Bacteria 2124
347 Ga0501074_0146192 3300049590 Bacteria 1690
348 Ga0501075_0016369 3300049591 Bacteria 5340
349 Ga0501075_0027053 3300049591 Bacteria 4226
350 Ga0501076_0009780 3300049592 Bacteria 7083
351 Ga0501076_0087415 3300049592 Bacteria 2506
352 Ga0501076_0152525 3300049592 Unclassified 1880
353 Ga0501076_0343150 3300049592 Unclassified 1226
354 Ga0501077_0009909 3300049593 Bacteria 5931
355 Ga0501077_0091333 3300049593 Bacteria 1929
356 Ga0501077_0102128 3300049593 Unclassified 1817
357 Ga0501079_0037980 3300049741 Bacteria 3713
358 Ga0501079_0190773 3300049741 Bacteria 1599
359 Ga0501079_0194807 3300049741 Bacteria 1582
360 Ga0501080_0004563 3300049742 Bacteria 12345
361 Ga0501081_0003238 3300049743 Bacteria 10359
362 Ga0501081_0005929 3300049743 Bacteria 7909
363 Ga0501081_0122495 3300049743 Unclassified 1853
364 Ga0501045_0111664 3300049824 Bacteria 2027
365 nmdc:mga05p37_176721_c1 3300050507 Bacteria 2601
366 nmdc:mga05p37_24894_c1 3300050507 Bacteria 7276
367 nmdc:mga05p37_553055_c1 3300050507 Bacteria 1310
368 nmdc:mga05p37_702_c1 3300050507 Bacteria 37071
369 nmdc:mga05p37_783_c1 3300050507 Bacteria 35363
370 nmdc:mga09592_137611_c1 3300050508 Bacteria 2104
371 nmdc:mga09592_191560_c1 3300050508 Bacteria 1770
372 nmdc:mga09592_34341_c1 3300050508 Bacteria 4239
373 nmdc:mga09592_59845_c1 3300050508 Bacteria 3220
374 nmdc:mga09592_82157_c1 3300050508 Bacteria 2746
375 nmdc:mga0qj67_12482_c1 3300050509 Bacteria 6400
376 nmdc:mga0qj67_47603_c1 3300050509 Bacteria 3387
377 nmdc:mga06r32_113184_c1 3300050510 Bacteria 2671
378 nmdc:mga06r32_125770_c1 3300050510 Bacteria 2532
379 nmdc:mga06r32_1728_c1 3300050510 Bacteria 19662
380 nmdc:mga06r32_323913_c1 3300050510 Bacteria 1526
381 nmdc:mga06r32_386057_c1 3300050510 Bacteria 1383
382 nmdc:mga06r32_60577_c1 3300050510 Bacteria 3643
383 nmdc:mga08y16_101427_c1 3300050511 Bacteria 2996
384 nmdc:mga08y16_234214_c1 3300050511 Unclassified 1899
385 nmdc:mga08y16_41470_c1 3300050511 Bacteria 4822
386 nmdc:mga0n895_12089_c1 3300050512 Bacteria 7725
387 nmdc:mga0n895_128304_c1 3300050512 Bacteria 2561
388 nmdc:mga0n895_186_c1 3300050512 Bacteria 38327
389 nmdc:mga0n895_70286_c1 3300050512 Bacteria 3470
390 nmdc:mga0n895_78012_c1 3300050512 Bacteria 3296
391 nmdc:mga0n895_88813_c1 3300050512 Bacteria 3091
392 nmdc:mga0rr50_12991_c1 3300050513 Bacteria 5404
393 nmdc:mga0rr50_185653_c1 3300050513 Bacteria 1702
394 nmdc:mga0rr50_3380_c1 3300050513 Bacteria 9169
395 nmdc:mga0rr50_36764_c1 3300050513 Bacteria 3529
396 nmdc:mga0rr50_62496_c1 3300050513 Bacteria 2810
397 nmdc:mga0rr50_629_c1 3300050513 Bacteria 18926
398 nmdc:mga0rr50_6480_c1 3300050513 Bacteria 7131
399 nmdc:mga08x19_2032_c1 3300050514 Bacteria 12404
400 nmdc:mga08x19_36938_c1 3300050514 Bacteria 3097
401 nmdc:mga08x19_46701_c1 3300050514 Bacteria 2770
402 nmdc:mga08x19_74863_c1 3300050514 Bacteria 2213
403 nmdc:mga0a205_135223_c1 3300050515 Bacteria 2366
404 nmdc:mga0a205_14767_c1 3300050515 Bacteria 6873
405 nmdc:mga0a205_198_c1 3300050515 Bacteria 41752
406 nmdc:mga0a205_267202_c1 3300050515 Bacteria 1588
407 nmdc:mga0a205_276626_c1 3300050515 Bacteria 1555
408 nmdc:mga0a205_38164_c1 3300050515 Bacteria 4621
409 nmdc:mga0a205_4159_c1 3300050515 Bacteria 12967
410 nmdc:mga0a205_47992_c1 3300050515 Bacteria 4121
411 Ga0501084_0015963 3300054114 Bacteria 6232
412 Ga0501084_0023468 3300054114 Bacteria 5147
413 Ga0501084_0046368 3300054114 Bacteria 3641
414 Ga0501082_0005783 3300060353 Bacteria 10731
415 Ga0501082_0024317 3300060353 Bacteria 5222
416 Ga0501082_0167370 3300060353 Bacteria 1910
417 Ga0530510_0001170 3300061734 Bacteria 17428
418 Ga0530510_0001217 3300061734 Bacteria 17190
419 Ga0530510_0053222 3300061734 Bacteria 2926
420 Ga0530510_0123518 3300061734 Bacteria 1902
421 Ga0530510_0154579 3300061734 Bacteria 1695
422 2508727510 2508501050 Bacteria 9633614
423 8045867346 8045864390 Bacteria 5043873
424 Ga0495621_0051369
425 JGI25406J46586_10016315
426 Ga0070683_100078017
427 Ga0070690_100186085
428 Ga0070670_100004645
429 Ga0070670_100013818
430 Ga0068869_100001452
431 Ga0068869_100083798
432 Ga0068869_100123458
433 Ga0070666_10090322
434 Ga0070680_100011658
435 Ga0070682_100002509
436 Ga0070660_100016239
437 Ga0070689_100027061
438 Ga0070691_10003047
439 Ga0070691_10015614
440 Ga0070661_100023730
441 Ga0070692_10002198
442 Ga0070668_100009121
443 Ga0070669_100028792
444 Ga0070669_100035470
445 Ga0070674_100289102
446 Ga0070673_100027608
447 Ga0070688_100061009
448 Ga0070659_100000377
449 Ga0070703_10006396
450 Ga0070713_100056037
451 Ga0070701_10006518
452 Ga0070701_10014965
453 Ga0070701_10099002
454 Ga0070705_100009495
455 Ga0070700_100020135
456 Ga0070694_100032698
457 Ga0070708_100014332
458 Ga0070708_100037746
459 Ga0070708_100047472
460 Ga0070708_100066444
461 Ga0070708_100140076
462 Ga0070708_100200539
463 Ga0070663_100001821
464 Ga0070678_100023444
465 Ga0070678_100057376
466 Ga0070662_100007534
467 Ga0070681_10021724
468 Ga0070681_10078947
469 Ga0070681_10157715
470 Ga0068867_100003302
471 Ga0068867_100014150
472 Ga0068867_100092123
473 Ga0070706_100013791
474 Ga0070706_100049412
475 Ga0070706_100127002
476 Ga0070706_100190304
477 Ga0070706_100363544
478 Ga0070707_100002180
479 Ga0070707_100016652
480 Ga0070707_100019107
481 Ga0070707_100059173
482 Ga0070707_100114956
483 Ga0070707_100146863
484 Ga0070698_100001010
485 Ga0070698_100004229
486 Ga0070698_100057246
487 Ga0070698_100065735
488 Ga0070698_100095682
489 Ga0070699_100002611
490 Ga0070699_100008788
491 Ga0070679_100021385
492 Ga0070697_100028318
493 Ga0070697_100030636
494 Ga0070697_100043773
495 Ga0070697_100151817
496 Ga0068853_100012895
497 Ga0070672_100033462
498 Ga0070686_100054527
499 Ga0070695_100002346
500 Ga0070695_100040087
501 Ga0070696_100002742
502 Ga0070696_100047989
503 Ga0070693_100000929
504 Ga0070693_100129032
505 Ga0070665_100008084
506 Ga0070704_100006964
507 Ga0070704_100024745
508 Ga0070704_100050215
509 Ga0068855_100006654
510 Ga0070664_100160066
511 Ga0070664_100218588
512 Ga0070664_100243031
513 Ga0068857_100033329
514 Ga0068857_100048685
515 Ga0068854_100008989
516 Ga0068856_100001687
517 Ga0068856_100128838
518 Ga0068852_100093674
519 Ga0068859_100007912
520 Ga0068859_100039159
521 Ga0068859_100381636
522 Ga0068864_100015072
523 Ga0068866_10002306
524 Ga0068861_100054895
525 Ga0068870_10001427
526 Ga0068870_10015890
527 Ga0068863_100051268
528 Ga0068863_100164786
529 Ga0068863_100274804
530 Ga0068858_100016518
531 Ga0068858_100042880
532 Ga0068860_100013265
533 Ga0068860_100035345
534 Ga0068862_100013621
535 Ga0068862_100016348
536 Ga0068862_100018122
537 Ga0068862_100223302
538 Ga0081539_10000020
539 Ga0081539_10066305
540 Ga0070717_10107012
541 Ga0097621_100033667
542 Ga0068871_100062440
543 Ga0075428_100019877
544 Ga0075428_100364531
545 Ga0075430_100001918
546 Ga0075431_100006917
547 Ga0075431_100012693
548 Ga0075431_100069245
549 Ga0075431_100087885
550 Ga0075431_100126719
551 Ga0075431_100388185
552 Ga0075433_10000319
553 Ga0075433_10000948
554 Ga0075433_10099341
555 Ga0075434_100000404
556 Ga0075434_100043691
557 Ga0075434_100223751
558 Ga0075434_100337622
559 Ga0075434_100393588
560 Ga0075434_100435018
561 Ga0075429_100022735
562 Ga0075429_100080143
563 Ga0075429_100080595
564 Ga0075429_100154915
565 Ga0075429_100209229
566 Ga0075429_100245613
567 Ga0068865_100011487
568 Ga0075436_100000794
569 Ga0075436_100059172
570 Ga0075436_100062974
571 Ga0097620_100007912
572 Ga0097620_100039158
573 Ga0097620_100381609
574 Ga0075435_100002255
575 Ga0075435_100005866
576 Ga0075435_100011023
577 Ga0075435_100025455
578 Ga0099794_10005722
579 Ga0099795_10006587
580 Ga0111539_10009439
581 Ga0111539_10015922
582 Ga0111539_10019508
583 Ga0114129_10000541
584 Ga0114129_10002669
585 Ga0114129_10002813
586 Ga0114129_10007717
587 Ga0114129_10014072
588 Ga0114129_10561614
589 Ga0105248_10047162
590 Ga0105248_10260580
591 Ga0105249_10368311
592 Ga0105246_10018554
593 Ga0157373_10015577
594 Ga0157369_10010014
595 Ga0157374_10301409
596 Ga0163162_10647624
597 Ga0157372_10000646
598 Ga0157375_10166539
599 Ga0157375_10193589
600 Ga0157380_10059685
601 Ga0182008_10055546
602 Ga0157379_10121286
603 Ga0163161_10067426
604 Ga0163161_10275178
605 Ga0213875_10000755
606 Ga0213871_10005735
607 Ga0207653_10004309
608 Ga0207653_10009269
609 Ga0207688_10003821
610 Ga0207688_10023301
611 Ga0207680_10042300
612 Ga0207647_10047460
613 Ga0207699_10005641
614 Ga0207699_10144291
615 Ga0207645_10003896
616 Ga0207645_10010845
617 Ga0207643_10000355
618 Ga0207643_10009641
619 Ga0207684_10001301
620 Ga0207684_10014343
621 Ga0207684_10023833
622 Ga0207684_10025457
623 Ga0207684_10078372
624 Ga0207684_10110211
625 Ga0207654_10007146
626 Ga0207707_10000047
627 Ga0207707_10027568
628 Ga0207660_10048966
629 Ga0207662_10020651
630 Ga0207662_10180307
631 Ga0207657_10000021
632 Ga0207649_10021028
633 Ga0207652_10042855
634 Ga0207646_10001330
635 Ga0207646_10001785
636 Ga0207646_10010669
637 Ga0207646_10035268
638 Ga0207646_10056416
639 Ga0207681_10191395
640 Ga0207681_10297315
641 Ga0207650_10030625
642 Ga0207650_10109826
643 Ga0207700_10022663
644 Ga0207664_10006264
645 Ga0207690_10000789
646 Ga0207706_10016654
647 Ga0207709_10011171
648 Ga0207709_10166663
649 Ga0207670_10132762
650 Ga0207665_10000411
651 Ga0207665_10015550
652 Ga0207691_10023772
653 Ga0207689_10000697
654 Ga0207689_10032358
655 Ga0207689_10036916
656 Ga0207661_10080777
657 Ga0207679_10004712
658 Ga0207679_10028623
659 Ga0207679_10149787
660 Ga0207667_10000620
661 Ga0207651_10031312
662 Ga0207651_10058815
663 Ga0207640_10068509
664 Ga0207677_10133747
665 Ga0207703_10015250
666 Ga0207639_10042501
667 Ga0207678_10007778
668 Ga0207708_10020587
669 Ga0207708_10075760
670 Ga0207702_10009066
671 Ga0207702_10049264
672 Ga0207641_10018246
673 Ga0207641_10080235
674 Ga0207641_10223569
675 Ga0207641_10252234
676 Ga0207648_10001227
677 Ga0207648_10171913
678 Ga0207648_10337882
679 Ga0207676_10015486
680 Ga0207676_10021716
681 Ga0207676_10179947
682 Ga0207676_10232303
683 Ga0207674_10042446
684 Ga0207674_10112021
685 Ga0207674_10265887
686 Ga0207674_10293473
687 Ga0207675_100053855
688 Ga0207675_100064101
689 Ga0207675_100088331
690 Ga0207675_100153501
691 Ga0209588_1002397
692 Ga0207428_10000029
693 Ga0207428_10047823
694 Ga0207428_10181689
695 Ga0268265_10001200
696 Ga0268265_10048595
697 Ga0268264_10077096
698 Ga0265318_10011943
699 Ga0265330_10007808
700 Ga0265332_10002055
701 Ga0265328_10002786
702 Ga0265320_10093129
703 Ga0265331_10002356
704 Ga0265327_10062581
705 Ga0265314_10004077
706 Ga0265342_10024638
707 Ga0307410_10133934
708 Ga0307416_100065186
709 Ga0307411_10269011
710 Ga0373932_0026638
711 Ga0373939_0032179
712 Ga0373931_0036893
713 Ga0373931_0038100
714 Ga0373935_0108887
715 Ga0373927_0236361
716 Ga0395899_0035751
717 Ga0395900_0001429
718 Ga0395900_0036108
719 Ga0395898_0010686
720 Ga0436364_0572636
721 Ga0436364_1119186
722 Ga0436365_0015172
723 Ga0439448_0012291
724 Ga0439455_0003931
725 Ga0439455_0019613
726 Ga0450889_000713
727 Ga0439458_0016440
728 Ga0451577_0019760
729 Ga0451577_0102879
730 Ga0453683_0039465
731 Ga0453683_0059833
732 Ga0453684_0075215
733 Ga0451576_0011896
734 Ga0451576_0031213
735 Ga0451576_0179653
736 Ga0451576_0219726
737 Ga0495580_0004319
738 Ga0495580_0236133
739 Ga0495584_0125817
740 Ga0495656_0125761
741 Ga0495669_0042868
742 Ga0495669_0108100
743 Ga0496101_0091987
744 Ga0496102_0132817
745 Ga0496104_0002880
746 Ga0496106_0035395
747 Ga0496106_0123371
748 Ga0496108_0031126
749 Ga0496112_0021385
750 Ga0496112_0152426
751 Ga0496112_0276040
752 Ga0496115_0009533
753 Ga0501036_0061832
754 Ga0501038_0339134
755 Ga0501039_0032330
756 Ga0501039_0065246
757 Ga0501040_0035157
758 Ga0501040_0040719
759 Ga0501040_0062505
760 Ga0501041_0002039
761 Ga0501041_0007275
762 Ga0501041_0007621
763 Ga0501042_0005859
764 Ga0501042_0031531
765 Ga0501048_0087573
766 Ga0501071_0029229
767 Ga0501072_0022676
768 Ga0501072_0137189
769 Ga0501074_0095914
770 Ga0501074_0146192
771 Ga0501075_0016369
772 Ga0501075_0027053
773 Ga0501076_0009780
774 Ga0501076_0087415
775 Ga0501076_0152525
776 Ga0501076_0343150
777 Ga0501077_0009909
778 Ga0501077_0091333
779 Ga0501077_0102128
780 Ga0501079_0037980
781 Ga0501079_0190773
782 Ga0501079_0194807
783 Ga0501080_0004563
784 Ga0501081_0003238
785 Ga0501081_0005929
786 Ga0501081_0122495
787 Ga0501045_0111664
788 nmdc:mga05p37_176721_c1
789 nmdc:mga05p37_24894_c1
790 nmdc:mga05p37_553055_c1
791 nmdc:mga05p37_702_c1
792 nmdc:mga05p37_783_c1
793 nmdc:mga09592_137611_c1
794 nmdc:mga09592_191560_c1
795 nmdc:mga09592_34341_c1
796 nmdc:mga09592_59845_c1
797 nmdc:mga09592_82157_c1
798 nmdc:mga0qj67_12482_c1
799 nmdc:mga0qj67_47603_c1
800 nmdc:mga06r32_113184_c1
801 nmdc:mga06r32_125770_c1
802 nmdc:mga06r32_1728_c1
803 nmdc:mga06r32_323913_c1
804 nmdc:mga06r32_386057_c1
805 nmdc:mga06r32_60577_c1
806 nmdc:mga08y16_101427_c1
807 nmdc:mga08y16_234214_c1
808 nmdc:mga08y16_41470_c1
809 nmdc:mga0n895_12089_c1
810 nmdc:mga0n895_128304_c1
811 nmdc:mga0n895_186_c1
812 nmdc:mga0n895_70286_c1
813 nmdc:mga0n895_78012_c1
814 nmdc:mga0n895_88813_c1
815 nmdc:mga0rr50_12991_c1
816 nmdc:mga0rr50_185653_c1
817 nmdc:mga0rr50_3380_c1
818 nmdc:mga0rr50_36764_c1
819 nmdc:mga0rr50_62496_c1
820 nmdc:mga0rr50_629_c1
821 nmdc:mga0rr50_6480_c1
822 nmdc:mga08x19_2032_c1
823 nmdc:mga08x19_36938_c1
824 nmdc:mga08x19_46701_c1
825 nmdc:mga08x19_74863_c1
826 nmdc:mga0a205_135223_c1
827 nmdc:mga0a205_14767_c1
828 nmdc:mga0a205_198_c1
829 nmdc:mga0a205_267202_c1
830 nmdc:mga0a205_276626_c1
831 nmdc:mga0a205_38164_c1
832 nmdc:mga0a205_4159_c1
833 nmdc:mga0a205_47992_c1
834 Ga0501084_0015963
835 Ga0501084_0023468
836 Ga0501084_0046368
837 Ga0501082_0005783
838 Ga0501082_0024317
839 Ga0501082_0167370
840 Ga0530510_0001170
841 Ga0530510_0001217
842 Ga0530510_0053222
843 Ga0530510_0123518
844 Ga0530510_0154579
845 2508727510
846 8045867346

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

1

85

0.98

PF13378

MR_MLE_C

Enolase C-terminal domain-like

232

445

0.95

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

88

209

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h83-assembly1.cif.gz_E crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9656 4 371
4h83-assembly1.cif.gz_A crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9643 4 370
3no1-assembly1.cif.gz_C crystal structure of mandelate racemase/muconate lactonizing enzyme from a marine actinobacterium in complex with magnesium 0.9642 4 371
4h83-assembly1.cif.gz_F crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9631 4 371
4h83-assembly3.cif.gz_C crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.9625 4 371
ID Description Score Start End Superfamily
3no1D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9522 124 361 3.20.20.120
3no1D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9402 124 361 3.20.20.120
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9345 124 361 3.20.20.120
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9233 122 361 3.20.20.120
5xd9A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9215 122 361 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A2V6VDW9-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9805 168 370 GO:0000287
GO:0016052
GO:0016836
AF-A0A2V6VDW9-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9758 168 370 GO:0000287
GO:0016052
GO:0016836
AF-A0A2E6Z135-F1-model_v4 Mandelate racemase 0.9746 4 371 GO:0000287
GO:0016052
GO:0016836
AF-A0A2V2SJ55-F1-model_v4 deleted 0.9741 31 371
AF-A0A2W6B1A8-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein 0.9725 136 371 GO:0000287
GO:0009063
GO:0016052
GO:0016836

Map