F440574

General Info

Members Datasets Scaffolds Average Seq Length
423 237 412 428

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_1197910|Ga0451853_1197910_758_2218
Length 486
Sequence LIPVFVPAFAIFLSQKAFMYSDYEALFSFAVSRFTLPLDDSRTQRVKNSNLRTKFVSMTIEQLYEIYRQYPSVQTDTRKLKTGDIFFALKGPNFNGNQFAPAALAAGSAYAVVDEAPATPDSRIIVVEDVLTTLQQLAKYHRQQFTIPFIAITGSNGKTTTKELVYAVLSAGYKTYTTQGNLNNHIGIPLTILSVKPDAEMAVIEMGANHLREIASYCEYTLPTHGIITNCGKAHLEGFGSIEGVRKGKGELYDHLRAHDGTAFVMWDYDYLQTMSTGIPTVVKYGTTDAADIQGTVQQSEPFLTVAISKGAALPVIQTQLVGSYNLPNVLVAVTTGKFFKVPDEKIRSAIENYTPSNSRSQLIEKNGNKFILDAYNANPTSMKLAIENFAGIQASNKVLMLGGMAELGHESLQEHKAIIDLIKQHSWKAVVLVGGDFMKIDHPYIKMSNSTEAAQWFTDQSFNDTYFLIKGSRSMQMEKVIPPAP

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
3 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
4 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
5 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
6 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
7 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
8 2914759650 Rhizosphaericola mali Isolate Rhizosphere
9 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
21 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
101 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
163 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
164 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
174 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
181 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
186 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
204 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
205 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
206 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
207 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
208 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
209 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
212 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
213 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
214 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
215 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
225 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
226 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
227 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
228 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
229 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
230 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
236 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
237 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.93
Nodule 0
Rhizoplane 0.47
Rhizosphere 83.45
Stem 0
Stem Tuber 0
Unclassified 6.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1002098 3300001904 Bacteria 3539
2 JGI24740J21852_10002536 3300001979 Bacteria 8243
3 JGI24739J22299_10000257 3300001989 Bacteria 17846
4 JGI24751J29686_10001389 3300002459 Bacteria 5085
5 JGI25154J39366_1000002 3300002738 Bacteria 466942
6 JGI25153J46596_10000187 3300003215 Bacteria 60030
7 JGI25153J46596_10010451 3300003215 Bacteria 4195
8 rootH2_10001992 3300003320 Bacteria 27353
9 rootH2_10041059 3300003320 Bacteria 8625
10 rootH2_10120975 3300003320 Bacteria 4752
11 rootL2_10069792 3300003322 Bacteria 2570
12 rootL2_10074125 3300003322 Bacteria 3798
13 rootL2_10306438 3300003322 Bacteria 2088
14 rootH1_10014859 3300003323 Bacteria 7780
15 rootH1_10062620 3300003323 Bacteria 10973
16 rootH1_10092435 3300003323 Bacteria 2519
17 rootH1_10136000 3300003323 Bacteria 5487
18 JGI25160J50197_1000943 3300003354 Bacteria 15255
19 Ga0055535_1002788 3300003761 Bacteria 5577
20 Ga0055528_1000338 3300003790 Bacteria 39174
21 Ga0055530_10001956 3300003791 Bacteria 14038
22 Ga0055531_10000014 3300003794 Bacteria 184532
23 Ga0065165_1000100 3300005262 Bacteria 141963
24 Ga0065704_10075692 3300005289 Bacteria 5460
25 Ga0065712_10002957 3300005290 Bacteria 6775
26 Ga0065712_10081218 3300005290 Bacteria 3028
27 Ga0065712_10081948 3300005290 Bacteria 2961
28 Ga0070658_10004172 3300005327 Bacteria 11824
29 Ga0070658_10004224 3300005327 Bacteria 11752
30 Ga0070676_10026113 3300005328 Bacteria 3306
31 Ga0070683_100000106 3300005329 Bacteria 54661
32 Ga0070670_100004569 3300005331 Bacteria 11610
33 Ga0070670_100040978 3300005331 Bacteria 3980
34 Ga0068869_100014774 3300005334 Bacteria 5222
35 Ga0068869_100071809 3300005334 Bacteria 2564
36 Ga0070666_10000038 3300005335 Bacteria 115799
37 Ga0070666_10000431 3300005335 Bacteria 25787
38 Ga0070682_100000005 3300005337 Bacteria 386439
39 Ga0068868_100006700 3300005338 Bacteria 8173
40 Ga0068868_100008228 3300005338 Bacteria 7464
41 Ga0070660_100000295 3300005339 Bacteria 33225
42 Ga0070689_100012836 3300005340 Bacteria 6048
43 Ga0070689_100047840 3300005340 Bacteria 3298
44 Ga0070687_100015390 3300005343 Bacteria 3459
45 Ga0070668_100000016 3300005347 Bacteria 104092
46 Ga0070668_100018828 3300005347 Bacteria 5187
47 Ga0070668_100091284 3300005347 Bacteria 2401
48 Ga0070669_100018500 3300005353 Bacteria 4979
49 Ga0070669_100124748 3300005353 Unclassified 1969
50 Ga0070674_100012744 3300005356 Bacteria 5173
51 Ga0070673_100000074 3300005364 Bacteria 42660
52 Ga0070688_100053553 3300005365 Bacteria 2524
53 Ga0070688_100063609 3300005365 Bacteria 2339
54 Ga0070659_100005770 3300005366 Bacteria 8910
55 Ga0070667_100000031 3300005367 Bacteria 177447
56 Ga0070667_100009794 3300005367 Bacteria 7946
57 Ga0070667_100065714 3300005367 Bacteria 3080
58 Ga0070667_100106327 3300005367 Bacteria 2429
59 Ga0070678_100190170 3300005456 Unclassified 1687
60 Ga0070662_100010182 3300005457 Bacteria 6165
61 Ga0070662_100183811 3300005457 Bacteria 1649
62 Ga0068867_100002817 3300005459 Bacteria 12223
63 Ga0070685_10044211 3300005466 Bacteria 2549
64 Ga0070685_10066503 3300005466 Bacteria 2124
65 Ga0070698_100003140 3300005471 Bacteria 18206
66 Ga0070698_100003376 3300005471 Bacteria 17567
67 Ga0070698_100021248 3300005471 Bacteria 6800
68 Ga0070684_100000083 3300005535 Bacteria 61611
69 Ga0068853_100002162 3300005539 Bacteria 14638
70 Ga0070672_100000002 3300005543 Bacteria 159809
71 Ga0070665_100000002 3300005548 Bacteria 849037
72 Ga0070665_100000222 3300005548 Bacteria 94961
73 Ga0068855_100031650 3300005563 Bacteria 6317
74 Ga0068855_100052791 3300005563 Bacteria 4785
75 Ga0068857_100039098 3300005577 Bacteria 4201
76 Ga0068856_100022359 3300005614 Bacteria 6147
77 Ga0068856_100175743 3300005614 Bacteria 2153
78 Ga0068852_100022105 3300005616 Bacteria 5094
79 Ga0068852_100028536 3300005616 Bacteria 4570
80 Ga0068852_100034563 3300005616 Bacteria 4207
81 Ga0068852_100106141 3300005616 Bacteria 2546
82 Ga0068859_100000007 3300005617 Bacteria 390070
83 Ga0068859_100003007 3300005617 Bacteria 17097
84 Ga0068859_100010163 3300005617 Bacteria 9477
85 Ga0068859_100021113 3300005617 Bacteria 6534
86 Ga0068864_100002308 3300005618 Bacteria 15782
87 Ga0068864_100027310 3300005618 Bacteria 4819
88 Ga0068864_100036488 3300005618 Bacteria 4190
89 Ga0068864_100051620 3300005618 Bacteria 3543
90 Ga0068864_100089029 3300005618 Bacteria 2719
91 Ga0068861_100018084 3300005719 Bacteria 5013
92 Ga0068861_100023480 3300005719 Bacteria 4448
93 Ga0068861_100091719 3300005719 Bacteria 2399
94 Ga0068861_100164968 3300005719 Bacteria 1831
95 Ga0068851_10000266 3300005834 Bacteria 24602
96 Ga0068863_100006676 3300005841 Bacteria 11327
97 Ga0068863_100011953 3300005841 Bacteria 8389
98 Ga0068863_100162256 3300005841 Bacteria 2142
99 Ga0068858_100001512 3300005842 Bacteria 23886
100 Ga0068858_100002116 3300005842 Bacteria 20141
101 Ga0068860_100000153 3300005843 Bacteria 112147
102 Ga0068860_100005736 3300005843 Bacteria 12522
103 Ga0068860_100006636 3300005843 Bacteria 11621
104 Ga0068860_100087203 3300005843 Bacteria 2971
105 Ga0068862_100007671 3300005844 Bacteria 8930
106 Ga0068862_100239332 3300005844 Bacteria 1649
107 Ga0081540_1009809 3300005983 Bacteria 6552
108 Ga0075366_10008814 3300006195 Bacteria 5619
109 Ga0075366_10036514 3300006195 Bacteria 2898
110 Ga0097621_100020168 3300006237 Bacteria 5134
111 Ga0097621_100029195 3300006237 Bacteria 4354
112 Ga0097621_100038945 3300006237 Bacteria 3816
113 Ga0068871_100002241 3300006358 Bacteria 13141
114 Ga0068871_100002443 3300006358 Bacteria 12694
115 Ga0075431_100013446 3300006847 Bacteria 8267
116 Ga0075431_100081904 3300006847 Bacteria 3332
117 Ga0075429_100004456 3300006880 Bacteria 12047
118 Ga0075429_100061118 3300006880 Bacteria 3281
119 Ga0068865_100001410 3300006881 Bacteria 14005
120 Ga0097620_100000007 3300006931 Bacteria 390070
121 Ga0097620_100003007 3300006931 Bacteria 17097
122 Ga0097620_100010163 3300006931 Bacteria 9477
123 Ga0097620_100021113 3300006931 Bacteria 6534
124 Ga0105240_10000047 3300009093 Bacteria 239067
125 Ga0105240_10001289 3300009093 Bacteria 43373
126 Ga0105240_10001361 3300009093 Bacteria 41976
127 Ga0105240_10109990 3300009093 Bacteria 3336
128 Ga0111539_10071489 3300009094 Bacteria 4094
129 Ga0111539_10323993 3300009094 Unclassified 1793
130 Ga0111539_10379110 3300009094 Bacteria 1647
131 Ga0105245_10041764 3300009098 Bacteria 4089
132 Ga0105247_10000702 3300009101 Bacteria 26164
133 Ga0105247_10005964 3300009101 Bacteria 7592
134 Ga0105247_10009108 3300009101 Bacteria 6042
135 Ga0114129_10005818 3300009147 Bacteria 17462
136 Ga0105241_10003349 3300009174 Bacteria 11935
137 Ga0105241_10032013 3300009174 Bacteria 3938
138 Ga0105241_10181847 3300009174 Bacteria 1745
139 Ga0105242_10012958 3300009176 Bacteria 6429
140 Ga0105242_10026160 3300009176 Bacteria 4624
141 Ga0105242_10095452 3300009176 Bacteria 2510
142 Ga0105237_10002631 3300009545 Bacteria 22095
143 Ga0105237_10005717 3300009545 Bacteria 13978
144 Ga0105237_10006835 3300009545 Bacteria 12575
145 Ga0105237_10143404 3300009545 Bacteria 2383
146 Ga0105249_10000769 3300009553 Bacteria 28707
147 Ga0105249_10001060 3300009553 Bacteria 24381
148 Ga0105249_10001119 3300009553 Bacteria 23864
149 Ga0105249_10002666 3300009553 Bacteria 15430
150 Ga0105249_10002912 3300009553 Bacteria 14766
151 Ga0105249_10014757 3300009553 Bacteria 6905
152 Ga0105249_10029768 3300009553 Bacteria 4933
153 Ga0105239_10001102 3300010375 Bacteria 37330
154 Ga0105239_10003353 3300010375 Bacteria 19678
155 Ga0105239_10003716 3300010375 Bacteria 18578
156 Ga0105239_10029822 3300010375 Bacteria 5999
157 Ga0105239_10037394 3300010375 Bacteria 5322
158 Ga0105239_10059542 3300010375 Bacteria 4192
159 Ga0105239_10153836 3300010375 Bacteria 2568
160 Ga0105246_10009985 3300011119 Bacteria 5857
161 Ga0157370_10287844 3300013104 Bacteria 1518
162 Ga0157369_10040640 3300013105 Bacteria 5077
163 Ga0157374_10000013 3300013296 Bacteria 461240
164 Ga0157374_10000074 3300013296 Bacteria 99947
165 Ga0157374_10145853 3300013296 Bacteria 2299
166 Ga0157374_10273775 3300013296 Bacteria 1665
167 Ga0157378_10001264 3300013297 Bacteria 22767
168 Ga0157378_10211077 3300013297 Unclassified 1841
169 Ga0163162_10000029 3300013306 Bacteria 168510
170 Ga0163162_10000970 3300013306 Bacteria 26653
171 Ga0163162_10003598 3300013306 Bacteria 14838
172 Ga0163162_10011551 3300013306 Bacteria 8615
173 Ga0163162_10013425 3300013306 Bacteria 7997
174 Ga0163162_10050100 3300013306 Bacteria 4187
175 Ga0157372_10004138 3300013307 Bacteria 15533
176 Ga0157372_10033207 3300013307 Bacteria 5666
177 Ga0157372_10270412 3300013307 Bacteria 1975
178 Ga0157375_10000042 3300013308 Bacteria 160008
179 Ga0157375_10005779 3300013308 Bacteria 10762
180 Ga0157375_10474056 3300013308 Bacteria 1417
181 Ga0163163_10000076 3300014325 Bacteria 108784
182 Ga0163163_10108034 3300014325 Bacteria 2809
183 Ga0157380_10000796 3300014326 Bacteria 19825
184 Ga0157380_10000855 3300014326 Bacteria 19105
185 Ga0157380_10061627 3300014326 Bacteria 3002
186 Ga0157380_10184400 3300014326 Unclassified 1837
187 Ga0157377_10006062 3300014745 Bacteria 5736
188 Ga0157379_10000016 3300014968 Bacteria 103230
189 Ga0157376_10000067 3300014969 Bacteria 83894
190 Ga0157376_10055183 3300014969 Bacteria 3315
191 Ga0163161_10013566 3300017792 Bacteria 5673
192 Ga0163161_10067603 3300017792 Bacteria 2610
193 Ga0163161_10088981 3300017792 Bacteria 2283
194 Ga0209258_100029 3300025242 Bacteria 490648
195 Ga0209646_1000005 3300025246 Bacteria 717627
196 Ga0209646_1002193 3300025246 Bacteria 4509
197 Ga0209026_1000587 3300025250 Bacteria 23729
198 Ga0209148_1000089 3300025254 Bacteria 253548
199 Ga0209673_1000049 3300025273 Bacteria 286207
200 Ga0209564_1004571 3300025295 Bacteria 8382
201 Ga0209758_1000346 3300025297 Bacteria 84821
202 Ga0209758_1006396 3300025297 Bacteria 8483
203 Ga0209758_1047055 3300025297 Bacteria 1548
204 Ga0209050_1000272 3300025298 Bacteria 110636
205 Ga0207426_1000536 3300025302 Bacteria 54323
206 Ga0207426_1001075 3300025302 Bacteria 25593
207 Ga0209257_1000004 3300025304 Bacteria 1678347
208 Ga0209257_1005429 3300025304 Bacteria 8959
209 Ga0207656_10002125 3300025321 Bacteria 6622
210 Ga0207656_10027993 3300025321 Bacteria 2310
211 Ga0207710_10000975 3300025900 Bacteria 15053
212 Ga0207710_10018629 3300025900 Bacteria 2954
213 Ga0207680_10000015 3300025903 Bacteria 138253
214 Ga0207680_10004520 3300025903 Bacteria 6599
215 Ga0207647_10000088 3300025904 Bacteria 70267
216 Ga0207645_10003999 3300025907 Bacteria 10993
217 Ga0207645_10039520 3300025907 Bacteria 3023
218 Ga0207705_10003723 3300025909 Bacteria 11605
219 Ga0207705_10017370 3300025909 Bacteria 5153
220 Ga0207654_10008231 3300025911 Bacteria 5264
221 Ga0207654_10101932 3300025911 Bacteria 1770
222 Ga0207695_10000010 3300025913 Bacteria 981919
223 Ga0207695_10000361 3300025913 Bacteria 104230
224 Ga0207695_10000431 3300025913 Bacteria 91965
225 Ga0207695_10001348 3300025913 Bacteria 41610
226 Ga0207695_10060008 3300025913 Bacteria 3941
227 Ga0207671_10002899 3300025914 Bacteria 17715
228 Ga0207671_10005104 3300025914 Bacteria 12244
229 Ga0207671_10118627 3300025914 Bacteria 2021
230 Ga0207662_10034956 3300025918 Bacteria 2934
231 Ga0207657_10001629 3300025919 Bacteria 24192
232 Ga0207650_10028644 3300025925 Bacteria 3996
233 Ga0207650_10033332 3300025925 Bacteria 3730
234 Ga0207650_10149270 3300025925 Bacteria 1843
235 Ga0207659_10019943 3300025926 Bacteria 4423
236 Ga0207690_10053676 3300025932 Bacteria 2706
237 Ga0207706_10015868 3300025933 Bacteria 6809
238 Ga0207686_10002586 3300025934 Bacteria 9824
239 Ga0207670_10003567 3300025936 Bacteria 8263
240 Ga0207670_10009226 3300025936 Bacteria 5615
241 Ga0207669_10075141 3300025937 Bacteria 2140
242 Ga0207704_10001983 3300025938 Bacteria 9175
243 Ga0207691_10000004 3300025940 Bacteria 168729
244 Ga0207689_10006920 3300025942 Bacteria 9975
245 Ga0207689_10038591 3300025942 Bacteria 3955
246 Ga0207689_10054389 3300025942 Bacteria 3296
247 Ga0207661_10000054 3300025944 Bacteria 88056
248 Ga0207667_10004643 3300025949 Bacteria 16844
249 Ga0207667_10010495 3300025949 Bacteria 10826
250 Ga0207651_10000456 3300025960 Bacteria 17226
251 Ga0207651_10011503 3300025960 Bacteria 4958
252 Ga0207651_10024581 3300025960 Bacteria 3729
253 Ga0207712_10001318 3300025961 Bacteria 17023
254 Ga0207712_10002570 3300025961 Bacteria 11667
255 Ga0207712_10003008 3300025961 Bacteria 10775
256 Ga0207712_10006689 3300025961 Bacteria 7268
257 Ga0207668_10000112 3300025972 Bacteria 58202
258 Ga0207668_10072816 3300025972 Bacteria 2460
259 Ga0207658_10000059 3300025986 Bacteria 121530
260 Ga0207658_10081098 3300025986 Bacteria 2487
261 Ga0207677_10002071 3300026023 Bacteria 10560
262 Ga0207703_10007561 3300026035 Bacteria 8615
263 Ga0207703_10073819 3300026035 Bacteria 2822
264 Ga0207639_10026251 3300026041 Bacteria 4232
265 Ga0207639_10136020 3300026041 Bacteria 2041
266 Ga0207702_10045382 3300026078 Bacteria 3697
267 Ga0207641_10000056 3300026088 Bacteria 170719
268 Ga0207641_10008158 3300026088 Bacteria 8665
269 Ga0207641_10018253 3300026088 Bacteria 5750
270 Ga0207641_10046070 3300026088 Bacteria 3675
271 Ga0207648_10001923 3300026089 Bacteria 22701
272 Ga0207648_10032768 3300026089 Bacteria 4585
273 Ga0207648_10136896 3300026089 Bacteria 2157
274 Ga0207648_10190564 3300026089 Bacteria 1817
275 Ga0207676_10008702 3300026095 Bacteria 7218
276 Ga0207676_10025096 3300026095 Bacteria 4420
277 Ga0207676_10037274 3300026095 Bacteria 3704
278 Ga0207676_10107625 3300026095 Bacteria 2326
279 Ga0207676_10163867 3300026095 Unclassified 1929
280 Ga0207674_10001712 3300026116 Bacteria 28070
281 Ga0207674_10005126 3300026116 Bacteria 15635
282 Ga0207674_10033982 3300026116 Bacteria 5333
283 Ga0207674_10060097 3300026116 Bacteria 3844
284 Ga0207675_100001037 3300026118 Bacteria 27537
285 Ga0207675_100002556 3300026118 Bacteria 18017
286 Ga0207675_100020494 3300026118 Bacteria 6163
287 Ga0207675_100072489 3300026118 Bacteria 3221
288 Ga0207683_10025706 3300026121 Bacteria 5078
289 Ga0207683_10203935 3300026121 Unclassified 1798
290 Ga0207698_10004577 3300026142 Bacteria 8443
291 Ga0207698_10040345 3300026142 Bacteria 3468
292 Ga0207698_10050508 3300026142 Bacteria 3173
293 Ga0207428_10013837 3300027907 Bacteria 7029
294 Ga0268266_10000022 3300028379 Bacteria 508060
295 Ga0268266_10004701 3300028379 Bacteria 12995
296 Ga0268265_10101836 3300028380 Bacteria 2321
297 Ga0268264_10000159 3300028381 Bacteria 152716
298 Ga0268264_10003138 3300028381 Bacteria 14321
299 Ga0268264_10004218 3300028381 Bacteria 12266
300 Ga0268264_10005645 3300028381 Bacteria 10603
301 Ga0307515_10000684 3300028794 Bacteria 78055
302 Ga0265327_10000010 3300031251 Bacteria 566817
303 Ga0307509_10301826 3300031507 Bacteria 1349
304 Ga0307510_10015354 3300033180 Bacteria 9053
305 Ga0373935_0057447 3300035692 Bacteria 2482
306 Ga0439436_0003662 3300041404 Bacteria 4686
307 Ga0451853_1197910 3300041512 Bacteria 2616
308 Ga0439431_0001162 3300041997 Bacteria 5747
309 Ga0439449_0011525 3300042007 Bacteria 3326
310 Ga0439449_0022650 3300042007 Bacteria 2352
311 Ga0439449_0071353 3300042007 Bacteria 1280
312 Ga0439457_002231 3300042014 Bacteria 5599
313 Ga0439457_004420 3300042014 Bacteria 3663
314 Ga0451577_0002869 3300042876 Bacteria 19808
315 Ga0466969_0000152 3300044656 Bacteria 37627
316 Ga0466969_0038014 3300044656 Bacteria 2425
317 Ga0466972_0000104 3300044658 Bacteria 73886
318 Ga0466972_0002005 3300044658 Bacteria 9972
319 Ga0466972_0011717 3300044658 Bacteria 4403
320 Ga0466965_0026621 3300044683 Bacteria 2804
321 Ga0466966_0000193 3300044684 Bacteria 40730
322 Ga0466961_0013482 3300044693 Bacteria 5235
323 Ga0453684_0005471 3300044712 Bacteria 25133
324 Ga0466968_0054168 3300044735 Bacteria 1719
325 Ga0466970_0097352 3300044765 Bacteria 1601
326 Ga0466957_0014002 3300044842 Bacteria 4664
327 Ga0466957_0052280 3300044842 Bacteria 2487
328 Ga0466959_0000016 3300045049 Bacteria 144600
329 Ga0466959_0011533 3300045049 Bacteria 6353
330 Ga0495638_0065845 3300046460 Bacteria 2229
331 Ga0495606_0032843 3300046507 Unclassified 3589
332 Ga0495648_0001257 3300046524 Bacteria 25300
333 Ga0495633_0000025 3300046558 Bacteria 218627
334 Ga0495668_0000108 3300046616 Bacteria 132593
335 Ga0495668_0006079 3300046616 Bacteria 7994
336 Ga0495611_0000101 3300046648 Bacteria 59066
337 Ga0495649_0015130 3300046694 Bacteria 4396
338 Ga0495672_0013065 3300047320 Bacteria 5747
339 Ga0495672_0045103 3300047320 Bacteria 2641
340 Ga0495687_008037 3300047443 Bacteria 6097
341 Ga0495686_0000010 3300047472 Bacteria 573229
342 Ga0495686_0000322 3300047472 Bacteria 79695
343 Ga0496108_0189620 3300048911 Bacteria 1782
344 Ga0496115_0186303 3300048918 Unclassified 1715
345 Ga0496121_0000008 3300048924 Bacteria 843593
346 Ga0501290_001609 3300049513 Bacteria 3043
347 Ga0501292_001849 3300049515 Bacteria 2653
348 Ga0501298_002833 3300049521 Bacteria 2658
349 Ga0501299_003377 3300049522 Unclassified 2308
350 Ga0501032_0009658 3300049569 Bacteria 6988
351 Ga0501033_0051494 3300049570 Bacteria 3052
352 Ga0501034_0029664 3300049571 Bacteria 5561
353 Ga0501034_0063339 3300049571 Bacteria 3711
354 Ga0501034_0142834 3300049571 Unclassified 2372
355 Ga0501036_0002554 3300049572 Bacteria 14316
356 Ga0501036_0202191 3300049572 Bacteria 1671
357 Ga0501038_0029241 3300049574 Bacteria 4886
358 Ga0501039_0060479 3300049575 Bacteria 2934
359 Ga0501043_0044168 3300049579 Unclassified 3503
360 Ga0501046_0012080 3300049580 Bacteria 7363
361 Ga0501047_0007092 3300049581 Bacteria 10523
362 Ga0501047_0023112 3300049581 Bacteria 5969
363 Ga0501047_0119477 3300049581 Bacteria 2518
364 Ga0501048_0004971 3300049582 Bacteria 10146
365 Ga0501067_0006644 3300049583 Bacteria 6417
366 Ga0501068_0059550 3300049584 Unclassified 2318
367 Ga0501073_0089224 3300049589 Unclassified 2143
368 Ga0501074_0014996 3300049590 Bacteria 5640
369 Ga0501201_000566 3300049651 Bacteria 3455
370 Ga0501207_001761 3300049654 Bacteria 2738
371 Ga0501217_000068 3300049661 Bacteria 12339
372 Ga0501223_000404 3300049663 Bacteria 10565
373 Ga0501240_000199 3300049673 Bacteria 4365
374 Ga0501243_000365 3300049675 Bacteria 5955
375 Ga0501251_003177 3300049681 Unclassified 1628
376 Ga0501257_025245 3300049686 Bacteria 1414
377 Ga0501259_001183 3300049688 Bacteria 4349
378 Ga0501261_001588 3300049690 Bacteria 2796
379 Ga0501219_000521 3300049703 Bacteria 5760
380 Ga0501221_001002 3300049704 Bacteria 4647
381 Ga0501241_004801 3300049758 Bacteria 2525
382 Ga0501035_0007292 3300049822 Bacteria 10347
383 Ga0501044_0012552 3300049823 Bacteria 9176
384 Ga0501044_0047789 3300049823 Bacteria 4425
385 Ga0501044_0060501 3300049823 Bacteria 3878
386 Ga0501284_00005 3300050005 Bacteria 164758
387 nmdc:mga0k408_88184_c1 3300050493 Bacteria 1822
388 nmdc:mga05p37_306281_c1 3300050507 Bacteria 1885
389 nmdc:mga05p37_3872_c1 3300050507 Bacteria 17505
390 nmdc:mga09592_109920_c1 3300050508 Bacteria 2365
391 nmdc:mga09592_167694_c1 3300050508 Bacteria 1898
392 nmdc:mga0qj67_5037_c1 3300050509 Bacteria 9603
393 nmdc:mga06r32_310042_c1 3300050510 Bacteria 1564
394 Ga0500578_0002185 3300053086 Bacteria 17132
395 Ga0500644_0000039 3300053088 Bacteria 78834
396 Ga0500646_0001356 3300053090 Bacteria 6502
397 Ga0500646_0008662 3300053090 Bacteria 2605
398 Ga0500646_0019636 3300053090 Bacteria 1789
399 Ga0500583_0000009 3300053092 Bacteria 160749
400 Ga0500583_0002527 3300053092 Bacteria 5521
401 Ga0500592_001769 3300053116 Bacteria 3497
402 Ga0500577_0000726 3300053142 Bacteria 8429
403 Ga0500589_040298 3300053147 Bacteria 2181
404 Ga0500616_0002253 3300053153 Bacteria 16431
405 Ga0500616_0004698 3300053153 Bacteria 9614
406 Ga0500622_0000151 3300053156 Bacteria 73392
407 Ga0500622_0001750 3300053156 Bacteria 16734
408 Ga0500622_0012266 3300053156 Bacteria 4646
409 Ga0500633_0000629 3300053160 Bacteria 5848
410 Ga0500636_0010079 3300053177 Bacteria 5505
411 Ga0500611_000004 3300053727 Bacteria 253326
412 Ga0500661_001081 3300055283 Bacteria 5134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026142 Ga0207698_10040345 Ga0207698_100403451 338
2 3300042007 Ga0439449_0071353 Ga0439449_0071353_190_1269 358
3 3300003320 rootH2_10120975 rootH2_101209754 384
4 3300049581 Ga0501047_0023112 Ga0501047_0023112_2863_4146 395
5 3300001979 JGI24740J21852_10002536 JGI24740J21852_1000253610 396
6 3300002738 JGI25154J39366_1000002 JGI25154J39366_1000002335 396
7 3300003215 JGI25153J46596_10000187 JGI25153J46596_1000018743 396
8 3300003323 rootH1_10014859 rootH1_1001485910 396
9 3300005471 Ga0070698_100003376 Ga0070698_1000033763 396
10 3300013306 Ga0163162_10013425 Ga0163162_100134253 396
11 3300025246 Ga0209646_1000005 Ga0209646_100000538 396
12 3300025250 Ga0209026_1000587 Ga0209026_10005873 396
13 3300025297 Ga0209758_1000346 Ga0209758_100034611 396
14 3300025302 Ga0207426_1000536 Ga0207426_100053635 396
15 3300005338 Ga0068868_100008228 Ga0068868_1000082284 398
16 3300005466 Ga0070685_10066503 Ga0070685_100665032 398
17 3300005841 Ga0068863_100162256 Ga0068863_1001622562 398
18 3300013297 Ga0157378_10001264 Ga0157378_100012642 398
19 3300014325 Ga0163163_10108034 Ga0163163_101080342 398
20 3300025321 Ga0207656_10027993 Ga0207656_100279931 398
21 3300025925 Ga0207650_10028644 Ga0207650_100286444 398
22 3300026088 Ga0207641_10046070 Ga0207641_100460704 398
23 3300026095 Ga0207676_10107625 Ga0207676_101076252 398
24 3300049703 Ga0501219_000521 Ga0501219_000521_1440_2714 398
25 3300049758 Ga0501241_004801 Ga0501241_004801_773_2047 398
26 3300050005 Ga0501284_00005 Ga0501284_00005_21473_22747 398
27 3300009094 Ga0111539_10323993 Ga0111539_103239931 399
28 3300025942 Ga0207689_10038591 Ga0207689_100385914 399
29 3300013297 Ga0157378_10211077 Ga0157378_102110771 400
30 3300009553 Ga0105249_10014757 Ga0105249_100147573 401
31 3300025961 Ga0207712_10001318 Ga0207712_1000131811 401
32 3300005329 Ga0070683_100000106 Ga0070683_10000010647 402
33 3300005535 Ga0070684_100000083 Ga0070684_10000008334 402
34 3300003323 rootH1_10062620 rootH1_100626205 403
35 3300005618 Ga0068864_100051620 Ga0068864_1000516204 403
36 3300006237 Ga0097621_100038945 Ga0097621_1000389452 403
37 3300006358 Ga0068871_100002443 Ga0068871_1000024432 403
38 3300009176 Ga0105242_10012958 Ga0105242_100129583 403
39 3300009176 Ga0105242_10026160 Ga0105242_100261602 403
40 3300013306 Ga0163162_10050100 Ga0163162_100501005 403
41 3300013308 Ga0157375_10474056 Ga0157375_104740561 403
42 3300014969 Ga0157376_10055183 Ga0157376_100551832 403
43 3300025934 Ga0207686_10002586 Ga0207686_100025863 403
44 3300026095 Ga0207676_10163867 Ga0207676_101638672 403
45 3300005353 Ga0070669_100124748 Ga0070669_1001247482 404
46 3300005719 Ga0068861_100018084 Ga0068861_1000180843 404
47 3300013296 Ga0157374_10273775 Ga0157374_102737752 404
48 3300026118 Ga0207675_100002556 Ga0207675_10000255612 404
49 3300005334 Ga0068869_100071809 Ga0068869_1000718092 405
50 3300017792 Ga0163161_10013566 Ga0163161_100135663 405
51 3300025942 Ga0207689_10054389 Ga0207689_100543893 405
52 3300026088 Ga0207641_10008158 Ga0207641_100081582 405
53 3300044842 Ga0466957_0014002 Ga0466957_0014002_564_1844 405
54 3300044842 Ga0466957_0052280 Ga0466957_0052280_443_1723 405
55 3300053092 Ga0500583_0000009 Ga0500583_0000009_132841_134130 405
56 3300003322 rootL2_10306438 rootL2_103064382 406
57 3300014745 Ga0157377_10006062 Ga0157377_100060623 407
58 3300005340 Ga0070689_100012836 Ga0070689_1000128362 408
59 3300005365 Ga0070688_100063609 Ga0070688_1000636091 408
60 3300005466 Ga0070685_10044211 Ga0070685_100442112 408
61 3300005617 Ga0068859_100021113 Ga0068859_1000211136 408
62 3300005618 Ga0068864_100089029 Ga0068864_1000890292 408
63 3300006931 Ga0097620_100021113 Ga0097620_1000211136 408
64 3300025936 Ga0207670_10003567 Ga0207670_100035676 408
65 3300026095 Ga0207676_10037274 Ga0207676_100372742 408
66 3300028380 Ga0268265_10101836 Ga0268265_101018362 408
67 3300044765 Ga0466970_0097352 Ga0466970_0097352_104_1450 409
68 3300005290 Ga0065712_10081948 Ga0065712_100819482 410
69 3300005343 Ga0070687_100015390 Ga0070687_1000153903 410
70 3300005365 Ga0070688_100053553 Ga0070688_1000535532 410
71 3300009093 Ga0105240_10000047 Ga0105240_1000004794 410
72 3300009094 Ga0111539_10379110 Ga0111539_103791102 410
73 3300013306 Ga0163162_10011551 Ga0163162_1001155110 410
74 3300013308 Ga0157375_10005779 Ga0157375_100057792 410
75 3300025918 Ga0207662_10034956 Ga0207662_100349562 410
76 3300025936 Ga0207670_10009226 Ga0207670_100092264 410
77 3300026118 Ga0207675_100072489 Ga0207675_1000724892 410
78 3300053086 Ga0500578_0002185 Ga0500578_0002185_14123_15406 410
79 3300005617 Ga0068859_100010163 Ga0068859_1000101636 411
80 3300005719 Ga0068861_100164968 Ga0068861_1001649682 411
81 3300006931 Ga0097620_100010163 Ga0097620_1000101636 411
82 3300009553 Ga0105249_10002666 Ga0105249_1000266611 411
83 3300025961 Ga0207712_10003008 Ga0207712_100030088 411
84 3300005367 Ga0070667_100106327 Ga0070667_1001063272 412
85 3300005563 Ga0068855_100052791 Ga0068855_1000527912 412
86 3300005843 Ga0068860_100087203 Ga0068860_1000872033 412
87 3300025944 Ga0207661_10000054 Ga0207661_1000005446 412
88 3300025986 Ga0207658_10081098 Ga0207658_100810982 412
89 3300028381 Ga0268264_10004218 Ga0268264_100042188 412
90 3300047443 Ga0495687_008037 Ga0495687_008037_1964_3340 412
91 3300005290 Ga0065712_10002957 Ga0065712_100029573 414
92 3300005347 Ga0070668_100091284 Ga0070668_1000912842 414
93 3300010375 Ga0105239_10059542 Ga0105239_100595422 414
94 3300025960 Ga0207651_10024581 Ga0207651_100245814 414
95 3300025972 Ga0207668_10072816 Ga0207668_100728162 414
96 3300044658 Ga0466972_0002005 Ga0466972_0002005_4125_5561 415
97 3300044735 Ga0466968_0054168 Ga0466968_0054168_249_1685 415
98 3300005471 Ga0070698_100021248 Ga0070698_1000212482 416
99 3300006847 Ga0075431_100013446 Ga0075431_1000134465 416
100 3300050507 nmdc:mga05p37_306281_c1 nmdc:mga05p37_306281_c1_508_1761 416
101 3300050508 nmdc:mga09592_167694_c1 nmdc:mga09592_167694_c1_92_1345 416
102 3300050510 nmdc:mga06r32_310042_c1 nmdc:mga06r32_310042_c1_90_1343 416
103 3300053090 Ga0500646_0019636 Ga0500646_0019636_302_1555 416
104 iso_pu_bacteria 2929239360 2929239650 416
105 3300013104 Ga0157370_10287844 Ga0157370_102878441 417
106 iso_pu_bacteria 2883068021 2883070015 417
107 3300009545 Ga0105237_10006835 Ga0105237_100068356 418
108 3300025913 Ga0207695_10001348 Ga0207695_100013482 418
109 3300025914 Ga0207671_10005104 Ga0207671_100051047 418
110 3300035692 Ga0373935_0057447 Ga0373935_0057447_920_2368 418
111 3300005616 Ga0068852_100028536 Ga0068852_1000285367 419
112 3300026089 Ga0207648_10190564 Ga0207648_101905642 419
113 3300026116 Ga0207674_10001712 Ga0207674_1000171218 419
114 3300046524 Ga0495648_0001257 Ga0495648_0001257_3188_4543 419
115 3300053090 Ga0500646_0001356 Ga0500646_0001356_1487_2746 419
116 3300053156 Ga0500622_0001750 Ga0500622_0001750_118_1473 419
117 iso_pu_bacteria 2896109856 2896114303 419
118 iso_pu_bacteria 2914759650 2914760161 419
119 3300003320 rootH2_10001992 rootH2_1000199210 420
120 3300003761 Ga0055535_1002788 Ga0055535_10027881 420
121 3300025242 Ga0209258_100029 Ga0209258_100029145 420
122 3300025254 Ga0209148_1000089 Ga0209148_100008953 420
123 3300033180 Ga0307510_10015354 Ga0307510_100153542 420
124 3300046648 Ga0495611_0000101 Ga0495611_0000101_5703_7238 420
125 3300053088 Ga0500644_0000039 Ga0500644_0000039_15691_16959 420
126 3300053090 Ga0500646_0008662 Ga0500646_0008662_222_1490 420
127 3300053092 Ga0500583_0002527 Ga0500583_0002527_2783_4051 420
128 3300053142 Ga0500577_0000726 Ga0500577_0000726_1629_2897 420
129 3300053153 Ga0500616_0004698 Ga0500616_0004698_5246_6514 420
130 3300053160 Ga0500633_0000629 Ga0500633_0000629_3526_4794 420
131 3300053177 Ga0500636_0010079 Ga0500636_0010079_666_1934 420
132 3300055283 Ga0500661_001081 Ga0500661_001081_3504_4772 420
133 iso_pu_bacteria 2738541278 2738726021 420
134 iso_pu_bacteria 2818991442 2819576628 420
135 iso_pu_bacteria 2821136567 2821143144 420
136 iso_pu_bacteria 2904467357 2904470863 420
137 3300003323 rootH1_10092435 rootH1_100924352 421
138 3300005339 Ga0070660_100000295 Ga0070660_10000029517 421
139 3300005548 Ga0070665_100000002 Ga0070665_10000000228 421
140 3300005843 Ga0068860_100000153 Ga0068860_10000015368 421
141 3300013296 Ga0157374_10000013 Ga0157374_100000135 421
142 3300025919 Ga0207657_10001629 Ga0207657_1000162918 421
143 3300025949 Ga0207667_10010495 Ga0207667_100104953 421
144 3300028379 Ga0268266_10000022 Ga0268266_10000022409 421
145 3300028381 Ga0268264_10000159 Ga0268264_1000015936 421
146 3300046694 Ga0495649_0015130 Ga0495649_0015130_346_1653 421
147 3300049570 Ga0501033_0051494 Ga0501033_0051494_204_1472 421
148 3300049571 Ga0501034_0029664 Ga0501034_0029664_2799_4067 421
149 3300049571 Ga0501034_0063339 Ga0501034_0063339_539_1852 421
150 3300049572 Ga0501036_0202191 Ga0501036_0202191_225_1493 421
151 iso_pu_bacteria 2881955468 2881956277 421
152 iso_pu_bacteria 2929921140 2929921284 421
153 iso_pu_bacteria 8003151029 8003157669 421
154 3300005327 Ga0070658_10004224 Ga0070658_100042242 422
155 3300009174 Ga0105241_10181847 Ga0105241_101818471 422
156 3300009545 Ga0105237_10005717 Ga0105237_100057175 422
157 3300010375 Ga0105239_10003353 Ga0105239_100033534 422
158 3300013307 Ga0157372_10004138 Ga0157372_1000413811 422
159 3300025909 Ga0207705_10017370 Ga0207705_100173704 422
160 3300041997 Ga0439431_0001162 Ga0439431_0001162_3512_4786 422
161 3300044656 Ga0466969_0038014 Ga0466969_0038014_356_1681 422
162 3300044712 Ga0453684_0005471 Ga0453684_0005471_4239_5564 422
163 3300045049 Ga0466959_0011533 Ga0466959_0011533_3955_5280 422
164 3300005289 Ga0065704_10075692 Ga0065704_100756922 423
165 3300005356 Ga0070674_100012744 Ga0070674_1000127443 423
166 3300005367 Ga0070667_100065714 Ga0070667_1000657143 423
167 3300005983 Ga0081540_1009809 Ga0081540_10098093 423
168 3300009176 Ga0105242_10095452 Ga0105242_100954522 423
169 3300013306 Ga0163162_10003598 Ga0163162_100035986 423
170 3300025937 Ga0207669_10075141 Ga0207669_100751413 423
171 3300026089 Ga0207648_10032768 Ga0207648_100327683 423
172 3300026116 Ga0207674_10033982 Ga0207674_100339823 423
173 3300042876 Ga0451577_0002869 Ga0451577_0002869_17528_18808 423
174 3300046558 Ga0495633_0000025 Ga0495633_0000025_98673_99950 423
175 3300048918 Ga0496115_0186303 Ga0496115_0186303_140_1450 423
176 3300049823 Ga0501044_0060501 Ga0501044_0060501_1296_2576 423
177 3300002459 JGI24751J29686_10001389 JGI24751J29686_100013893 424
178 3300003320 rootH2_10041059 rootH2_100410595 424
179 3300003322 rootL2_10069792 rootL2_100697923 424
180 3300003322 rootL2_10074125 rootL2_100741253 424
181 3300003794 Ga0055531_10000014 Ga0055531_10000014114 424
182 3300005290 Ga0065712_10081218 Ga0065712_100812182 424
183 3300005331 Ga0070670_100004569 Ga0070670_1000045697 424
184 3300005337 Ga0070682_100000005 Ga0070682_100000005102 424
185 3300005471 Ga0070698_100003140 Ga0070698_1000031407 424
186 3300005563 Ga0068855_100031650 Ga0068855_1000316503 424
187 3300005577 Ga0068857_100039098 Ga0068857_1000390982 424
188 3300005614 Ga0068856_100022359 Ga0068856_1000223592 424
189 3300005614 Ga0068856_100175743 Ga0068856_1001757433 424
190 3300005617 Ga0068859_100003007 Ga0068859_1000030074 424
191 3300005618 Ga0068864_100027310 Ga0068864_1000273104 424
192 3300005844 Ga0068862_100239332 Ga0068862_1002393322 424
193 3300006195 Ga0075366_10008814 Ga0075366_100088143 424
194 3300006847 Ga0075431_100081904 Ga0075431_1000819043 424
195 3300006880 Ga0075429_100004456 Ga0075429_10000445610 424
196 3300006880 Ga0075429_100061118 Ga0075429_1000611183 424
197 3300006931 Ga0097620_100003007 Ga0097620_1000030074 424
198 3300009093 Ga0105240_10001361 Ga0105240_1000136116 424
199 3300009093 Ga0105240_10109990 Ga0105240_101099901 424
200 3300009094 Ga0111539_10071489 Ga0111539_100714893 424
201 3300009147 Ga0114129_10005818 Ga0114129_1000581811 424
202 3300009174 Ga0105241_10032013 Ga0105241_100320133 424
203 3300009545 Ga0105237_10143404 Ga0105237_101434042 424
204 3300009553 Ga0105249_10001060 Ga0105249_100010606 424
205 3300010375 Ga0105239_10001102 Ga0105239_1000110225 424
206 3300010375 Ga0105239_10003716 Ga0105239_100037162 424
207 3300010375 Ga0105239_10029822 Ga0105239_100298223 424
208 3300014326 Ga0157380_10000855 Ga0157380_100008552 424
209 3300014326 Ga0157380_10061627 Ga0157380_100616272 424
210 3300017792 Ga0163161_10067603 Ga0163161_100676032 424
211 3300025246 Ga0209646_1002193 Ga0209646_10021934 424
212 3300025304 Ga0209257_1000004 Ga0209257_1000004544 424
213 3300025911 Ga0207654_10101932 Ga0207654_101019322 424
214 3300025913 Ga0207695_10000431 Ga0207695_1000043166 424
215 3300025913 Ga0207695_10060008 Ga0207695_100600081 424
216 3300025914 Ga0207671_10118627 Ga0207671_101186271 424
217 3300025925 Ga0207650_10149270 Ga0207650_101492702 424
218 3300025949 Ga0207667_10004643 Ga0207667_1000464312 424
219 3300025961 Ga0207712_10006689 Ga0207712_100066893 424
220 3300026078 Ga0207702_10045382 Ga0207702_100453822 424
221 3300026089 Ga0207648_10136896 Ga0207648_101368962 424
222 3300026116 Ga0207674_10060097 Ga0207674_100600972 424
223 3300026121 Ga0207683_10025706 Ga0207683_100257062 424
224 3300041404 Ga0439436_0003662 Ga0439436_0003662_2553_3833 424
225 3300042007 Ga0439449_0022650 Ga0439449_0022650_855_2135 424
226 3300042014 Ga0439457_002231 Ga0439457_002231_3716_4996 424
227 3300044656 Ga0466969_0000152 Ga0466969_0000152_1742_3022 424
228 3300044658 Ga0466972_0000104 Ga0466972_0000104_39982_41265 424
229 3300044658 Ga0466972_0011717 Ga0466972_0011717_974_2257 424
230 3300044684 Ga0466966_0000193 Ga0466966_0000193_7775_9124 424
231 3300044693 Ga0466961_0013482 Ga0466961_0013482_2498_3823 424
232 3300045049 Ga0466959_0000016 Ga0466959_0000016_7722_9071 424
233 3300046507 Ga0495606_0032843 Ga0495606_0032843_418_1932 424
234 3300048924 Ga0496121_0000008 Ga0496121_0000008_169783_171063 424
235 3300049581 Ga0501047_0119477 Ga0501047_0119477_378_1661 424
236 3300050507 nmdc:mga05p37_3872_c1 nmdc:mga05p37_3872_c1_1801_3108 424
237 3300050508 nmdc:mga09592_109920_c1 nmdc:mga09592_109920_c1_36_1340 424
238 3300050509 nmdc:mga0qj67_5037_c1 nmdc:mga0qj67_5037_c1_7023_8327 424
239 3300053156 Ga0500622_0000151 Ga0500622_0000151_4800_6116 424
240 3300001989 JGI24739J22299_10000257 JGI24739J22299_1000025714 425
241 3300003215 JGI25153J46596_10010451 JGI25153J46596_100104513 425
242 3300003323 rootH1_10136000 rootH1_101360002 425
243 3300003354 JGI25160J50197_1000943 JGI25160J50197_10009439 425
244 3300003790 Ga0055528_1000338 Ga0055528_100033814 425
245 3300003791 Ga0055530_10001956 Ga0055530_100019563 425
246 3300005262 Ga0065165_1000100 Ga0065165_100010091 425
247 3300005328 Ga0070676_10026113 Ga0070676_100261132 425
248 3300005334 Ga0068869_100014774 Ga0068869_1000147743 425
249 3300005335 Ga0070666_10000038 Ga0070666_1000003829 425
250 3300005340 Ga0070689_100047840 Ga0070689_1000478403 425
251 3300005347 Ga0070668_100018828 Ga0070668_1000188282 425
252 3300005353 Ga0070669_100018500 Ga0070669_1000185003 425
253 3300005367 Ga0070667_100009794 Ga0070667_1000097943 425
254 3300005457 Ga0070662_100183811 Ga0070662_1001838111 425
255 3300005616 Ga0068852_100034563 Ga0068852_1000345632 425
256 3300005617 Ga0068859_100000007 Ga0068859_10000000731 425
257 3300005618 Ga0068864_100036488 Ga0068864_1000364884 425
258 3300005719 Ga0068861_100023480 Ga0068861_1000234802 425
259 3300005841 Ga0068863_100011953 Ga0068863_1000119531 425
260 3300005842 Ga0068858_100002116 Ga0068858_10000211616 425
261 3300005843 Ga0068860_100005736 Ga0068860_1000057363 425
262 3300005844 Ga0068862_100007671 Ga0068862_1000076718 425
263 3300006237 Ga0097621_100020168 Ga0097621_1000201683 425
264 3300006931 Ga0097620_100000007 Ga0097620_10000000732 425
265 3300009093 Ga0105240_10001289 Ga0105240_1000128912 425
266 3300009098 Ga0105245_10041764 Ga0105245_100417642 425
267 3300009101 Ga0105247_10000702 Ga0105247_100007028 425
268 3300009101 Ga0105247_10005964 Ga0105247_100059644 425
269 3300009174 Ga0105241_10003349 Ga0105241_100033493 425
270 3300009545 Ga0105237_10002631 Ga0105237_100026319 425
271 3300009553 Ga0105249_10001119 Ga0105249_100011199 425
272 3300009553 Ga0105249_10002912 Ga0105249_100029129 425
273 3300009553 Ga0105249_10029768 Ga0105249_100297683 425
274 3300011119 Ga0105246_10009985 Ga0105246_100099852 425
275 3300013306 Ga0163162_10000970 Ga0163162_1000097014 425
276 3300014326 Ga0157380_10000796 Ga0157380_100007962 425
277 3300017792 Ga0163161_10088981 Ga0163161_100889813 425
278 3300025273 Ga0209673_1000049 Ga0209673_10000497 425
279 3300025295 Ga0209564_1004571 Ga0209564_10045718 425
280 3300025297 Ga0209758_1006396 Ga0209758_10063965 425
281 3300025297 Ga0209758_1047055 Ga0209758_10470551 425
282 3300025298 Ga0209050_1000272 Ga0209050_100027274 425
283 3300025302 Ga0207426_1001075 Ga0207426_10010759 425
284 3300025304 Ga0209257_1005429 Ga0209257_10054299 425
285 3300025900 Ga0207710_10000975 Ga0207710_100009757 425
286 3300025900 Ga0207710_10018629 Ga0207710_100186292 425
287 3300025903 Ga0207680_10000015 Ga0207680_1000001531 425
288 3300025907 Ga0207645_10039520 Ga0207645_100395202 425
289 3300025911 Ga0207654_10008231 Ga0207654_100082312 425
290 3300025913 Ga0207695_10000010 Ga0207695_10000010145 425
291 3300025913 Ga0207695_10000361 Ga0207695_1000036118 425
292 3300025914 Ga0207671_10002899 Ga0207671_100028993 425
293 3300025925 Ga0207650_10033332 Ga0207650_100333323 425
294 3300025926 Ga0207659_10019943 Ga0207659_100199435 425
295 3300025942 Ga0207689_10006920 Ga0207689_100069203 425
296 3300025960 Ga0207651_10011503 Ga0207651_100115033 425
297 3300025961 Ga0207712_10002570 Ga0207712_100025703 425
298 3300026035 Ga0207703_10073819 Ga0207703_100738192 425
299 3300026088 Ga0207641_10000056 Ga0207641_1000005630 425
300 3300026095 Ga0207676_10025096 Ga0207676_100250962 425
301 3300026116 Ga0207674_10005126 Ga0207674_1000512610 425
302 3300026118 Ga0207675_100001037 Ga0207675_10000103717 425
303 3300026142 Ga0207698_10004577 Ga0207698_100045772 425
304 3300026142 Ga0207698_10050508 Ga0207698_100505082 425
305 3300027907 Ga0207428_10013837 Ga0207428_100138372 425
306 3300028381 Ga0268264_10005645 Ga0268264_100056457 425
307 3300028794 Ga0307515_10000684 Ga0307515_1000068465 425
308 3300031251 Ga0265327_10000010 Ga0265327_10000010187 425
309 3300044683 Ga0466965_0026621 Ga0466965_0026621_191_1474 425
310 3300046616 Ga0495668_0000108 Ga0495668_0000108_34797_36080 425
311 3300047320 Ga0495672_0013065 Ga0495672_0013065_2301_3608 425
312 3300047320 Ga0495672_0045103 Ga0495672_0045103_1137_2456 425
313 3300047472 Ga0495686_0000010 Ga0495686_0000010_86893_88353 425
314 3300047472 Ga0495686_0000322 Ga0495686_0000322_25700_26983 425
315 3300049569 Ga0501032_0009658 Ga0501032_0009658_4651_5931 425
316 3300049571 Ga0501034_0142834 Ga0501034_0142834_111_1391 425
317 3300049572 Ga0501036_0002554 Ga0501036_0002554_537_1817 425
318 3300049574 Ga0501038_0029241 Ga0501038_0029241_3319_4599 425
319 3300049575 Ga0501039_0060479 Ga0501039_0060479_189_1469 425
320 3300049579 Ga0501043_0044168 Ga0501043_0044168_111_1391 425
321 3300049580 Ga0501046_0012080 Ga0501046_0012080_1691_2971 425
322 3300049581 Ga0501047_0007092 Ga0501047_0007092_836_2116 425
323 3300049582 Ga0501048_0004971 Ga0501048_0004971_4120_5400 425
324 3300049583 Ga0501067_0006644 Ga0501067_0006644_2486_3766 425
325 3300049584 Ga0501068_0059550 Ga0501068_0059550_94_1374 425
326 3300049589 Ga0501073_0089224 Ga0501073_0089224_111_1391 425
327 3300049590 Ga0501074_0014996 Ga0501074_0014996_517_1797 425
328 3300049822 Ga0501035_0007292 Ga0501035_0007292_5649_6929 425
329 3300049823 Ga0501044_0012552 Ga0501044_0012552_3201_4481 425
330 3300049823 Ga0501044_0047789 Ga0501044_0047789_224_1510 425
331 3300050493 nmdc:mga0k408_88184_c1 nmdc:mga0k408_88184_c1_348_1655 425
332 3300053116 Ga0500592_001769 Ga0500592_001769_1262_2554 425
333 3300053153 Ga0500616_0002253 Ga0500616_0002253_7532_8815 425
334 3300001904 JGI24736J21556_1002098 JGI24736J21556_10020985 426
335 3300005327 Ga0070658_10004172 Ga0070658_100041722 426
336 3300005331 Ga0070670_100040978 Ga0070670_1000409786 426
337 3300005335 Ga0070666_10000431 Ga0070666_1000043118 426
338 3300005338 Ga0068868_100006700 Ga0068868_1000067006 426
339 3300005347 Ga0070668_100000016 Ga0070668_1000000162 426
340 3300005364 Ga0070673_100000074 Ga0070673_10000007434 426
341 3300005366 Ga0070659_100005770 Ga0070659_1000057708 426
342 3300005367 Ga0070667_100000031 Ga0070667_10000003175 426
343 3300005456 Ga0070678_100190170 Ga0070678_1001901701 426
344 3300005457 Ga0070662_100010182 Ga0070662_1000101822 426
345 3300005459 Ga0068867_100002817 Ga0068867_1000028177 426
346 3300005539 Ga0068853_100002162 Ga0068853_10000216215 426
347 3300005543 Ga0070672_100000002 Ga0070672_10000000257 426
348 3300005548 Ga0070665_100000222 Ga0070665_10000022259 426
349 3300005616 Ga0068852_100022105 Ga0068852_1000221052 426
350 3300005616 Ga0068852_100106141 Ga0068852_1001061412 426
351 3300005618 Ga0068864_100002308 Ga0068864_1000023085 426
352 3300005719 Ga0068861_100091719 Ga0068861_1000917192 426
353 3300005834 Ga0068851_10000266 Ga0068851_1000026613 426
354 3300005841 Ga0068863_100006676 Ga0068863_1000066766 426
355 3300005842 Ga0068858_100001512 Ga0068858_10000151222 426
356 3300005843 Ga0068860_100006636 Ga0068860_1000066369 426
357 3300006195 Ga0075366_10036514 Ga0075366_100365142 426
358 3300006237 Ga0097621_100029195 Ga0097621_1000291952 426
359 3300006358 Ga0068871_100002241 Ga0068871_1000022411 426
360 3300006881 Ga0068865_100001410 Ga0068865_1000014107 426
361 3300009101 Ga0105247_10009108 Ga0105247_100091084 426
362 3300009553 Ga0105249_10000769 Ga0105249_100007693 426
363 3300010375 Ga0105239_10037394 Ga0105239_100373942 426
364 3300010375 Ga0105239_10153836 Ga0105239_101538362 426
365 3300013105 Ga0157369_10040640 Ga0157369_100406402 426
366 3300013296 Ga0157374_10000074 Ga0157374_1000007476 426
367 3300013296 Ga0157374_10145853 Ga0157374_101458532 426
368 3300013306 Ga0163162_10000029 Ga0163162_1000002967 426
369 3300013307 Ga0157372_10033207 Ga0157372_100332072 426
370 3300013307 Ga0157372_10270412 Ga0157372_102704123 426
371 3300013308 Ga0157375_10000042 Ga0157375_1000004294 426
372 3300014325 Ga0163163_10000076 Ga0163163_100000767 426
373 3300014326 Ga0157380_10184400 Ga0157380_101844002 426
374 3300014968 Ga0157379_10000016 Ga0157379_100000162 426
375 3300014969 Ga0157376_10000067 Ga0157376_100000676 426
376 3300025321 Ga0207656_10002125 Ga0207656_100021256 426
377 3300025903 Ga0207680_10004520 Ga0207680_100045203 426
378 3300025904 Ga0207647_10000088 Ga0207647_1000008828 426
379 3300025907 Ga0207645_10003999 Ga0207645_100039999 426
380 3300025909 Ga0207705_10003723 Ga0207705_1000372312 426
381 3300025932 Ga0207690_10053676 Ga0207690_100536763 426
382 3300025933 Ga0207706_10015868 Ga0207706_100158686 426
383 3300025938 Ga0207704_10001983 Ga0207704_100019834 426
384 3300025940 Ga0207691_10000004 Ga0207691_1000000467 426
385 3300025960 Ga0207651_10000456 Ga0207651_100004569 426
386 3300025972 Ga0207668_10000112 Ga0207668_100001123 426
387 3300025986 Ga0207658_10000059 Ga0207658_1000005974 426
388 3300026023 Ga0207677_10002071 Ga0207677_100020713 426
389 3300026035 Ga0207703_10007561 Ga0207703_100075619 426
390 3300026041 Ga0207639_10026251 Ga0207639_100262514 426
391 3300026041 Ga0207639_10136020 Ga0207639_101360202 426
392 3300026088 Ga0207641_10018253 Ga0207641_100182534 426
393 3300026089 Ga0207648_10001923 Ga0207648_1000192319 426
394 3300026095 Ga0207676_10008702 Ga0207676_100087024 426
395 3300026118 Ga0207675_100020494 Ga0207675_1000204944 426
396 3300026121 Ga0207683_10203935 Ga0207683_102039352 426
397 3300028379 Ga0268266_10004701 Ga0268266_1000470111 426
398 3300028381 Ga0268264_10003138 Ga0268264_100031387 426
399 3300031507 Ga0307509_10301826 Ga0307509_103018261 426
400 3300041512 Ga0451853_1197910 Ga0451853_1197910_758_2218 426
401 3300042007 Ga0439449_0011525 Ga0439449_0011525_1691_2971 426
402 3300042014 Ga0439457_004420 Ga0439457_004420_103_1383 426
403 3300046460 Ga0495638_0065845 Ga0495638_0065845_788_2077 426
404 3300046616 Ga0495668_0006079 Ga0495668_0006079_3802_5118 426
405 3300048911 Ga0496108_0189620 Ga0496108_0189620_65_1393 426
406 3300049513 Ga0501290_001609 Ga0501290_001609_1150_2436 426
407 3300049515 Ga0501292_001849 Ga0501292_001849_1284_2570 426
408 3300049521 Ga0501298_002833 Ga0501298_002833_346_1632 426
409 3300049522 Ga0501299_003377 Ga0501299_003377_731_2017 426
410 3300049651 Ga0501201_000566 Ga0501201_000566_336_1622 426
411 3300049654 Ga0501207_001761 Ga0501207_001761_1047_2333 426
412 3300049661 Ga0501217_000068 Ga0501217_000068_6054_7340 426
413 3300049663 Ga0501223_000404 Ga0501223_000404_3990_5276 426
414 3300049673 Ga0501240_000199 Ga0501240_000199_1481_2767 426
415 3300049675 Ga0501243_000365 Ga0501243_000365_1868_3154 426
416 3300049681 Ga0501251_003177 Ga0501251_003177_151_1437 426
417 3300049686 Ga0501257_025245 Ga0501257_025245_52_1332 426
418 3300049688 Ga0501259_001183 Ga0501259_001183_577_1863 426
419 3300049690 Ga0501261_001588 Ga0501261_001588_336_1622 426
420 3300049704 Ga0501221_001002 Ga0501221_001002_2320_3606 426
421 3300053147 Ga0500589_040298 Ga0500589_040298_167_1456 426
422 3300053156 Ga0500622_0012266 Ga0500622_0012266_2065_3354 426
423 3300053727 Ga0500611_000004 Ga0500611_000004_168515_169804 426

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01225

Mur_ligase

Mur ligase family, catalytic domain

69

142

0.88

PF08245

Mur_ligase_M

Mur ligase middle domain

152

337

0.88

PF02875

Mur_ligase_C

Mur ligase, glutamate ligase domain

359

474

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qf5-assembly2.cif.gz_B crystal structure i of murf from acinetobacter baumannii 0.9054 15 424
8f5d-assembly1.cif.gz_A architecture of the mure-murf ligase bacterial cell wall biosynthesis complex 0.8963 6 297
3zl8-assembly1.cif.gz_A crystal structure of murf ligase from thermotoga maritima in complex with adp 0.8927 11 425
4qf5-assembly2.cif.gz_B crystal structure i of murf from acinetobacter baumannii 0.8711 15 424
3zl8-assembly1.cif.gz_A crystal structure of murf ligase from thermotoga maritima in complex with adp 0.869 11 425
ID Description Score Start End Superfamily
af_P9WJL1_108_337_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9265 73 293 3.40.1190.10
af_Q2FWH4_87_313_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.918 71 296 3.40.1190.10
af_Q2FWH4_87_313_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.9104 71 296 3.40.1190.10
af_P9WJL1_108_337_3.40.1190.10 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.888 73 293 3.40.1190.10
4ziyA02 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Mur-like, catalytic domain 0.8857 72 296 3.40.1190.10
ID Description Score Start End GO Terms
AF-A0A059WT83-F1-model_v4 Mur ligase middle domain protein 0.9947 1 297 GO:0005524
GO:0009058
GO:0016881
AF-A0A258Y4V1-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9922 1 175 GO:0005524
GO:0009058
GO:0016881
AF-A0A059WT83-F1-model_v4 Mur ligase middle domain protein 0.9913 1 297 GO:0005524
GO:0009058
GO:0016881
AF-A0A258Y4V1-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9865 1 175 GO:0005524
GO:0009058
GO:0016881
AF-A0A3D4TF72-F1-model_v4 UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase 0.9824 284 423 GO:0009058
GO:0016881

Feature Viewer

pLDDT pTM Quality
93.86 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map