F440561

General Info

Members Datasets Scaffolds Average Seq Length
423 164 846 274

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0325958|Ga0395899_0325958_34_957
Length 307
Sequence MLQEAACRIEVSYDLQPVRDMHAPGSSRGRGMPYRNARYFMFVVIAVILGGFWPSYFAVWTNVPWQFHAHGVAASIWVTMVTAQTWTAHNKSQLALHRTVGRTSLFLFPFLIAGLAAILDRSAKGFVSGDGPVRIMFGPTFMIGIAVTIAAYVTLYYRALKYRRKVWVHAGYMLSTPLILFESPFSRLLAMFMPGLTVRGPADFGRIIPGILWSMALELVVVAVIWLRFRDKAKPFLVAGAFIVAQMIAMGLLGKLAVLRPLEYFVGNLPDAVIVATGFAIGALTSWAGWQAGKQPTVPVGAVAQPA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
145 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
146 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
147 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
162 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
163 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
164 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0
Rhizoplane 1.18
Rhizosphere 97.4
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0325958 3300037312 Bacteria 1033
2 JGI24739J22299_10010512 3300001989 Bacteria 3436
3 JGI24737J22298_10034900 3300001990 Bacteria 1558
4 JGI24743J22301_10014798 3300001991 Bacteria 1441
5 JGI24735J21928_10001569 3300002067 Bacteria 8103
6 JGI24735J21928_10009354 3300002067 Bacteria 3149
7 JGI24735J21928_10060464 3300002067 Unclassified 1089
8 JGI24744J21845_10010244 3300002077 Unclassified 1922
9 JGI25165J46597_1001698 3300003214 Bacteria 9909
10 Ga0070658_10001316 3300005327 Bacteria 21172
11 Ga0070658_10011801 3300005327 Bacteria 7011
12 Ga0070658_10014116 3300005327 Bacteria 6413
13 Ga0070658_10017728 3300005327 Bacteria 5695
14 Ga0070658_10035767 3300005327 Bacteria 4001
15 Ga0070658_10055818 3300005327 Bacteria 3209
16 Ga0070676_10179733 3300005328 Bacteria 1374
17 Ga0070676_10206021 3300005328 Bacteria 1292
18 Ga0070683_100071148 3300005329 Unclassified 3246
19 Ga0070670_100041381 3300005331 Bacteria 3961
20 Ga0070670_100257210 3300005331 Unclassified 1522
21 Ga0070677_10001692 3300005333 Bacteria 6973
22 Ga0070666_10470920 3300005335 Bacteria 909
23 Ga0068868_100000053 3300005338 Bacteria 65580
24 Ga0068868_100087522 3300005338 Bacteria 2505
25 Ga0068868_100146787 3300005338 Bacteria 1940
26 Ga0068868_100336914 3300005338 Bacteria 1289
27 Ga0070660_100001188 3300005339 Bacteria 17646
28 Ga0070660_100004430 3300005339 Bacteria 9700
29 Ga0070660_100005599 3300005339 Bacteria 8709
30 Ga0070660_100017856 3300005339 Bacteria 5175
31 Ga0070660_100034182 3300005339 Bacteria 3838
32 Ga0070660_100055278 3300005339 Bacteria 3067
33 Ga0070660_100082970 3300005339 Bacteria 2517
34 Ga0070660_100102941 3300005339 Bacteria 2264
35 Ga0070660_100335965 3300005339 Bacteria 1243
36 Ga0070661_100005132 3300005344 Bacteria 9022
37 Ga0070661_100099504 3300005344 Bacteria 2161
38 Ga0070661_100156294 3300005344 Unclassified 1725
39 Ga0070668_100096114 3300005347 Bacteria 2341
40 Ga0070669_100195677 3300005353 Bacteria 1588
41 Ga0070669_100421245 3300005353 Bacteria 1096
42 Ga0070675_100065081 3300005354 Bacteria 3014
43 Ga0070675_100083136 3300005354 Bacteria 2672
44 Ga0070671_100044654 3300005355 Bacteria 3683
45 Ga0070671_100204241 3300005355 Bacteria 1676
46 Ga0070671_100420546 3300005355 Bacteria 1145
47 Ga0070673_100000023 3300005364 Bacteria 91936
48 Ga0070673_100010326 3300005364 Bacteria 6316
49 Ga0070673_100023143 3300005364 Bacteria 4536
50 Ga0070673_100075524 3300005364 Bacteria 2718
51 Ga0070673_100222345 3300005364 Bacteria 1635
52 Ga0070659_100004005 3300005366 Bacteria 10484
53 Ga0070659_100004467 3300005366 Bacteria 9992
54 Ga0070659_100025585 3300005366 Bacteria 4535
55 Ga0070659_100047014 3300005366 Bacteria 3383
56 Ga0070659_100092021 3300005366 Bacteria 2431
57 Ga0070659_100215783 3300005366 Bacteria 1582
58 Ga0070659_100293750 3300005366 Bacteria 1354
59 Ga0070659_100485486 3300005366 Bacteria 1052
60 Ga0070667_100084432 3300005367 Bacteria 2721
61 Ga0070667_100113018 3300005367 Bacteria 2356
62 Ga0070667_100478603 3300005367 Bacteria 1140
63 Ga0070714_100075130 3300005435 Bacteria 2932
64 Ga0070694_100013723 3300005444 Bacteria 5064
65 Ga0070663_100004842 3300005455 Bacteria 7939
66 Ga0070663_100047307 3300005455 Bacteria 3047
67 Ga0070663_100169871 3300005455 Bacteria 1685
68 Ga0070663_100320370 3300005455 Unclassified 1246
69 Ga0070678_100026084 3300005456 Bacteria 3945
70 Ga0070662_100008265 3300005457 Bacteria 6778
71 Ga0070662_100017992 3300005457 Bacteria 4773
72 Ga0070662_100234808 3300005457 Unclassified 1468
73 Ga0068867_100000007 3300005459 Bacteria 148726
74 Ga0068853_100022173 3300005539 Bacteria 5301
75 Ga0068853_100073555 3300005539 Bacteria 2980
76 Ga0068853_100078477 3300005539 Bacteria 2885
77 Ga0068853_100488968 3300005539 Bacteria 1161
78 Ga0070672_100053741 3300005543 Bacteria 3150
79 Ga0070672_100183089 3300005543 Bacteria 1746
80 Ga0070672_100198793 3300005543 Bacteria 1676
81 Ga0070672_100323929 3300005543 Bacteria 1310
82 Ga0070695_100183381 3300005545 Bacteria 1484
83 Ga0070693_100068909 3300005547 Bacteria 2078
84 Ga0070665_100023302 3300005548 Bacteria 6235
85 Ga0070665_100074004 3300005548 Bacteria 3412
86 Ga0070665_100514480 3300005548 Bacteria 1208
87 Ga0068855_100000029 3300005563 Bacteria 171278
88 Ga0068855_100029272 3300005563 Bacteria 6586
89 Ga0068855_100059851 3300005563 Bacteria 4456
90 Ga0068855_100073332 3300005563 Unclassified 3977
91 Ga0068855_100400648 3300005563 Bacteria 1504
92 Ga0068855_100454735 3300005563 Unclassified 1397
93 Ga0068855_100463566 3300005563 Unclassified 1381
94 Ga0070664_100055209 3300005564 Bacteria 3371
95 Ga0070664_100058362 3300005564 Bacteria 3282
96 Ga0070664_100155466 3300005564 Bacteria 2021
97 Ga0070664_100359187 3300005564 Bacteria 1326
98 Ga0068857_100044189 3300005577 Bacteria 3951
99 Ga0068857_100065203 3300005577 Bacteria 3238
100 Ga0068857_100097908 3300005577 Bacteria 2630
101 Ga0068854_100031200 3300005578 Bacteria 3702
102 Ga0068854_100138993 3300005578 Bacteria 1862
103 Ga0068856_100041877 3300005614 Bacteria 4503
104 Ga0068856_100119484 3300005614 Bacteria 2637
105 Ga0068856_100246895 3300005614 Bacteria 1800
106 Ga0068856_100252962 3300005614 Unclassified 1777
107 Ga0068856_100399675 3300005614 Bacteria 1394
108 Ga0068852_100002742 3300005616 Bacteria 12191
109 Ga0068852_100006907 3300005616 Bacteria 8254
110 Ga0068852_100080363 3300005616 Bacteria 2890
111 Ga0068852_100276332 3300005616 Bacteria 1618
112 Ga0068852_100540439 3300005616 Bacteria 1165
113 Ga0068852_100551150 3300005616 Bacteria 1153
114 Ga0068859_100173570 3300005617 Bacteria 2237
115 Ga0068864_100002781 3300005618 Bacteria 14450
116 Ga0068863_100011940 3300005841 Bacteria 8393
117 Ga0068858_100003882 3300005842 Bacteria 14763
118 Ga0068858_100012001 3300005842 Bacteria 8167
119 Ga0068860_100019666 3300005843 Bacteria 6548
120 Ga0068860_100025107 3300005843 Bacteria 5751
121 Ga0068860_100040127 3300005843 Bacteria 4476
122 Ga0068862_100102746 3300005844 Bacteria 2502
123 Ga0068862_100154403 3300005844 Bacteria 2045
124 Ga0070717_10276353 3300006028 Unclassified 1489
125 Ga0097621_100728709 3300006237 Bacteria 914
126 Ga0068865_100000010 3300006881 Bacteria 159548
127 Ga0097620_100173584 3300006931 Bacteria 2237
128 Ga0105240_10011671 3300009093 Bacteria 12209
129 Ga0105240_10116040 3300009093 Bacteria 3231
130 Ga0105240_10457766 3300009093 Unclassified 1426
131 Ga0105245_10000174 3300009098 Bacteria 61234
132 Ga0105245_10791337 3300009098 Bacteria 986
133 Ga0105243_10000054 3300009148 Bacteria 136517
134 Ga0105243_10083610 3300009148 Bacteria 2612
135 Ga0105241_10480712 3300009174 Unclassified 1104
136 Ga0105242_10000315 3300009176 Bacteria 38764
137 Ga0105248_10000621 3300009177 Bacteria 40351
138 Ga0105248_10080599 3300009177 Bacteria 3659
139 Ga0105248_10124670 3300009177 Bacteria 2906
140 Ga0105248_10222364 3300009177 Bacteria 2126
141 Ga0105238_10013165 3300009551 Bacteria 8347
142 Ga0105238_10066300 3300009551 Bacteria 3612
143 Ga0105249_10008840 3300009553 Bacteria 8795
144 Ga0105239_10013130 3300010375 Bacteria 9204
145 Ga0105246_10306367 3300011119 Bacteria 1285
146 Ga0157373_10194538 3300013100 Bacteria 1429
147 Ga0157373_10252079 3300013100 Bacteria 1248
148 Ga0157371_10065643 3300013102 Bacteria 2570
149 Ga0157370_10006160 3300013104 Bacteria 13307
150 Ga0157370_10370543 3300013104 Unclassified 1319
151 Ga0157370_10425698 3300013104 Bacteria 1221
152 Ga0157369_10000256 3300013105 Bacteria 73068
153 Ga0157369_10013170 3300013105 Bacteria 9359
154 Ga0157369_10064570 3300013105 Bacteria 3942
155 Ga0157369_10089432 3300013105 Bacteria 3287
156 Ga0157369_10134816 3300013105 Bacteria 2615
157 Ga0157369_10189435 3300013105 Bacteria 2162
158 Ga0157369_10279666 3300013105 Bacteria 1738
159 Ga0157369_10517087 3300013105 Unclassified 1235
160 Ga0157374_10269648 3300013296 Bacteria 1678
161 Ga0163162_10004057 3300013306 Bacteria 14052
162 Ga0163162_10042835 3300013306 Bacteria 4532
163 Ga0157372_10004983 3300013307 Bacteria 14110
164 Ga0157372_10170458 3300013307 Bacteria 2518
165 Ga0157372_10282699 3300013307 Unclassified 1929
166 Ga0157372_10915051 3300013307 Bacteria 1017
167 Ga0157375_10011606 3300013308 Bacteria 7784
168 Ga0163163_10000849 3300014325 Bacteria 25987
169 Ga0157380_10066260 3300014326 Unclassified 2904
170 Ga0157380_10453861 3300014326 Bacteria 1232
171 Ga0157377_10013168 3300014745 Bacteria 4180
172 Ga0157377_10019592 3300014745 Bacteria 3536
173 Ga0157379_10068296 3300014968 Bacteria 3178
174 Ga0157379_10191905 3300014968 Unclassified 1846
175 Ga0157379_10466612 3300014968 Bacteria 1167
176 Ga0157376_10000047 3300014969 Bacteria 107974
177 Ga0163161_10012759 3300017792 Bacteria 5836
178 Ga0209437_112335 3300025233 Bacteria 1250
179 Ga0209148_1003249 3300025254 Bacteria 4615
180 Ga0209233_1000120 3300025261 Bacteria 233311
181 Ga0209455_1000700 3300025272 Bacteria 19633
182 Ga0207697_10034240 3300025315 Bacteria 2079
183 Ga0207697_10060867 3300025315 Unclassified 1570
184 Ga0207656_10023440 3300025321 Bacteria 2486
185 Ga0207688_10007063 3300025901 Bacteria 6104
186 Ga0207688_10160394 3300025901 Bacteria 1333
187 Ga0207680_10006006 3300025903 Bacteria 5842
188 Ga0207647_10003710 3300025904 Bacteria 11418
189 Ga0207647_10024043 3300025904 Bacteria 4020
190 Ga0207647_10135343 3300025904 Unclassified 1446
191 Ga0207645_10085901 3300025907 Unclassified 2021
192 Ga0207645_10114277 3300025907 Bacteria 1749
193 Ga0207705_10000369 3300025909 Bacteria 40762
194 Ga0207705_10003534 3300025909 Bacteria 11903
195 Ga0207705_10008352 3300025909 Bacteria 7558
196 Ga0207705_10017434 3300025909 Bacteria 5142
197 Ga0207705_10022598 3300025909 Bacteria 4486
198 Ga0207705_10173935 3300025909 Bacteria 1622
199 Ga0207695_10141252 3300025913 Bacteria 2356
200 Ga0207695_10370039 3300025913 Unclassified 1319
201 Ga0207695_10397215 3300025913 Bacteria 1263
202 Ga0207662_10077661 3300025918 Bacteria 2020
203 Ga0207657_10000414 3300025919 Bacteria 45279
204 Ga0207657_10005804 3300025919 Bacteria 12860
205 Ga0207657_10008601 3300025919 Bacteria 10337
206 Ga0207657_10011723 3300025919 Bacteria 8685
207 Ga0207657_10011750 3300025919 Bacteria 8673
208 Ga0207657_10023564 3300025919 Bacteria 5728
209 Ga0207657_10024746 3300025919 Bacteria 5550
210 Ga0207657_10064065 3300025919 Bacteria 3139
211 Ga0207657_10077282 3300025919 Bacteria 2806
212 Ga0207657_10112987 3300025919 Bacteria 2241
213 Ga0207657_10351759 3300025919 Bacteria 1162
214 Ga0207657_10365878 3300025919 Bacteria 1136
215 Ga0207649_10036531 3300025920 Bacteria 2959
216 Ga0207649_10070192 3300025920 Bacteria 2233
217 Ga0207649_10310381 3300025920 Bacteria 1156
218 Ga0207681_10076184 3300025923 Bacteria 2355
219 Ga0207681_10123907 3300025923 Unclassified 1900
220 Ga0207681_10246838 3300025923 Bacteria 1392
221 Ga0207694_10004290 3300025924 Bacteria 11156
222 Ga0207694_10069833 3300025924 Unclassified 2745
223 Ga0207650_10017413 3300025925 Bacteria 5032
224 Ga0207650_10052135 3300025925 Bacteria 3030
225 Ga0207659_10063842 3300025926 Bacteria 2664
226 Ga0207659_10126235 3300025926 Bacteria 1968
227 Ga0207687_10001615 3300025927 Bacteria 15526
228 Ga0207664_10115232 3300025929 Bacteria 2241
229 Ga0207644_10065419 3300025931 Bacteria 2644
230 Ga0207644_10088345 3300025931 Unclassified 2305
231 Ga0207644_10232400 3300025931 Bacteria 1465
232 Ga0207690_10033016 3300025932 Bacteria 3325
233 Ga0207690_10106511 3300025932 Unclassified 2012
234 Ga0207690_10117338 3300025932 Bacteria 1927
235 Ga0207690_10276634 3300025932 Bacteria 1306
236 Ga0207690_10309229 3300025932 Bacteria 1239
237 Ga0207690_10430529 3300025932 Bacteria 1057
238 Ga0207706_10014325 3300025933 Bacteria 7187
239 Ga0207706_10036426 3300025933 Bacteria 4370
240 Ga0207706_10057515 3300025933 Bacteria 3426
241 Ga0207706_10066925 3300025933 Bacteria 3161
242 Ga0207709_10000050 3300025935 Bacteria 234391
243 Ga0207704_10000020 3300025938 Bacteria 148847
244 Ga0207691_10019100 3300025940 Bacteria 6490
245 Ga0207691_10082353 3300025940 Bacteria 2891
246 Ga0207691_10082681 3300025940 Plasmid 2884
247 Ga0207711_10001669 3300025941 Bacteria 20448
248 Ga0207711_10401981 3300025941 Unclassified 1273
249 Ga0207689_10000268 3300025942 Bacteria 47140
250 Ga0207679_10035951 3300025945 Bacteria 3509
251 Ga0207679_10041464 3300025945 Bacteria 3300
252 Ga0207667_10000035 3300025949 Bacteria 301056
253 Ga0207667_10025999 3300025949 Bacteria 6402
254 Ga0207667_10155331 3300025949 Bacteria 2354
255 Ga0207667_10245473 3300025949 Unclassified 1832
256 Ga0207667_10247342 3300025949 Bacteria 1824
257 Ga0207667_10284061 3300025949 Bacteria 1691
258 Ga0207667_10321437 3300025949 Unclassified 1580
259 Ga0207667_10494155 3300025949 Bacteria 1241
260 Ga0207651_10000005 3300025960 Bacteria 246132
261 Ga0207651_10053139 3300025960 Bacteria 2767
262 Ga0207651_10249949 3300025960 Unclassified 1450
263 Ga0207651_10261543 3300025960 Bacteria 1421
264 Ga0207712_10003861 3300025961 Bacteria 9467
265 Ga0207712_10115356 3300025961 Bacteria 2022
266 Ga0207668_10142486 3300025972 Bacteria 1845
267 Ga0207640_10032795 3300025981 Bacteria 3223
268 Ga0207640_10145152 3300025981 Unclassified 1735
269 Ga0207658_10050401 3300025986 Bacteria 3063
270 Ga0207658_10248003 3300025986 Bacteria 1512
271 Ga0207677_10000094 3300026023 Bacteria 73172
272 Ga0207677_10083788 3300026023 Bacteria 2296
273 Ga0207703_10027710 3300026035 Bacteria 4461
274 Ga0207703_10032589 3300026035 Bacteria 4124
275 Ga0207639_10000334 3300026041 Bacteria 32648
276 Ga0207639_10100530 3300026041 Bacteria 2336
277 Ga0207678_10006985 3300026067 Bacteria 10022
278 Ga0207678_10011343 3300026067 Bacteria 7822
279 Ga0207678_10030926 3300026067 Bacteria 4673
280 Ga0207678_10088993 3300026067 Bacteria 2639
281 Ga0207678_10214957 3300026067 Bacteria 1645
282 Ga0207702_10002737 3300026078 Bacteria 16509
283 Ga0207702_10090496 3300026078 Bacteria 2678
284 Ga0207702_10152615 3300026078 Bacteria 2103
285 Ga0207702_10161132 3300026078 Unclassified 2049
286 Ga0207648_10000017 3300026089 Bacteria 148699
287 Ga0207676_10001827 3300026095 Bacteria 15590
288 Ga0207674_10007233 3300026116 Bacteria 12953
289 Ga0207674_10023294 3300026116 Bacteria 6635
290 Ga0207674_10040810 3300026116 Bacteria 4804
291 Ga0207674_10057581 3300026116 Bacteria 3939
292 Ga0207674_10190300 3300026116 Bacteria 2002
293 Ga0207674_10332319 3300026116 Unclassified 1470
294 Ga0207683_10013235 3300026121 Bacteria 7034
295 Ga0207698_10002646 3300026142 Bacteria 10644
296 Ga0207698_10006383 3300026142 Bacteria 7350
297 Ga0207698_10021001 3300026142 Bacteria 4509
298 Ga0207698_10062498 3300026142 Bacteria 2908
299 Ga0207698_10455825 3300026142 Bacteria 1235
300 Ga0268266_10159070 3300028379 Bacteria 2042
301 Ga0268265_10016326 3300028380 Bacteria 5098
302 Ga0268265_10073966 3300028380 Bacteria 2663
303 Ga0268265_10136513 3300028380 Bacteria 2047
304 Ga0268265_10418580 3300028380 Bacteria 1243
305 Ga0268264_10000546 3300028381 Bacteria 47268
306 Ga0268264_10006400 3300028381 Bacteria 9921
307 Ga0268264_10014149 3300028381 Bacteria 6561
308 Ga0307408_100088997 3300031548 Bacteria 2327
309 Ga0307408_100111604 3300031548 Bacteria 2101
310 Ga0307408_100218766 3300031548 Bacteria 1553
311 Ga0307405_10523038 3300031731 Unclassified 955
312 Ga0307413_10021710 3300031824 Bacteria 3443
313 Ga0307413_10033399 3300031824 Bacteria 2929
314 Ga0307413_10067582 3300031824 Bacteria 2235
315 Ga0307413_10076786 3300031824 Bacteria 2124
316 Ga0307410_10030449 3300031852 Bacteria 3449
317 Ga0307410_10048001 3300031852 Bacteria 2857
318 Ga0307410_10211190 3300031852 Bacteria 1487
319 Ga0307406_10071397 3300031901 Bacteria 2276
320 Ga0307406_10110370 3300031901 Bacteria 1892
321 Ga0307406_10127406 3300031901 Bacteria 1781
322 Ga0307406_10510238 3300031901 Bacteria 977
323 Ga0307407_10014482 3300031903 Bacteria 3864
324 Ga0307407_10145906 3300031903 Bacteria 1532
325 Ga0307407_10228505 3300031903 Bacteria 1262
326 Ga0307412_10049237 3300031911 Bacteria 2775
327 Ga0307412_10053298 3300031911 Bacteria 2681
328 Ga0307412_10435316 3300031911 Bacteria 1076
329 Ga0307409_100008994 3300031995 Bacteria 6107
330 Ga0307409_100012533 3300031995 Bacteria 5408
331 Ga0307409_100018531 3300031995 Bacteria 4684
332 Ga0307409_100066459 3300031995 Bacteria 2843
333 Ga0307409_100166939 3300031995 Bacteria 1933
334 Ga0307409_100181523 3300031995 Bacteria 1864
335 Ga0307409_100219282 3300031995 Bacteria 1716
336 Ga0307409_100319318 3300031995 Bacteria 1453
337 Ga0307409_100426612 3300031995 Bacteria 1273
338 Ga0307416_100155329 3300032002 Bacteria 2105
339 Ga0307416_100167884 3300032002 Bacteria 2038
340 Ga0307414_10010095 3300032004 Bacteria 5459
341 Ga0307414_10013806 3300032004 Bacteria 4820
342 Ga0307414_10035349 3300032004 Bacteria 3324
343 Ga0307414_10055788 3300032004 Bacteria 2768
344 Ga0307414_10125764 3300032004 Bacteria 1980
345 Ga0307414_10161093 3300032004 Bacteria 1782
346 Ga0307414_10571125 3300032004 Unclassified 1010
347 Ga0307411_10001421 3300032005 Bacteria 9757
348 Ga0307411_10025306 3300032005 Bacteria 3554
349 Ga0307411_10027305 3300032005 Bacteria 3451
350 Ga0307411_10027338 3300032005 Bacteria 3450
351 Ga0307411_10196809 3300032005 Bacteria 1544
352 Ga0307411_10357457 3300032005 Unclassified 1193
353 Ga0307415_100003404 3300032126 Bacteria 8095
354 Ga0307415_100005544 3300032126 Bacteria 6715
355 Ga0373923_0123322 3300035111 Bacteria 1159
356 Ga0373956_0165453 3300035119 Bacteria 1043
357 Ga0373933_0148543 3300035724 Bacteria 1483
358 Ga0395899_0000876 3300037312 Bacteria 28650
359 Ga0395899_0063934 3300037312 Bacteria 2706
360 Ga0395899_0097676 3300037312 Bacteria 2123
361 Ga0395899_0269202 3300037312 Bacteria 1162
362 Ga0395900_0013739 3300037418 Bacteria 8265
363 Ga0395900_0015940 3300037418 Bacteria 7657
364 Ga0395900_0016050 3300037418 Bacteria 7632
365 Ga0395900_0026185 3300037418 Bacteria 5972
366 Ga0395900_0049519 3300037418 Bacteria 4329
367 Ga0395900_0082671 3300037418 Bacteria 3299
368 Ga0395900_0241591 3300037418 Unclassified 1811
369 Ga0395900_0328330 3300037418 Bacteria 1508
370 Ga0395900_0473722 3300037418 Unclassified 1205
371 Ga0395898_0011623 3300037466 Bacteria 9137
372 Ga0395898_0025638 3300037466 Bacteria 5939
373 Ga0395898_0030803 3300037466 Bacteria 5366
374 Ga0395898_0092066 3300037466 Bacteria 2916
375 Ga0395898_0145259 3300037466 Unclassified 2270
376 Ga0395898_0217304 3300037466 Bacteria 1823
377 Ga0395898_0229879 3300037466 Bacteria 1769
378 Ga0395898_0255752 3300037466 Bacteria 1670
379 Ga0395898_0691658 3300037466 Unclassified 962
380 Ga0395905_0002477 3300037471 Bacteria 20432
381 Ga0395905_0005585 3300037471 Bacteria 12813
382 Ga0395905_0008253 3300037471 Bacteria 10287
383 Ga0395905_0023378 3300037471 Bacteria 5841
384 Ga0395905_0059810 3300037471 Bacteria 3562
385 Ga0395905_0117751 3300037471 Bacteria 2496
386 Ga0395905_0193312 3300037471 Bacteria 1908
387 Ga0395905_0198822 3300037471 Bacteria 1879
388 Ga0395905_0265459 3300037471 Unclassified 1602
389 Ga0395905_0296300 3300037471 Bacteria 1504
390 Ga0395901_0029762 3300038443 Bacteria 5624
391 Ga0395901_0051759 3300038443 Bacteria 4269
392 Ga0395901_0066150 3300038443 Bacteria 3765
393 Ga0395901_0319699 3300038443 Bacteria 1606
394 Ga0395901_0330314 3300038443 Bacteria 1576
395 Ga0395901_0396383 3300038443 Unclassified 1418
396 Ga0439449_0122383 3300042007 Bacteria 966
397 Ga0466969_0003744 3300044656 Bacteria 8081
398 Ga0466972_0041965 3300044658 Bacteria 2226
399 Ga0466961_0002881 3300044693 Bacteria 10667
400 Ga0466961_0039765 3300044693 Bacteria 3014
401 Ga0466963_0102575 3300044694 Bacteria 1959
402 Ga0466971_0004187 3300044719 Bacteria 6217
403 Ga0466971_0113385 3300044719 Bacteria 1252
404 Ga0466970_0004031 3300044765 Bacteria 7210
405 Ga0466970_0213628 3300044765 Bacteria 1075
406 Ga0466957_0003290 3300044842 Bacteria 8850
407 Ga0466959_0003223 3300045049 Bacteria 10612
408 Ga0466959_0014201 3300045049 Bacteria 5779
409 Ga0466958_0007199 3300045836 Bacteria 6099
410 Ga0466958_0013623 3300045836 Bacteria 4634
411 Ga0495669_0216052 3300046684 Bacteria 918
412 Ga0495670_0045028 3300046691 Bacteria 2203
413 Ga0495677_0092122 3300047445 Bacteria 1143
414 Ga0495602_0057111 3300048088 Plasmid 3427
415 Ga0496106_0365800 3300048909 Bacteria 1159
416 Ga0496109_0140764 3300048912 Bacteria 2256
417 Ga0496109_0230267 3300048912 Bacteria 1743
418 Ga0496110_0262784 3300048913 Bacteria 1571
419 Ga0496111_0130378 3300048914 Bacteria 1860
420 Ga0501225_0076253 3300049705 Unclassified 958
421 Ga0500658_0000349 3300053134 Bacteria 20530
422 Ga0466962_0056816 3300061719 Bacteria 1869
423 2896431421 2896429255 Bacteria 2557483
424 Ga0395899_0325958
425 JGI24739J22299_10010512
426 JGI24737J22298_10034900
427 JGI24743J22301_10014798
428 JGI24735J21928_10001569
429 JGI24735J21928_10009354
430 JGI24735J21928_10060464
431 JGI24744J21845_10010244
432 JGI25165J46597_1001698
433 Ga0070658_10001316
434 Ga0070658_10011801
435 Ga0070658_10014116
436 Ga0070658_10017728
437 Ga0070658_10035767
438 Ga0070658_10055818
439 Ga0070676_10179733
440 Ga0070676_10206021
441 Ga0070683_100071148
442 Ga0070670_100041381
443 Ga0070670_100257210
444 Ga0070677_10001692
445 Ga0070666_10470920
446 Ga0068868_100000053
447 Ga0068868_100087522
448 Ga0068868_100146787
449 Ga0068868_100336914
450 Ga0070660_100001188
451 Ga0070660_100004430
452 Ga0070660_100005599
453 Ga0070660_100017856
454 Ga0070660_100034182
455 Ga0070660_100055278
456 Ga0070660_100082970
457 Ga0070660_100102941
458 Ga0070660_100335965
459 Ga0070661_100005132
460 Ga0070661_100099504
461 Ga0070661_100156294
462 Ga0070668_100096114
463 Ga0070669_100195677
464 Ga0070669_100421245
465 Ga0070675_100065081
466 Ga0070675_100083136
467 Ga0070671_100044654
468 Ga0070671_100204241
469 Ga0070671_100420546
470 Ga0070673_100000023
471 Ga0070673_100010326
472 Ga0070673_100023143
473 Ga0070673_100075524
474 Ga0070673_100222345
475 Ga0070659_100004005
476 Ga0070659_100004467
477 Ga0070659_100025585
478 Ga0070659_100047014
479 Ga0070659_100092021
480 Ga0070659_100215783
481 Ga0070659_100293750
482 Ga0070659_100485486
483 Ga0070667_100084432
484 Ga0070667_100113018
485 Ga0070667_100478603
486 Ga0070714_100075130
487 Ga0070694_100013723
488 Ga0070663_100004842
489 Ga0070663_100047307
490 Ga0070663_100169871
491 Ga0070663_100320370
492 Ga0070678_100026084
493 Ga0070662_100008265
494 Ga0070662_100017992
495 Ga0070662_100234808
496 Ga0068867_100000007
497 Ga0068853_100022173
498 Ga0068853_100073555
499 Ga0068853_100078477
500 Ga0068853_100488968
501 Ga0070672_100053741
502 Ga0070672_100183089
503 Ga0070672_100198793
504 Ga0070672_100323929
505 Ga0070695_100183381
506 Ga0070693_100068909
507 Ga0070665_100023302
508 Ga0070665_100074004
509 Ga0070665_100514480
510 Ga0068855_100000029
511 Ga0068855_100029272
512 Ga0068855_100059851
513 Ga0068855_100073332
514 Ga0068855_100400648
515 Ga0068855_100454735
516 Ga0068855_100463566
517 Ga0070664_100055209
518 Ga0070664_100058362
519 Ga0070664_100155466
520 Ga0070664_100359187
521 Ga0068857_100044189
522 Ga0068857_100065203
523 Ga0068857_100097908
524 Ga0068854_100031200
525 Ga0068854_100138993
526 Ga0068856_100041877
527 Ga0068856_100119484
528 Ga0068856_100246895
529 Ga0068856_100252962
530 Ga0068856_100399675
531 Ga0068852_100002742
532 Ga0068852_100006907
533 Ga0068852_100080363
534 Ga0068852_100276332
535 Ga0068852_100540439
536 Ga0068852_100551150
537 Ga0068859_100173570
538 Ga0068864_100002781
539 Ga0068863_100011940
540 Ga0068858_100003882
541 Ga0068858_100012001
542 Ga0068860_100019666
543 Ga0068860_100025107
544 Ga0068860_100040127
545 Ga0068862_100102746
546 Ga0068862_100154403
547 Ga0070717_10276353
548 Ga0097621_100728709
549 Ga0068865_100000010
550 Ga0097620_100173584
551 Ga0105240_10011671
552 Ga0105240_10116040
553 Ga0105240_10457766
554 Ga0105245_10000174
555 Ga0105245_10791337
556 Ga0105243_10000054
557 Ga0105243_10083610
558 Ga0105241_10480712
559 Ga0105242_10000315
560 Ga0105248_10000621
561 Ga0105248_10080599
562 Ga0105248_10124670
563 Ga0105248_10222364
564 Ga0105238_10013165
565 Ga0105238_10066300
566 Ga0105249_10008840
567 Ga0105239_10013130
568 Ga0105246_10306367
569 Ga0157373_10194538
570 Ga0157373_10252079
571 Ga0157371_10065643
572 Ga0157370_10006160
573 Ga0157370_10370543
574 Ga0157370_10425698
575 Ga0157369_10000256
576 Ga0157369_10013170
577 Ga0157369_10064570
578 Ga0157369_10089432
579 Ga0157369_10134816
580 Ga0157369_10189435
581 Ga0157369_10279666
582 Ga0157369_10517087
583 Ga0157374_10269648
584 Ga0163162_10004057
585 Ga0163162_10042835
586 Ga0157372_10004983
587 Ga0157372_10170458
588 Ga0157372_10282699
589 Ga0157372_10915051
590 Ga0157375_10011606
591 Ga0163163_10000849
592 Ga0157380_10066260
593 Ga0157380_10453861
594 Ga0157377_10013168
595 Ga0157377_10019592
596 Ga0157379_10068296
597 Ga0157379_10191905
598 Ga0157379_10466612
599 Ga0157376_10000047
600 Ga0163161_10012759
601 Ga0209437_112335
602 Ga0209148_1003249
603 Ga0209233_1000120
604 Ga0209455_1000700
605 Ga0207697_10034240
606 Ga0207697_10060867
607 Ga0207656_10023440
608 Ga0207688_10007063
609 Ga0207688_10160394
610 Ga0207680_10006006
611 Ga0207647_10003710
612 Ga0207647_10024043
613 Ga0207647_10135343
614 Ga0207645_10085901
615 Ga0207645_10114277
616 Ga0207705_10000369
617 Ga0207705_10003534
618 Ga0207705_10008352
619 Ga0207705_10017434
620 Ga0207705_10022598
621 Ga0207705_10173935
622 Ga0207695_10141252
623 Ga0207695_10370039
624 Ga0207695_10397215
625 Ga0207662_10077661
626 Ga0207657_10000414
627 Ga0207657_10005804
628 Ga0207657_10008601
629 Ga0207657_10011723
630 Ga0207657_10011750
631 Ga0207657_10023564
632 Ga0207657_10024746
633 Ga0207657_10064065
634 Ga0207657_10077282
635 Ga0207657_10112987
636 Ga0207657_10351759
637 Ga0207657_10365878
638 Ga0207649_10036531
639 Ga0207649_10070192
640 Ga0207649_10310381
641 Ga0207681_10076184
642 Ga0207681_10123907
643 Ga0207681_10246838
644 Ga0207694_10004290
645 Ga0207694_10069833
646 Ga0207650_10017413
647 Ga0207650_10052135
648 Ga0207659_10063842
649 Ga0207659_10126235
650 Ga0207687_10001615
651 Ga0207664_10115232
652 Ga0207644_10065419
653 Ga0207644_10088345
654 Ga0207644_10232400
655 Ga0207690_10033016
656 Ga0207690_10106511
657 Ga0207690_10117338
658 Ga0207690_10276634
659 Ga0207690_10309229
660 Ga0207690_10430529
661 Ga0207706_10014325
662 Ga0207706_10036426
663 Ga0207706_10057515
664 Ga0207706_10066925
665 Ga0207709_10000050
666 Ga0207704_10000020
667 Ga0207691_10019100
668 Ga0207691_10082353
669 Ga0207691_10082681
670 Ga0207711_10001669
671 Ga0207711_10401981
672 Ga0207689_10000268
673 Ga0207679_10035951
674 Ga0207679_10041464
675 Ga0207667_10000035
676 Ga0207667_10025999
677 Ga0207667_10155331
678 Ga0207667_10245473
679 Ga0207667_10247342
680 Ga0207667_10284061
681 Ga0207667_10321437
682 Ga0207667_10494155
683 Ga0207651_10000005
684 Ga0207651_10053139
685 Ga0207651_10249949
686 Ga0207651_10261543
687 Ga0207712_10003861
688 Ga0207712_10115356
689 Ga0207668_10142486
690 Ga0207640_10032795
691 Ga0207640_10145152
692 Ga0207658_10050401
693 Ga0207658_10248003
694 Ga0207677_10000094
695 Ga0207677_10083788
696 Ga0207703_10027710
697 Ga0207703_10032589
698 Ga0207639_10000334
699 Ga0207639_10100530
700 Ga0207678_10006985
701 Ga0207678_10011343
702 Ga0207678_10030926
703 Ga0207678_10088993
704 Ga0207678_10214957
705 Ga0207702_10002737
706 Ga0207702_10090496
707 Ga0207702_10152615
708 Ga0207702_10161132
709 Ga0207648_10000017
710 Ga0207676_10001827
711 Ga0207674_10007233
712 Ga0207674_10023294
713 Ga0207674_10040810
714 Ga0207674_10057581
715 Ga0207674_10190300
716 Ga0207674_10332319
717 Ga0207683_10013235
718 Ga0207698_10002646
719 Ga0207698_10006383
720 Ga0207698_10021001
721 Ga0207698_10062498
722 Ga0207698_10455825
723 Ga0268266_10159070
724 Ga0268265_10016326
725 Ga0268265_10073966
726 Ga0268265_10136513
727 Ga0268265_10418580
728 Ga0268264_10000546
729 Ga0268264_10006400
730 Ga0268264_10014149
731 Ga0307408_100088997
732 Ga0307408_100111604
733 Ga0307408_100218766
734 Ga0307405_10523038
735 Ga0307413_10021710
736 Ga0307413_10033399
737 Ga0307413_10067582
738 Ga0307413_10076786
739 Ga0307410_10030449
740 Ga0307410_10048001
741 Ga0307410_10211190
742 Ga0307406_10071397
743 Ga0307406_10110370
744 Ga0307406_10127406
745 Ga0307406_10510238
746 Ga0307407_10014482
747 Ga0307407_10145906
748 Ga0307407_10228505
749 Ga0307412_10049237
750 Ga0307412_10053298
751 Ga0307412_10435316
752 Ga0307409_100008994
753 Ga0307409_100012533
754 Ga0307409_100018531
755 Ga0307409_100066459
756 Ga0307409_100166939
757 Ga0307409_100181523
758 Ga0307409_100219282
759 Ga0307409_100319318
760 Ga0307409_100426612
761 Ga0307416_100155329
762 Ga0307416_100167884
763 Ga0307414_10010095
764 Ga0307414_10013806
765 Ga0307414_10035349
766 Ga0307414_10055788
767 Ga0307414_10125764
768 Ga0307414_10161093
769 Ga0307414_10571125
770 Ga0307411_10001421
771 Ga0307411_10025306
772 Ga0307411_10027305
773 Ga0307411_10027338
774 Ga0307411_10196809
775 Ga0307411_10357457
776 Ga0307415_100003404
777 Ga0307415_100005544
778 Ga0373923_0123322
779 Ga0373956_0165453
780 Ga0373933_0148543
781 Ga0395899_0000876
782 Ga0395899_0063934
783 Ga0395899_0097676
784 Ga0395899_0269202
785 Ga0395900_0013739
786 Ga0395900_0015940
787 Ga0395900_0016050
788 Ga0395900_0026185
789 Ga0395900_0049519
790 Ga0395900_0082671
791 Ga0395900_0241591
792 Ga0395900_0328330
793 Ga0395900_0473722
794 Ga0395898_0011623
795 Ga0395898_0025638
796 Ga0395898_0030803
797 Ga0395898_0092066
798 Ga0395898_0145259
799 Ga0395898_0217304
800 Ga0395898_0229879
801 Ga0395898_0255752
802 Ga0395898_0691658
803 Ga0395905_0002477
804 Ga0395905_0005585
805 Ga0395905_0008253
806 Ga0395905_0023378
807 Ga0395905_0059810
808 Ga0395905_0117751
809 Ga0395905_0193312
810 Ga0395905_0198822
811 Ga0395905_0265459
812 Ga0395905_0296300
813 Ga0395901_0029762
814 Ga0395901_0051759
815 Ga0395901_0066150
816 Ga0395901_0319699
817 Ga0395901_0330314
818 Ga0395901_0396383
819 Ga0439449_0122383
820 Ga0466969_0003744
821 Ga0466972_0041965
822 Ga0466961_0002881
823 Ga0466961_0039765
824 Ga0466963_0102575
825 Ga0466971_0004187
826 Ga0466971_0113385
827 Ga0466970_0004031
828 Ga0466970_0213628
829 Ga0466957_0003290
830 Ga0466959_0003223
831 Ga0466959_0014201
832 Ga0466958_0007199
833 Ga0466958_0013623
834 Ga0495669_0216052
835 Ga0495670_0045028
836 Ga0495677_0092122
837 Ga0495602_0057111
838 Ga0496106_0365800
839 Ga0496109_0140764
840 Ga0496109_0230267
841 Ga0496110_0262784
842 Ga0496111_0130378
843 Ga0501225_0076253
844 Ga0500658_0000349
845 Ga0466962_0056816
846 2896431421

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5291 111 224
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.5084 111 224
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4765 115 237
2rld-assembly1.cif.gz_E crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.4578 115 237
1yo7-assembly2.cif.gz_B re-engineering topology of the homodimeric rop protein into a single-chain 4-helix bundle 0.3991 108 235
ID Description Score Start End Superfamily
2yfaA02 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.5846 108 223 1.20.1440.210
2yfaA02 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins); 0.5683 108 223 1.20.1440.210
2rldB00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.5648 111 224 1.20.1440.60
2rldB00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.5472 111 224 1.20.1440.60
2rldE00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);23S rRNA-intervening sequence 0.5391 115 225 1.20.1440.60
ID Description Score Start End GO Terms
AF-A0A1W9HEM5-F1-model_v4 Uncharacterized protein 0.9492 11 275 GO:0016020
AF-A0A1H6FVK2-F1-model_v4 Cytochrome c oxidase assembly factor CtaG 0.9479 1 262 GO:0016020
AF-A0A4R6XHM1-F1-model_v4 Uncharacterized protein 0.9467 1 261 GO:0016020
AF-A0A5R9IDZ1-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9451 1 266 GO:0016020
AF-A0A1W9HEM5-F1-model_v4 Uncharacterized protein 0.9423 11 275 GO:0016020

Map