F440521

General Info

Members Datasets Scaffolds Average Seq Length
423 235 846 293

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10070347|Ga0157379_100703472
Length 340
Sequence MQKGTASPIIEFVLMPGCSLMRMGNPRARIRADLVIGADMQKKKYGMVATLFLACACMGRGQLVNAQGGSTSTTLTVHWEELTGPDFIEAIKRSQGTCLLPFGILEKHGPHMPIGSDLINARYAALHAAEQQYAVVFPEYYFGQIAEARHEPGTVAYSRELQLALLQATTDEMARNGCKKILIVNGHGGNVSLLPYFAQSQLDKPHDYVVYLFDERTPASGGPKKKTTVDAHAGESETSKMMVVRPDLLHPDRAAAESGTDQHRLNLPDGVYTGIWWYARFPDHYAGDGSAATRELGEYQMKWWIDSVSKAIAAIKADDVSLKLQNEFYEKSAHPLATPQ

Samples

Sample ID Description Type Environment
1 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
125 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
126 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
140 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
160 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
234 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
235 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.95
Isolates 0.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 2.36
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 15.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157379_10070347 3300014968 Unclassified 3131
2 Ga0070658_10202723 3300005327 Unclassified 1674
3 Ga0070658_10212806 3300005327 Bacteria 1633
4 Ga0070670_100067638 3300005331 Bacteria 3065
5 Ga0070666_10002688 3300005335 Bacteria 10728
6 Ga0070680_100039917 3300005336 Bacteria 3798
7 Ga0070682_100321272 3300005337 Unclassified 1143
8 Ga0070689_100228907 3300005340 Bacteria 1527
9 Ga0070661_100053465 3300005344 Bacteria 2956
10 Ga0070661_100096927 3300005344 Bacteria 2189
11 Ga0070671_100009331 3300005355 Bacteria 7878
12 Ga0070671_100298198 3300005355 Unclassified 1372
13 Ga0070673_100005231 3300005364 Bacteria 8284
14 Ga0070709_10190650 3300005434 Unclassified 1446
15 Ga0070709_10202339 3300005434 Bacteria 1407
16 Ga0070714_100000099 3300005435 Bacteria 73629
17 Ga0070714_100084928 3300005435 Bacteria 2763
18 Ga0070714_100108818 3300005435 Bacteria 2451
19 Ga0070713_100000021 3300005436 Bacteria 107806
20 Ga0070713_100000203 3300005436 Bacteria 39626
21 Ga0070713_100055500 3300005436 Bacteria 3292
22 Ga0070713_100055848 3300005436 Bacteria 3283
23 Ga0070713_100605011 3300005436 Bacteria 1041
24 Ga0070710_10001681 3300005437 Bacteria 10423
25 Ga0070710_10033712 3300005437 Bacteria 2782
26 Ga0070710_10038562 3300005437 Unclassified 2625
27 Ga0070711_100000077 3300005439 Bacteria 54563
28 Ga0070708_100001275 3300005445 Bacteria 19393
29 Ga0070708_100022003 3300005445 Bacteria 5404
30 Ga0070708_100093680 3300005445 Bacteria 2739
31 Ga0070708_100269532 3300005445 Bacteria 1601
32 Ga0070678_100030349 3300005456 Bacteria 3716
33 Ga0070681_10014011 3300005458 Bacteria 7979
34 Ga0070681_10049169 3300005458 Bacteria 4212
35 Ga0068867_100014128 3300005459 Bacteria 5657
36 Ga0070706_100054320 3300005467 Bacteria 3697
37 Ga0070706_100058631 3300005467 Unclassified 3553
38 Ga0070707_100009036 3300005468 Bacteria 9243
39 Ga0070707_100026133 3300005468 Bacteria 5540
40 Ga0070707_100041831 3300005468 Unclassified 4386
41 Ga0070698_100000133 3300005471 Bacteria 65381
42 Ga0070699_100019153 3300005518 Bacteria 5888
43 Ga0070699_100085986 3300005518 Bacteria 2744
44 Ga0070697_100007425 3300005536 Bacteria 8534
45 Ga0070697_100067356 3300005536 Bacteria 2929
46 Ga0070697_100122086 3300005536 Bacteria 2180
47 Ga0070693_100020826 3300005547 Bacteria 3466
48 Ga0070665_100038121 3300005548 Bacteria 4831
49 Ga0070665_100073813 3300005548 Bacteria 3417
50 Ga0070704_100052357 3300005549 Unclassified 2880
51 Ga0068855_100026793 3300005563 Bacteria 6896
52 Ga0070664_100000942 3300005564 Bacteria 22742
53 Ga0068857_100044297 3300005577 Bacteria 3947
54 Ga0068854_100083305 3300005578 Bacteria 2365
55 Ga0068856_100005998 3300005614 Bacteria 11960
56 Ga0068856_100012860 3300005614 Bacteria 8100
57 Ga0068852_100121514 3300005616 Bacteria 2392
58 Ga0068861_100344479 3300005719 Bacteria 1305
59 Ga0068870_10034813 3300005840 Bacteria 2579
60 Ga0068863_100001861 3300005841 Bacteria 20976
61 Ga0068863_100007165 3300005841 Bacteria 10939
62 Ga0068863_100024898 3300005841 Bacteria 5708
63 Ga0068858_100007558 3300005842 Bacteria 10501
64 Ga0068860_100039164 3300005843 Bacteria 4534
65 Ga0068860_100043295 3300005843 Bacteria 4296
66 Ga0081539_10035313 3300005985 Unclassified 3007
67 Ga0070717_10000861 3300006028 Bacteria 20088
68 Ga0070717_10002498 3300006028 Bacteria 12981
69 Ga0070717_10009588 3300006028 Bacteria 7283
70 Ga0070717_10040195 3300006028 Bacteria 3809
71 Ga0070717_10089158 3300006028 Unclassified 2601
72 Ga0070717_10294257 3300006028 Bacteria 1442
73 Ga0070717_10451928 3300006028 Bacteria 1158
74 Ga0070716_100004215 3300006173 Bacteria 6845
75 Ga0070716_100008927 3300006173 Bacteria 4986
76 Ga0070716_100066423 3300006173 Bacteria 2104
77 Ga0070716_100196122 3300006173 Bacteria 1338
78 Ga0070712_100000269 3300006175 Bacteria 29183
79 Ga0070712_100000440 3300006175 Bacteria 23727
80 Ga0070712_100003734 3300006175 Bacteria 9375
81 Ga0070712_100028001 3300006175 Unclassified 3766
82 Ga0070712_100041195 3300006175 Unclassified 3170
83 Ga0075367_10009168 3300006178 Bacteria 5160
84 Ga0097621_100000554 3300006237 Bacteria 26269
85 Ga0097621_100315261 3300006237 Bacteria 1384
86 Ga0068871_100022585 3300006358 Bacteria 4853
87 Ga0068871_100185818 3300006358 Bacteria 1788
88 Ga0075434_100247713 3300006871 Unclassified 1801
89 Ga0075436_100005052 3300006914 Bacteria 9078
90 Ga0075436_100030956 3300006914 Unclassified 3682
91 Ga0099794_10045508 3300007265 Bacteria 2100
92 Ga0099795_10039919 3300007788 Bacteria 1664
93 Ga0105240_10001010 3300009093 Bacteria 50200
94 Ga0105240_10112971 3300009093 Bacteria 3283
95 Ga0105245_10004799 3300009098 Bacteria 11930
96 Ga0105245_10412867 3300009098 Bacteria 1351
97 Ga0114129_10024516 3300009147 Bacteria 8547
98 Ga0105241_10002935 3300009174 Bacteria 12729
99 Ga0105242_10123055 3300009176 Bacteria 2229
100 Ga0105242_10134835 3300009176 Bacteria 2136
101 Ga0105248_10023224 3300009177 Bacteria 6887
102 Ga0105248_10059948 3300009177 Bacteria 4274
103 Ga0105248_10149863 3300009177 Bacteria 2632
104 Ga0105237_10003004 3300009545 Bacteria 20366
105 Ga0105237_10074760 3300009545 Bacteria 3380
106 Ga0105238_10547452 3300009551 Bacteria 1161
107 Ga0099796_10065289 3300010159 Bacteria 1301
108 Ga0105239_10045709 3300010375 Bacteria 4799
109 Ga0105239_10300932 3300010375 Bacteria 1806
110 Ga0105239_10319333 3300010375 Unclassified 1751
111 Ga0157373_10004519 3300013100 Bacteria 10461
112 Ga0157370_10033164 3300013104 Bacteria 5035
113 Ga0157369_10195205 3300013105 Bacteria 2126
114 Ga0157369_10261591 3300013105 Bacteria 1804
115 Ga0157369_10305504 3300013105 Bacteria 1655
116 Ga0157374_10001617 3300013296 Bacteria 18892
117 Ga0157374_10002942 3300013296 Bacteria 14272
118 Ga0157374_10079086 3300013296 Bacteria 3115
119 Ga0157378_10000062 3300013297 Bacteria 94916
120 Ga0157378_10000437 3300013297 Bacteria 40470
121 Ga0163162_10000264 3300013306 Bacteria 47545
122 Ga0157372_10002657 3300013307 Bacteria 19372
123 Ga0157372_10003766 3300013307 Bacteria 16289
124 Ga0157372_10083412 3300013307 Bacteria 3620
125 Ga0163163_10003008 3300014325 Bacteria 14268
126 Ga0163163_10008455 3300014325 Bacteria 9147
127 Ga0163163_10199614 3300014325 Unclassified 2048
128 Ga0163163_10208558 3300014325 Bacteria 2002
129 Ga0163163_10288028 3300014325 Bacteria 1694
130 Ga0157376_10027588 3300014969 Unclassified 4503
131 Ga0157376_10128597 3300014969 Bacteria 2257
132 Ga0213872_10002164 3300021361 Bacteria 11778
133 Ga0213874_10080122 3300021377 Bacteria 1056
134 Ga0213876_10193001 3300021384 Bacteria 1083
135 Ga0213875_10000019 3300021388 Bacteria 231333
136 Ga0224569_100391 3300022732 Bacteria 3713
137 Ga0224572_1007858 3300024225 Bacteria 1962
138 Ga0224572_1017301 3300024225 Bacteria 1384
139 Ga0228598_1003468 3300024227 Bacteria 3394
140 Ga0228598_1021570 3300024227 Bacteria 1267
141 Ga0207692_10004772 3300025898 Bacteria 5387
142 Ga0207692_10097740 3300025898 Bacteria 1605
143 Ga0207642_10006034 3300025899 Bacteria 4003
144 Ga0207680_10014231 3300025903 Bacteria 4110
145 Ga0207699_10000364 3300025906 Bacteria 23996
146 Ga0207699_10006881 3300025906 Bacteria 5530
147 Ga0207699_10161522 3300025906 Bacteria 1491
148 Ga0207699_10179143 3300025906 Bacteria 1423
149 Ga0207699_10191012 3300025906 Unclassified 1382
150 Ga0207643_10192729 3300025908 Bacteria 1238
151 Ga0207684_10000283 3300025910 Bacteria 73904
152 Ga0207684_10132328 3300025910 Bacteria 2141
153 Ga0207684_10281132 3300025910 Bacteria 1435
154 Ga0207707_10005801 3300025912 Bacteria 10792
155 Ga0207707_10005818 3300025912 Bacteria 10774
156 Ga0207707_10049877 3300025912 Bacteria 3647
157 Ga0207695_10007147 3300025913 Bacteria 14287
158 Ga0207695_10010144 3300025913 Bacteria 11556
159 Ga0207695_10031530 3300025913 Bacteria 5810
160 Ga0207693_10000047 3300025915 Bacteria 100876
161 Ga0207693_10000050 3300025915 Bacteria 100076
162 Ga0207693_10001883 3300025915 Bacteria 18348
163 Ga0207693_10118961 3300025915 Bacteria 2075
164 Ga0207663_10028382 3300025916 Bacteria 3275
165 Ga0207663_10078479 3300025916 Bacteria 2153
166 Ga0207649_10023659 3300025920 Bacteria 3561
167 Ga0207649_10102987 3300025920 Bacteria 1893
168 Ga0207652_10174591 3300025921 Bacteria 1929
169 Ga0207652_10485264 3300025921 Bacteria 1113
170 Ga0207646_10003114 3300025922 Bacteria 19045
171 Ga0207646_10111639 3300025922 Bacteria 2453
172 Ga0207650_10050835 3300025925 Bacteria 3066
173 Ga0207650_10180496 3300025925 Bacteria 1682
174 Ga0207687_10050967 3300025927 Unclassified 2884
175 Ga0207687_10485840 3300025927 Bacteria 1029
176 Ga0207700_10000136 3300025928 Bacteria 43796
177 Ga0207700_10000316 3300025928 Bacteria 28259
178 Ga0207700_10065485 3300025928 Unclassified 2772
179 Ga0207700_10264601 3300025928 Unclassified 1474
180 Ga0207664_10000647 3300025929 Bacteria 24129
181 Ga0207664_10019757 3300025929 Bacteria 4985
182 Ga0207664_10091450 3300025929 Bacteria 2495
183 Ga0207644_10241902 3300025931 Unclassified 1437
184 Ga0207670_10052633 3300025936 Bacteria 2738
185 Ga0207665_10005107 3300025939 Bacteria 8765
186 Ga0207665_10010682 3300025939 Bacteria 6029
187 Ga0207665_10010870 3300025939 Bacteria 5975
188 Ga0207665_10025723 3300025939 Unclassified 3883
189 Ga0207665_10238554 3300025939 Bacteria 1339
190 Ga0207665_10406257 3300025939 Bacteria 1038
191 Ga0207711_10052773 3300025941 Bacteria 3486
192 Ga0207711_10232983 3300025941 Bacteria 1687
193 Ga0207679_10020387 3300025945 Bacteria 4474
194 Ga0207667_10023827 3300025949 Bacteria 6737
195 Ga0207651_10095103 3300025960 Bacteria 2193
196 Ga0207677_10079775 3300026023 Bacteria 2342
197 Ga0207702_10001499 3300026078 Bacteria 23079
198 Ga0207702_10018724 3300026078 Bacteria 5728
199 Ga0207702_10087889 3300026078 Bacteria 2714
200 Ga0207702_10259288 3300026078 Bacteria 1636
201 Ga0207641_10017715 3300026088 Bacteria 5835
202 Ga0207641_10024170 3300026088 Bacteria 5009
203 Ga0207641_10180073 3300026088 Unclassified 1935
204 Ga0207648_10039799 3300026089 Bacteria 4132
205 Ga0207676_10222904 3300026095 Unclassified 1680
206 Ga0207674_10000502 3300026116 Bacteria 51641
207 Ga0207674_10031828 3300026116 Bacteria 5536
208 Ga0207675_100519265 3300026118 Bacteria 1187
209 Ga0207683_10047930 3300026121 Bacteria 3741
210 Ga0265356_1000834 3300028017 Bacteria 5108
211 Ga0268266_10003332 3300028379 Bacteria 16090
212 Ga0268266_10014163 3300028379 Bacteria 6862
213 Ga0268264_10003401 3300028381 Bacteria 13737
214 Ga0265338_10001949 3300028800 Bacteria 32187
215 Ga0265338_10098791 3300028800 Bacteria 2387
216 Ga0265338_10103632 3300028800 Bacteria 2310
217 Ga0265762_1020882 3300030760 Viruses 1205
218 Ga0265760_10000233 3300031090 Bacteria 15186
219 Ga0265760_10000408 3300031090 Bacteria 12026
220 Ga0265760_10007763 3300031090 Unclassified 3066
221 Ga0265325_10028481 3300031241 Bacteria 3011
222 Ga0265339_10030396 3300031249 Bacteria 3059
223 Ga0265339_10119288 3300031249 Bacteria 1358
224 Ga0265316_10017544 3300031344 Bacteria 6181
225 Ga0265314_10015926 3300031711 Bacteria 5953
226 Ga0265342_10084177 3300031712 Bacteria 1832
227 Ga0307510_10204134 3300033180 Bacteria 1507
228 Ga0373926_0037088 3300035083 Bacteria 1733
229 Ga0373934_0115516 3300035086 Bacteria 1090
230 Ga0373923_0004526 3300035111 Bacteria 4622
231 Ga0373923_0144302 3300035111 Bacteria 1077
232 Ga0373936_0009910 3300035113 Bacteria 3596
233 Ga0373936_0014035 3300035113 Bacteria 3060
234 Ga0373936_0046594 3300035113 Unclassified 1748
235 Ga0373953_0105890 3300035117 Bacteria 1186
236 Ga0373954_0020028 3300035118 Bacteria 3022
237 Ga0373957_0011243 3300035120 Bacteria 2982
238 Ga0373943_0000252 3300035170 Bacteria 21931
239 Ga0373943_0035406 3300035170 Unclassified 2386
240 Ga0373946_0001625 3300035171 Bacteria 7832
241 Ga0373924_0009403 3300035410 Bacteria 3581
242 Ga0373935_0005106 3300035692 Bacteria 7731
243 Ga0373935_0013986 3300035692 Bacteria 4846
244 Ga0373935_0028560 3300035692 Unclassified 3447
245 Ga0373927_0000484 3300035695 Bacteria 30616
246 Ga0373927_0056793 3300035695 Bacteria 2531
247 Ga0373927_0064048 3300035695 Bacteria 2378
248 Ga0373933_0073393 3300035724 Bacteria 2084
249 Ga0373933_0337763 3300035724 Unclassified 978
250 Ga0373947_0001324 3300035725 Bacteria 15241
251 Ga0373937_0007715 3300036401 Bacteria 9326
252 Ga0373937_0098533 3300036401 Bacteria 2711
253 Ga0373937_0236494 3300036401 Bacteria 1720
254 Ga0373937_0260843 3300036401 Bacteria 1634
255 Ga0373925_0001989 3300037068 Bacteria 16928
256 Ga0373925_0004750 3300037068 Bacteria 10236
257 Ga0373925_0012868 3300037068 Bacteria 6060
258 Ga0373925_0061985 3300037068 Bacteria 2811
259 Ga0373925_0240321 3300037068 Bacteria 1450
260 Ga0436364_0026955 3300037853 Bacteria 9629
261 Ga0436364_0278774 3300037853 Bacteria 400541
262 Ga0436364_0539953 3300037853 Unclassified 2667
263 Ga0436365_0113516 3300039437 Bacteria 2620
264 Ga0436365_1560009 3300039437 Bacteria 3827
265 Ga0436361_0139021 3300039447 Bacteria 59763
266 Ga0436363_0795955 3300039450 Bacteria 2079
267 Ga0436362_0997880 3300039453 Unclassified 1233
268 Ga0466959_0345986 3300045049 Bacteria 1014
269 Ga0451576_0748314 3300045051 Unclassified 1027
270 Ga0451576_0944395 3300045051 Unclassified 904
271 Ga0466958_0297909 3300045836 Bacteria 1035
272 Ga0466967_0077161 3300045976 Bacteria 2998
273 Ga0466967_0325009 3300045976 Unclassified 1484
274 Ga0466967_0423820 3300045976 Bacteria 1297
275 Ga0495603_0079681 3300046455 Unclassified 1920
276 Ga0495629_0005419 3300046459 Bacteria 9517
277 Ga0495629_0028698 3300046459 Bacteria 3949
278 Ga0495629_0032715 3300046459 Bacteria 3681
279 Ga0495638_0090709 3300046460 Bacteria 1842
280 Ga0495638_0133079 3300046460 Bacteria 1459
281 Ga0495651_0043745 3300046462 Unclassified 3473
282 Ga0495653_0012370 3300046463 Bacteria 6965
283 Ga0495653_0161782 3300046463 Bacteria 1553
284 Ga0495650_0000037 3300046471 Bacteria 390090
285 Ga0495650_0006960 3300046471 Bacteria 6916
286 Ga0495580_0001147 3300046472 Bacteria 23331
287 Ga0495580_0002001 3300046472 Bacteria 17936
288 Ga0495580_0005141 3300046472 Bacteria 10883
289 Ga0495580_0021887 3300046472 Unclassified 4713
290 Ga0495580_0034956 3300046472 Bacteria 3615
291 Ga0495580_0071660 3300046472 Bacteria 2421
292 Ga0495580_0072336 3300046472 Bacteria 2408
293 Ga0495580_0080320 3300046472 Bacteria 2274
294 Ga0495580_0084838 3300046472 Bacteria 2206
295 Ga0495580_0105638 3300046472 Unclassified 1956
296 Ga0495580_0186217 3300046472 Unclassified 1433
297 Ga0495580_0266062 3300046472 Bacteria 1172
298 Ga0495582_0000902 3300046473 Bacteria 16512
299 Ga0495582_0023944 3300046473 Bacteria 3338
300 Ga0495639_0001160 3300046475 Bacteria 11914
301 Ga0495639_0115577 3300046475 Unclassified 1276
302 Ga0495662_0000422 3300046476 Bacteria 18945
303 Ga0495664_0012123 3300046477 Bacteria 4877
304 Ga0495664_0036076 3300046477 Unclassified 2913
305 Ga0495664_0052635 3300046477 Bacteria 2420
306 Ga0495664_0073648 3300046477 Bacteria 2042
307 Ga0495664_0126236 3300046477 Bacteria 1548
308 Ga0495664_0144203 3300046477 Bacteria 1444
309 Ga0495585_0236234 3300046492 Bacteria 916
310 Ga0495594_0000736 3300046499 Bacteria 16798
311 Ga0495594_0001718 3300046499 Bacteria 11357
312 Ga0495594_0006052 3300046499 Bacteria 6215
313 Ga0495596_0020024 3300046500 Bacteria 2742
314 Ga0495583_0015035 3300046506 Bacteria 4232
315 Ga0495606_0207445 3300046507 Bacteria 1112
316 Ga0495608_0292644 3300046511 Bacteria 1009
317 Ga0495618_0083169 3300046514 Unclassified 2045
318 Ga0495628_0045428 3300046516 Unclassified 3492
319 Ga0495628_0143543 3300046516 Bacteria 1821
320 Ga0495630_0177176 3300046517 Bacteria 1625
321 Ga0495630_0201074 3300046517 Unclassified 1520
322 Ga0495631_0084570 3300046518 Bacteria 1367
323 Ga0495644_0000210 3300046523 Bacteria 27505
324 Ga0495666_0002916 3300046526 Bacteria 8566
325 Ga0495652_0029088 3300046529 Bacteria 4854
326 Ga0495652_0175000 3300046529 Bacteria 1653
327 Ga0495652_0186809 3300046529 Bacteria 1585
328 Ga0495665_0001500 3300046531 Bacteria 12515
329 Ga0495665_0002409 3300046531 Bacteria 10104
330 Ga0495665_0186428 3300046531 Unclassified 1077
331 Ga0495640_0025268 3300046533 Bacteria 4310
332 Ga0495586_0002700 3300046535 Bacteria 9598
333 Ga0495587_0249348 3300046536 Unclassified 998
334 Ga0495609_0040907 3300046538 Bacteria 2085
335 Ga0495645_0021818 3300046543 Bacteria 4629
336 Ga0495645_0034853 3300046543 Bacteria 3670
337 Ga0495645_0076047 3300046543 Bacteria 2416
338 Ga0495645_0079879 3300046543 Bacteria 2349
339 Ga0495633_0011516 3300046558 Bacteria 4763
340 Ga0495667_0003727 3300046559 Bacteria 10254
341 Ga0495668_0073302 3300046616 Bacteria 1881
342 Ga0495668_0085241 3300046616 Bacteria 1733
343 Ga0495634_0171828 3300046642 Unclassified 1361
344 Ga0495611_0017509 3300046648 Bacteria 3066
345 Ga0495625_0000074 3300046660 Bacteria 164813
346 Ga0495625_0154895 3300046660 Bacteria 1538
347 Ga0495635_0019283 3300046663 Bacteria 4757
348 Ga0495635_0050035 3300046663 Bacteria 2881
349 Ga0495599_0115662 3300046678 Unclassified 1669
350 Ga0495623_0004440 3300046679 Bacteria 9216
351 Ga0495623_0134003 3300046679 Unclassified 1480
352 Ga0495658_0022883 3300046683 Bacteria 3311
353 Ga0495669_0011982 3300046684 Bacteria 3687
354 Ga0495613_0004411 3300046689 Bacteria 10540
355 Ga0495613_0093715 3300046689 Bacteria 2174
356 Ga0495613_0141730 3300046689 Unclassified 1717
357 Ga0495624_0025683 3300046690 Bacteria 3866
358 Ga0495624_0155544 3300046690 Bacteria 1397
359 Ga0495624_0216282 3300046690 Bacteria 1162
360 Ga0495649_0040427 3300046694 Bacteria 2554
361 Ga0495600_0069781 3300046809 Unclassified 2296
362 Ga0495600_0087795 3300046809 Unclassified 2029
363 Ga0495581_0005033 3300047315 Bacteria 7657
364 Ga0495581_0093856 3300047315 Unclassified 1742
365 Ga0495604_0013026 3300047317 Bacteria 6626
366 Ga0495604_0039387 3300047317 Unclassified 3714
367 Ga0495604_0050343 3300047317 Bacteria 3235
368 Ga0495636_0012043 3300047318 Unclassified 3428
369 Ga0495636_0097055 3300047318 Bacteria 1285
370 Ga0495674_0007832 3300047319 Bacteria 10200
371 Ga0495674_0085878 3300047319 Bacteria 2695
372 Ga0495674_0086842 3300047319 Bacteria 2678
373 Ga0495674_0153421 3300047319 Bacteria 1930
374 Ga0495674_0161134 3300047319 Bacteria 1877
375 Ga0495672_0005632 3300047320 Bacteria 9883
376 Ga0495676_0003253 3300047321 Bacteria 14691
377 Ga0495680_0020075 3300047322 Bacteria 5630
378 Ga0495675_0018546 3300047444 Unclassified 4417
379 Ga0495675_0057242 3300047444 Bacteria 2472
380 Ga0495673_0047019 3300047469 Bacteria 1909
381 Ga0495673_0094242 3300047469 Bacteria 1219
382 Ga0495684_0019599 3300047471 Bacteria 5212
383 Ga0495686_0001240 3300047472 Bacteria 29081
384 Ga0495593_0021562 3300047673 Unclassified 3596
385 Ga0495602_0049601 3300048088 Bacteria 3758
386 Ga0495614_0024541 3300048089 Unclassified 2602
387 Ga0495614_0092948 3300048089 Bacteria 1313
388 Ga0496100_0111816 3300048903 Bacteria 1899
389 Ga0496100_0175645 3300048903 Bacteria 1546
390 Ga0496105_0154679 3300048908 Bacteria 1884
391 Ga0496105_0232265 3300048908 Bacteria 1499
392 Ga0496108_0219187 3300048911 Unclassified 1653
393 Ga0496109_0023660 3300048912 Bacteria 5453
394 Ga0496112_0009060 3300048915 Bacteria 8940
395 Ga0496114_0261089 3300048917 Bacteria 1525
396 Ga0496115_0009686 3300048918 Bacteria 7170
397 Ga0496115_0395982 3300048918 Unclassified 1121
398 Ga0496120_0026897 3300048923 Bacteria 3547
399 Ga0496126_0006989 3300048929 Bacteria 12472
400 Ga0495682_0012532 3300049460 Bacteria 3248
401 Ga0501031_0018224 3300049568 Bacteria 4570
402 Ga0501032_0009133 3300049569 Bacteria 7194
403 Ga0501034_0098159 3300049571 Bacteria 2925
404 Ga0501036_0017273 3300049572 Bacteria 6030
405 Ga0501037_0202215 3300049573 Bacteria 1403
406 Ga0501039_0073084 3300049575 Bacteria 2665
407 Ga0501043_0003110 3300049579 Bacteria 13758
408 Ga0501046_0000377 3300049580 Bacteria 44790
409 Ga0501047_0000390 3300049581 Bacteria 49175
410 Ga0501074_0174481 3300049590 Bacteria 1534
411 Ga0501080_0361380 3300049742 Bacteria 1310
412 Ga0501035_0010759 3300049822 Bacteria 8471
413 Ga0501035_0099845 3300049822 Bacteria 2548
414 Ga0501044_0021742 3300049823 Bacteria 6839
415 nmdc:mga06z11_175254_c1 3300050494 Bacteria 1234
416 nmdc:mga05p37_457655_c1 3300050507 Bacteria 1475
417 nmdc:mga0n895_55812_c1 3300050512 Unclassified 3888
418 nmdc:mga08x19_30566_c1 3300050514 Unclassified 3385
419 Ga0495601_0062685 3300053077 Unclassified 2362
420 Ga0500651_0000039 3300053093 Bacteria 96498
421 Ga0500595_004244 3300053119 Bacteria 6474
422 Ga0500661_003741 3300055283 Bacteria 2856
423 2884218313 2884215851 Bacteria 4554841
424 Ga0157379_10070347
425 Ga0070658_10202723
426 Ga0070658_10212806
427 Ga0070670_100067638
428 Ga0070666_10002688
429 Ga0070680_100039917
430 Ga0070682_100321272
431 Ga0070689_100228907
432 Ga0070661_100053465
433 Ga0070661_100096927
434 Ga0070671_100009331
435 Ga0070671_100298198
436 Ga0070673_100005231
437 Ga0070709_10190650
438 Ga0070709_10202339
439 Ga0070714_100000099
440 Ga0070714_100084928
441 Ga0070714_100108818
442 Ga0070713_100000021
443 Ga0070713_100000203
444 Ga0070713_100055500
445 Ga0070713_100055848
446 Ga0070713_100605011
447 Ga0070710_10001681
448 Ga0070710_10033712
449 Ga0070710_10038562
450 Ga0070711_100000077
451 Ga0070708_100001275
452 Ga0070708_100022003
453 Ga0070708_100093680
454 Ga0070708_100269532
455 Ga0070678_100030349
456 Ga0070681_10014011
457 Ga0070681_10049169
458 Ga0068867_100014128
459 Ga0070706_100054320
460 Ga0070706_100058631
461 Ga0070707_100009036
462 Ga0070707_100026133
463 Ga0070707_100041831
464 Ga0070698_100000133
465 Ga0070699_100019153
466 Ga0070699_100085986
467 Ga0070697_100007425
468 Ga0070697_100067356
469 Ga0070697_100122086
470 Ga0070693_100020826
471 Ga0070665_100038121
472 Ga0070665_100073813
473 Ga0070704_100052357
474 Ga0068855_100026793
475 Ga0070664_100000942
476 Ga0068857_100044297
477 Ga0068854_100083305
478 Ga0068856_100005998
479 Ga0068856_100012860
480 Ga0068852_100121514
481 Ga0068861_100344479
482 Ga0068870_10034813
483 Ga0068863_100001861
484 Ga0068863_100007165
485 Ga0068863_100024898
486 Ga0068858_100007558
487 Ga0068860_100039164
488 Ga0068860_100043295
489 Ga0081539_10035313
490 Ga0070717_10000861
491 Ga0070717_10002498
492 Ga0070717_10009588
493 Ga0070717_10040195
494 Ga0070717_10089158
495 Ga0070717_10294257
496 Ga0070717_10451928
497 Ga0070716_100004215
498 Ga0070716_100008927
499 Ga0070716_100066423
500 Ga0070716_100196122
501 Ga0070712_100000269
502 Ga0070712_100000440
503 Ga0070712_100003734
504 Ga0070712_100028001
505 Ga0070712_100041195
506 Ga0075367_10009168
507 Ga0097621_100000554
508 Ga0097621_100315261
509 Ga0068871_100022585
510 Ga0068871_100185818
511 Ga0075434_100247713
512 Ga0075436_100005052
513 Ga0075436_100030956
514 Ga0099794_10045508
515 Ga0099795_10039919
516 Ga0105240_10001010
517 Ga0105240_10112971
518 Ga0105245_10004799
519 Ga0105245_10412867
520 Ga0114129_10024516
521 Ga0105241_10002935
522 Ga0105242_10123055
523 Ga0105242_10134835
524 Ga0105248_10023224
525 Ga0105248_10059948
526 Ga0105248_10149863
527 Ga0105237_10003004
528 Ga0105237_10074760
529 Ga0105238_10547452
530 Ga0099796_10065289
531 Ga0105239_10045709
532 Ga0105239_10300932
533 Ga0105239_10319333
534 Ga0157373_10004519
535 Ga0157370_10033164
536 Ga0157369_10195205
537 Ga0157369_10261591
538 Ga0157369_10305504
539 Ga0157374_10001617
540 Ga0157374_10002942
541 Ga0157374_10079086
542 Ga0157378_10000062
543 Ga0157378_10000437
544 Ga0163162_10000264
545 Ga0157372_10002657
546 Ga0157372_10003766
547 Ga0157372_10083412
548 Ga0163163_10003008
549 Ga0163163_10008455
550 Ga0163163_10199614
551 Ga0163163_10208558
552 Ga0163163_10288028
553 Ga0157376_10027588
554 Ga0157376_10128597
555 Ga0213872_10002164
556 Ga0213874_10080122
557 Ga0213876_10193001
558 Ga0213875_10000019
559 Ga0224569_100391
560 Ga0224572_1007858
561 Ga0224572_1017301
562 Ga0228598_1003468
563 Ga0228598_1021570
564 Ga0207692_10004772
565 Ga0207692_10097740
566 Ga0207642_10006034
567 Ga0207680_10014231
568 Ga0207699_10000364
569 Ga0207699_10006881
570 Ga0207699_10161522
571 Ga0207699_10179143
572 Ga0207699_10191012
573 Ga0207643_10192729
574 Ga0207684_10000283
575 Ga0207684_10132328
576 Ga0207684_10281132
577 Ga0207707_10005801
578 Ga0207707_10005818
579 Ga0207707_10049877
580 Ga0207695_10007147
581 Ga0207695_10010144
582 Ga0207695_10031530
583 Ga0207693_10000047
584 Ga0207693_10000050
585 Ga0207693_10001883
586 Ga0207693_10118961
587 Ga0207663_10028382
588 Ga0207663_10078479
589 Ga0207649_10023659
590 Ga0207649_10102987
591 Ga0207652_10174591
592 Ga0207652_10485264
593 Ga0207646_10003114
594 Ga0207646_10111639
595 Ga0207650_10050835
596 Ga0207650_10180496
597 Ga0207687_10050967
598 Ga0207687_10485840
599 Ga0207700_10000136
600 Ga0207700_10000316
601 Ga0207700_10065485
602 Ga0207700_10264601
603 Ga0207664_10000647
604 Ga0207664_10019757
605 Ga0207664_10091450
606 Ga0207644_10241902
607 Ga0207670_10052633
608 Ga0207665_10005107
609 Ga0207665_10010682
610 Ga0207665_10010870
611 Ga0207665_10025723
612 Ga0207665_10238554
613 Ga0207665_10406257
614 Ga0207711_10052773
615 Ga0207711_10232983
616 Ga0207679_10020387
617 Ga0207667_10023827
618 Ga0207651_10095103
619 Ga0207677_10079775
620 Ga0207702_10001499
621 Ga0207702_10018724
622 Ga0207702_10087889
623 Ga0207702_10259288
624 Ga0207641_10017715
625 Ga0207641_10024170
626 Ga0207641_10180073
627 Ga0207648_10039799
628 Ga0207676_10222904
629 Ga0207674_10000502
630 Ga0207674_10031828
631 Ga0207675_100519265
632 Ga0207683_10047930
633 Ga0265356_1000834
634 Ga0268266_10003332
635 Ga0268266_10014163
636 Ga0268264_10003401
637 Ga0265338_10001949
638 Ga0265338_10098791
639 Ga0265338_10103632
640 Ga0265762_1020882
641 Ga0265760_10000233
642 Ga0265760_10000408
643 Ga0265760_10007763
644 Ga0265325_10028481
645 Ga0265339_10030396
646 Ga0265339_10119288
647 Ga0265316_10017544
648 Ga0265314_10015926
649 Ga0265342_10084177
650 Ga0307510_10204134
651 Ga0373926_0037088
652 Ga0373934_0115516
653 Ga0373923_0004526
654 Ga0373923_0144302
655 Ga0373936_0009910
656 Ga0373936_0014035
657 Ga0373936_0046594
658 Ga0373953_0105890
659 Ga0373954_0020028
660 Ga0373957_0011243
661 Ga0373943_0000252
662 Ga0373943_0035406
663 Ga0373946_0001625
664 Ga0373924_0009403
665 Ga0373935_0005106
666 Ga0373935_0013986
667 Ga0373935_0028560
668 Ga0373927_0000484
669 Ga0373927_0056793
670 Ga0373927_0064048
671 Ga0373933_0073393
672 Ga0373933_0337763
673 Ga0373947_0001324
674 Ga0373937_0007715
675 Ga0373937_0098533
676 Ga0373937_0236494
677 Ga0373937_0260843
678 Ga0373925_0001989
679 Ga0373925_0004750
680 Ga0373925_0012868
681 Ga0373925_0061985
682 Ga0373925_0240321
683 Ga0436364_0026955
684 Ga0436364_0278774
685 Ga0436364_0539953
686 Ga0436365_0113516
687 Ga0436365_1560009
688 Ga0436361_0139021
689 Ga0436363_0795955
690 Ga0436362_0997880
691 Ga0466959_0345986
692 Ga0451576_0748314
693 Ga0451576_0944395
694 Ga0466958_0297909
695 Ga0466967_0077161
696 Ga0466967_0325009
697 Ga0466967_0423820
698 Ga0495603_0079681
699 Ga0495629_0005419
700 Ga0495629_0028698
701 Ga0495629_0032715
702 Ga0495638_0090709
703 Ga0495638_0133079
704 Ga0495651_0043745
705 Ga0495653_0012370
706 Ga0495653_0161782
707 Ga0495650_0000037
708 Ga0495650_0006960
709 Ga0495580_0001147
710 Ga0495580_0002001
711 Ga0495580_0005141
712 Ga0495580_0021887
713 Ga0495580_0034956
714 Ga0495580_0071660
715 Ga0495580_0072336
716 Ga0495580_0080320
717 Ga0495580_0084838
718 Ga0495580_0105638
719 Ga0495580_0186217
720 Ga0495580_0266062
721 Ga0495582_0000902
722 Ga0495582_0023944
723 Ga0495639_0001160
724 Ga0495639_0115577
725 Ga0495662_0000422
726 Ga0495664_0012123
727 Ga0495664_0036076
728 Ga0495664_0052635
729 Ga0495664_0073648
730 Ga0495664_0126236
731 Ga0495664_0144203
732 Ga0495585_0236234
733 Ga0495594_0000736
734 Ga0495594_0001718
735 Ga0495594_0006052
736 Ga0495596_0020024
737 Ga0495583_0015035
738 Ga0495606_0207445
739 Ga0495608_0292644
740 Ga0495618_0083169
741 Ga0495628_0045428
742 Ga0495628_0143543
743 Ga0495630_0177176
744 Ga0495630_0201074
745 Ga0495631_0084570
746 Ga0495644_0000210
747 Ga0495666_0002916
748 Ga0495652_0029088
749 Ga0495652_0175000
750 Ga0495652_0186809
751 Ga0495665_0001500
752 Ga0495665_0002409
753 Ga0495665_0186428
754 Ga0495640_0025268
755 Ga0495586_0002700
756 Ga0495587_0249348
757 Ga0495609_0040907
758 Ga0495645_0021818
759 Ga0495645_0034853
760 Ga0495645_0076047
761 Ga0495645_0079879
762 Ga0495633_0011516
763 Ga0495667_0003727
764 Ga0495668_0073302
765 Ga0495668_0085241
766 Ga0495634_0171828
767 Ga0495611_0017509
768 Ga0495625_0000074
769 Ga0495625_0154895
770 Ga0495635_0019283
771 Ga0495635_0050035
772 Ga0495599_0115662
773 Ga0495623_0004440
774 Ga0495623_0134003
775 Ga0495658_0022883
776 Ga0495669_0011982
777 Ga0495613_0004411
778 Ga0495613_0093715
779 Ga0495613_0141730
780 Ga0495624_0025683
781 Ga0495624_0155544
782 Ga0495624_0216282
783 Ga0495649_0040427
784 Ga0495600_0069781
785 Ga0495600_0087795
786 Ga0495581_0005033
787 Ga0495581_0093856
788 Ga0495604_0013026
789 Ga0495604_0039387
790 Ga0495604_0050343
791 Ga0495636_0012043
792 Ga0495636_0097055
793 Ga0495674_0007832
794 Ga0495674_0085878
795 Ga0495674_0086842
796 Ga0495674_0153421
797 Ga0495674_0161134
798 Ga0495672_0005632
799 Ga0495676_0003253
800 Ga0495680_0020075
801 Ga0495675_0018546
802 Ga0495675_0057242
803 Ga0495673_0047019
804 Ga0495673_0094242
805 Ga0495684_0019599
806 Ga0495686_0001240
807 Ga0495593_0021562
808 Ga0495602_0049601
809 Ga0495614_0024541
810 Ga0495614_0092948
811 Ga0496100_0111816
812 Ga0496100_0175645
813 Ga0496105_0154679
814 Ga0496105_0232265
815 Ga0496108_0219187
816 Ga0496109_0023660
817 Ga0496112_0009060
818 Ga0496114_0261089
819 Ga0496115_0009686
820 Ga0496115_0395982
821 Ga0496120_0026897
822 Ga0496126_0006989
823 Ga0495682_0012532
824 Ga0501031_0018224
825 Ga0501032_0009133
826 Ga0501034_0098159
827 Ga0501036_0017273
828 Ga0501037_0202215
829 Ga0501039_0073084
830 Ga0501043_0003110
831 Ga0501046_0000377
832 Ga0501047_0000390
833 Ga0501074_0174481
834 Ga0501080_0361380
835 Ga0501035_0010759
836 Ga0501035_0099845
837 Ga0501044_0021742
838 nmdc:mga06z11_175254_c1
839 nmdc:mga05p37_457655_c1
840 nmdc:mga0n895_55812_c1
841 nmdc:mga08x19_30566_c1
842 Ga0495601_0062685
843 Ga0500651_0000039
844 Ga0500595_004244
845 Ga0500661_003741
846 2884218313

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02633

Creatininase

Creatinine amidohydrolase

80

312

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lub-assembly2.cif.gz_L crystal structure of putative creatinine amidohydrolase (yp_211512.1) from bacteroides fragilis nctc 9343 at 2.11 a resolution 0.819 46 273
1q3k-assembly1.cif.gz_A crystal structure of creatinine amidohydrolase (creatininase) 0.7993 25 264
3a6h-assembly1.cif.gz_F w154a mutant creatininase 0.7982 26 270
3a6g-assembly1.cif.gz_C w154f mutant creatininase 0.7965 26 266
3a6f-assembly1.cif.gz_D w174f mutant creatininase, type ii 0.7957 26 266
ID Description Score Start End Superfamily
3a6kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.8014 26 266 3.40.50.10310
3lubB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.7958 46 267 3.40.50.10310
af_P9WP59_13_243_3.40.50.10310 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.7682 28 267 3.40.50.10310
af_P9WP59_13_243_3.40.50.10310 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.7591 28 267 3.40.50.10310
3lubB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Creatininase 0.7552 46 267 3.40.50.10310
ID Description Score Start End GO Terms
AF-A0A1Q7XX32-F1-model_v4 Creatininase 0.9761 22 292 GO:0009231
GO:0016811
GO:0046872
AF-A0A1Q7XX32-F1-model_v4 Creatininase 0.9726 22 292 GO:0009231
GO:0016811
GO:0046872
AF-A0A7W8MYF9-F1-model_v4 deleted 0.9607 21 270
AF-A0A2E8H325-F1-model_v4 Creatininase 0.9588 28 287 GO:0009231
GO:0016811
GO:0046872
AF-A0A2V9B2G4-F1-model_v4 Creatininase 0.9579 112 292 GO:0009231
GO:0016811
GO:0046872

Map