F440495

General Info

Members Datasets Scaffolds Average Seq Length
423 217 846 111

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100410582|Ga0075434_1004105821
Length 109
Sequence MAKQADLMKGTLQLLVLKTLALQRRHGVGIAERIRQITRGTFDVKAGSLFPALHRLEQGGFIRGEWTNTPDGYRAKYYALTPRGQRQLTIERRNWSRVAVAIQQVLEVD

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
91 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
131 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
156 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
172 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
173 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
174 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
175 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
205 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
215 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 2.84
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 36.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100410582 3300006871 Unclassified 1375
2 Ga0065704_10283344 3300005289 Bacteria 918
3 Ga0065712_10079477 3300005290 Bacteria 3213
4 Ga0065715_10644190 3300005293 Bacteria 682
5 Ga0070676_10952146 3300005328 Unclassified 642
6 Ga0070683_100012211 3300005329 Bacteria 7456
7 Ga0070683_100015875 3300005329 Bacteria 6625
8 Ga0070690_101159360 3300005330 Unclassified 615
9 Ga0070680_100048704 3300005336 Unclassified 3454
10 Ga0070682_100111029 3300005337 Unclassified 1827
11 Ga0070682_101562825 3300005337 Unclassified 569
12 Ga0068868_100703988 3300005338 Unclassified 904
13 Ga0070661_100034990 3300005344 Bacteria 3645
14 Ga0070668_100460230 3300005347 Bacteria 1095
15 Ga0070675_100059828 3300005354 Bacteria 3144
16 Ga0070673_100106495 3300005364 Bacteria 2318
17 Ga0070667_100498780 3300005367 Bacteria 1116
18 Ga0070667_100912574 3300005367 Unclassified 818
19 Ga0070703_10009096 3300005406 Unclassified 2802
20 Ga0070709_10007637 3300005434 Bacteria 5934
21 Ga0070709_10018663 3300005434 Bacteria 4000
22 Ga0070709_10247782 3300005434 Bacteria 1282
23 Ga0070709_10296801 3300005434 Bacteria 1179
24 Ga0070709_10323218 3300005434 Unclassified 1133
25 Ga0070709_10748072 3300005434 Unclassified 764
26 Ga0070709_10804778 3300005434 Unclassified 738
27 Ga0070709_11170093 3300005434 Unclassified 617
28 Ga0070714_100070533 3300005435 Unclassified 3021
29 Ga0070714_100213375 3300005435 Unclassified 1770
30 Ga0070714_100781601 3300005435 Unclassified 924
31 Ga0070713_100007491 3300005436 Bacteria 7665
32 Ga0070713_100124610 3300005436 Unclassified 2264
33 Ga0070713_100281052 3300005436 Bacteria 1527
34 Ga0070713_100982019 3300005436 Bacteria 814
35 Ga0070713_101367946 3300005436 Unclassified 686
36 Ga0070713_101441629 3300005436 Bacteria 668
37 Ga0070713_101921427 3300005436 Bacteria 574
38 Ga0070710_10052102 3300005437 Bacteria 2301
39 Ga0070710_10589805 3300005437 Unclassified 772
40 Ga0070710_10720154 3300005437 Unclassified 706
41 Ga0070711_100001871 3300005439 Bacteria 11759
42 Ga0070711_100239419 3300005439 Bacteria 1418
43 Ga0070711_100256368 3300005439 Bacteria 1374
44 Ga0070711_100302113 3300005439 Bacteria 1273
45 Ga0070705_100009689 3300005440 Bacteria 4797
46 Ga0070705_100088180 3300005440 Unclassified 1925
47 Ga0070694_100010607 3300005444 Bacteria 5690
48 Ga0070694_100063962 3300005444 Bacteria 2517
49 Ga0070694_100816701 3300005444 Unclassified 765
50 Ga0070708_100003744 3300005445 Bacteria 11931
51 Ga0070708_100050616 3300005445 Unclassified 3679
52 Ga0070708_101169280 3300005445 Bacteria 720
53 Ga0070663_100058044 3300005455 Bacteria 2778
54 Ga0070678_100141802 3300005456 Bacteria 1924
55 Ga0070706_100001399 3300005467 Bacteria 25498
56 Ga0070706_100039298 3300005467 Bacteria 4368
57 Ga0070707_100701361 3300005468 Archaea 975
58 Ga0070699_100038358 3300005518 Bacteria 4148
59 Ga0070684_100000301 3300005535 Bacteria 34312
60 Ga0070684_100107636 3300005535 Bacteria 2497
61 Ga0070684_100256272 3300005535 Bacteria 1600
62 Ga0070697_100000698 3300005536 Bacteria 25151
63 Ga0070697_100009808 3300005536 Bacteria 7468
64 Ga0070697_100137171 3300005536 Bacteria 2055
65 Ga0070697_100457647 3300005536 Bacteria 1112
66 Ga0070697_100936512 3300005536 Unclassified 769
67 Ga0070672_100424584 3300005543 Bacteria 1142
68 Ga0070686_100848279 3300005544 Unclassified 740
69 Ga0070686_101269884 3300005544 Unclassified 614
70 Ga0070696_100000936 3300005546 Bacteria 18905
71 Ga0070696_101196186 3300005546 Unclassified 642
72 Ga0070693_100000426 3300005547 Bacteria 19036
73 Ga0070665_100100479 3300005548 Bacteria 2897
74 Ga0070665_100392832 3300005548 Unclassified 1395
75 Ga0070665_101433223 3300005548 Bacteria 699
76 Ga0070704_100691847 3300005549 Bacteria 903
77 Ga0068855_101925512 3300005563 Bacteria 598
78 Ga0070664_100002048 3300005564 Bacteria 16145
79 Ga0068856_102590440 3300005614 Unclassified 513
80 Ga0068859_100358425 3300005617 Unclassified 1553
81 Ga0068859_100812583 3300005617 Unclassified 1022
82 Ga0068859_102265700 3300005617 Unclassified 599
83 Ga0068859_103141069 3300005617 Unclassified 503
84 Ga0068864_100315828 3300005618 Bacteria 1466
85 Ga0068864_100679646 3300005618 Unclassified 1004
86 Ga0068866_11173803 3300005718 Bacteria 553
87 Ga0068863_100108148 3300005841 Bacteria 2646
88 Ga0068863_100929053 3300005841 Unclassified 871
89 Ga0068858_100155972 3300005842 Bacteria 2148
90 Ga0068858_100403060 3300005842 Unclassified 1314
91 Ga0068858_100662568 3300005842 Unclassified 1014
92 Ga0068858_100764177 3300005842 Unclassified 942
93 Ga0068858_100853805 3300005842 Bacteria 889
94 Ga0068860_100841094 3300005843 Unclassified 932
95 Ga0068862_102322043 3300005844 Unclassified 548
96 Ga0081539_10300606 3300005985 Bacteria 690
97 Ga0070717_10077462 3300006028 Unclassified 2784
98 Ga0070717_10231216 3300006028 Bacteria 1628
99 Ga0070717_10358492 3300006028 Bacteria 1305
100 Ga0070717_10584395 3300006028 Bacteria 1013
101 Ga0070715_10129415 3300006163 Bacteria 1213
102 Ga0070716_100020762 3300006173 Bacteria 3452
103 Ga0070716_100039722 3300006173 Bacteria 2613
104 Ga0070716_100071719 3300006173 Bacteria 2037
105 Ga0070716_100226078 3300006173 Bacteria 1260
106 Ga0070716_100237803 3300006173 Bacteria 1233
107 Ga0070716_100627446 3300006173 Bacteria 812
108 Ga0070712_100218560 3300006175 Bacteria 1507
109 Ga0070712_101117791 3300006175 Bacteria 684
110 Ga0097621_100130208 3300006237 Bacteria 2141
111 Ga0075428_100096779 3300006844 Bacteria 3217
112 Ga0075428_100407571 3300006844 Bacteria 1457
113 Ga0075430_100469348 3300006846 Unclassified 1039
114 Ga0075430_101289858 3300006846 Unclassified 601
115 Ga0075431_100058964 3300006847 Bacteria 3961
116 Ga0075431_100062824 3300006847 Bacteria 3832
117 Ga0075431_100099454 3300006847 Unclassified 3001
118 Ga0075431_100171527 3300006847 Bacteria 2229
119 Ga0075431_100335357 3300006847 Bacteria 1522
120 Ga0075431_100386341 3300006847 Unclassified 1403
121 Ga0075431_100580303 3300006847 Unclassified 1106
122 Ga0075431_100640621 3300006847 Bacteria 1044
123 Ga0075431_100966418 3300006847 Unclassified 820
124 Ga0075433_10261012 3300006852 Bacteria 1536
125 Ga0075433_10289082 3300006852 Unclassified 1452
126 Ga0075434_100000988 3300006871 Bacteria 23007
127 Ga0075434_100039424 3300006871 Unclassified 4680
128 Ga0075434_100065117 3300006871 Bacteria 3630
129 Ga0075434_100100395 3300006871 Bacteria 2900
130 Ga0075434_102340622 3300006871 Bacteria 537
131 Ga0075429_100174367 3300006880 Bacteria 1884
132 Ga0075429_100466341 3300006880 Unclassified 1106
133 Ga0075429_101024078 3300006880 Unclassified 722
134 Ga0075436_100111786 3300006914 Bacteria 1907
135 Ga0075436_100180888 3300006914 Bacteria 1490
136 Ga0075436_100273664 3300006914 Unclassified 1206
137 Ga0075436_100829897 3300006914 Unclassified 689
138 Ga0097620_100358441 3300006931 Unclassified 1553
139 Ga0097620_100636011 3300006931 Bacteria 1159
140 Ga0097620_100812580 3300006931 Unclassified 1022
141 Ga0097620_102265272 3300006931 Unclassified 599
142 Ga0097620_103141841 3300006931 Unclassified 503
143 Ga0075435_100245411 3300007076 Unclassified 1524
144 Ga0099794_10244569 3300007265 Bacteria 924
145 Ga0099794_10246845 3300007265 Bacteria 920
146 Ga0099794_10372955 3300007265 Unclassified 744
147 Ga0099795_10100149 3300007788 Unclassified 1136
148 Ga0099795_10338243 3300007788 Bacteria 670
149 Ga0105240_10002362 3300009093 Bacteria 30432
150 Ga0105240_10057863 3300009093 Bacteria 4840
151 Ga0105240_12001798 3300009093 Unclassified 602
152 Ga0111539_10036125 3300009094 Bacteria 5977
153 Ga0111539_10317851 3300009094 Unclassified 1812
154 Ga0111539_13543721 3300009094 Unclassified 500
155 Ga0105247_10321801 3300009101 Unclassified 1079
156 Ga0105247_11248227 3300009101 Unclassified 594
157 Ga0105247_11844014 3300009101 Bacteria 504
158 Ga0114129_10010174 3300009147 Bacteria 13410
159 Ga0114129_10100611 3300009147 Bacteria 4000
160 Ga0114129_10222102 3300009147 Bacteria 2548
161 Ga0114129_10233251 3300009147 Bacteria 2478
162 Ga0114129_10488875 3300009147 Unclassified 1609
163 Ga0105243_12853423 3300009148 Unclassified 524
164 Ga0105241_11468706 3300009174 Bacteria 655
165 Ga0105242_12162766 3300009176 Unclassified 601
166 Ga0105248_10066273 3300009177 Bacteria 4055
167 Ga0105248_10134943 3300009177 Bacteria 2784
168 Ga0105248_10273418 3300009177 Bacteria 1902
169 Ga0105248_10303354 3300009177 Bacteria 1798
170 Ga0105248_11203982 3300009177 Bacteria 856
171 Ga0105237_10141552 3300009545 Bacteria 2399
172 Ga0105237_10147625 3300009545 Bacteria 2347
173 Ga0105237_10441796 3300009545 Bacteria 1307
174 Ga0105238_11118445 3300009551 Unclassified 811
175 Ga0105238_13059353 3300009551 Unclassified 502
176 Ga0105249_10172689 3300009553 Bacteria 2097
177 Ga0105249_12429352 3300009553 Bacteria 597
178 Ga0105239_10286271 3300010375 Unclassified 1856
179 Ga0105239_10603930 3300010375 Bacteria 1252
180 Ga0105246_12397949 3300011119 Bacteria 517
181 Ga0157373_10270487 3300013100 Unclassified 1203
182 Ga0157370_10123718 3300013104 Unclassified 2415
183 Ga0157369_10214367 3300013105 Bacteria 2017
184 Ga0157369_11281582 3300013105 Bacteria 747
185 Ga0157374_10192582 3300013296 Bacteria 1994
186 Ga0157378_10034750 3300013297 Bacteria 4458
187 Ga0157372_10125758 3300013307 Bacteria 2948
188 Ga0157375_10556824 3300013308 Bacteria 1308
189 Ga0157375_11103106 3300013308 Bacteria 929
190 Ga0157375_11771171 3300013308 Bacteria 732
191 Ga0163163_10020748 3300014325 Bacteria 6193
192 Ga0163163_10062653 3300014325 Bacteria 3686
193 Ga0163163_10213902 3300014325 Bacteria 1977
194 Ga0163163_10706899 3300014325 Bacteria 1071
195 Ga0163163_10842436 3300014325 Bacteria 980
196 Ga0163163_11759653 3300014325 Bacteria 680
197 Ga0157380_10170383 3300014326 Unclassified 1902
198 Ga0157379_10238599 3300014968 Unclassified 1649
199 Ga0157379_11071724 3300014968 Bacteria 771
200 Ga0157379_11799234 3300014968 Bacteria 602
201 Ga0157376_11921413 3300014969 Bacteria 629
202 Ga0213873_10100700 3300021358 Unclassified 830
203 Ga0213875_10001039 3300021388 Bacteria 19546
204 Ga0213875_10152441 3300021388 Unclassified 1083
205 Ga0224572_1008776 3300024225 Bacteria 1875
206 Ga0228598_1007108 3300024227 Bacteria 2293
207 Ga0207697_10027775 3300025315 Bacteria 2313
208 Ga0207653_10000850 3300025885 Bacteria 10187
209 Ga0207682_10544127 3300025893 Bacteria 549
210 Ga0207692_10063959 3300025898 Unclassified 1914
211 Ga0207692_10628396 3300025898 Unclassified 692
212 Ga0207680_10472342 3300025903 Bacteria 891
213 Ga0207699_10034092 3300025906 Unclassified 2884
214 Ga0207699_10066359 3300025906 Bacteria 2191
215 Ga0207699_10092824 3300025906 Unclassified 1898
216 Ga0207699_10093007 3300025906 Bacteria 1897
217 Ga0207699_10250692 3300025906 Bacteria 1220
218 Ga0207699_10262302 3300025906 Bacteria 1194
219 Ga0207699_10504613 3300025906 Unclassified 873
220 Ga0207699_10936772 3300025906 Unclassified 639
221 Ga0207684_10005467 3300025910 Bacteria 11712
222 Ga0207684_10035082 3300025910 Bacteria 4260
223 Ga0207695_10013271 3300025913 Bacteria 9829
224 Ga0207695_10028537 3300025913 Bacteria 6185
225 Ga0207695_10099512 3300025913 Bacteria 2905
226 Ga0207671_10133146 3300025914 Bacteria 1909
227 Ga0207671_10513050 3300025914 Bacteria 956
228 Ga0207693_10182405 3300025915 Bacteria 1652
229 Ga0207693_10417891 3300025915 Bacteria 1048
230 Ga0207693_10707472 3300025915 Bacteria 780
231 Ga0207693_10889536 3300025915 Unclassified 684
232 Ga0207663_10029307 3300025916 Bacteria 3231
233 Ga0207660_10117276 3300025917 Unclassified 2012
234 Ga0207649_10006301 3300025920 Bacteria 6444
235 Ga0207652_10034476 3300025921 Bacteria 4266
236 Ga0207694_11034459 3300025924 Unclassified 695
237 Ga0207700_10033740 3300025928 Unclassified 3665
238 Ga0207700_10091562 3300025928 Bacteria 2402
239 Ga0207700_10364711 3300025928 Bacteria 1260
240 Ga0207700_10490016 3300025928 Unclassified 1087
241 Ga0207664_10037917 3300025929 Bacteria 3734
242 Ga0207664_10177274 3300025929 Bacteria 1828
243 Ga0207664_10553188 3300025929 Bacteria 1032
244 Ga0207669_11691109 3300025937 Unclassified 540
245 Ga0207665_10024427 3300025939 Bacteria 3984
246 Ga0207665_10254154 3300025939 Bacteria 1300
247 Ga0207665_10339352 3300025939 Bacteria 1132
248 Ga0207665_10773140 3300025939 Unclassified 758
249 Ga0207665_11454131 3300025939 Bacteria 545
250 Ga0207711_10194841 3300025941 Bacteria 1848
251 Ga0207711_10210377 3300025941 Bacteria 1776
252 Ga0207711_11089124 3300025941 Bacteria 740
253 Ga0207711_11172741 3300025941 Bacteria 709
254 Ga0207661_10030342 3300025944 Bacteria 4164
255 Ga0207661_10100903 3300025944 Bacteria 2423
256 Ga0207679_10898104 3300025945 Bacteria 810
257 Ga0207667_11597125 3300025949 Bacteria 621
258 Ga0207651_10065463 3300025960 Bacteria 2549
259 Ga0207712_10219994 3300025961 Unclassified 1517
260 Ga0207668_10723441 3300025972 Unclassified 876
261 Ga0207640_11578260 3300025981 Unclassified 591
262 Ga0207658_10571584 3300025986 Unclassified 1013
263 Ga0207658_11007207 3300025986 Bacteria 760
264 Ga0207703_10621825 3300026035 Bacteria 1023
265 Ga0207639_10186295 3300026041 Bacteria 1770
266 Ga0207639_10684607 3300026041 Bacteria 950
267 Ga0207678_10067909 3300026067 Bacteria 3059
268 Ga0207702_11206168 3300026078 Unclassified 751
269 Ga0207641_10063416 3300026088 Bacteria 3157
270 Ga0207676_10854870 3300026095 Bacteria 890
271 Ga0207676_10998863 3300026095 Unclassified 824
272 Ga0207674_10523644 3300026116 Bacteria 1145
273 Ga0207683_10169260 3300026121 Bacteria 1978
274 Ga0209179_1005892 3300027512 Bacteria 1945
275 Ga0207428_10369262 3300027907 Unclassified 1054
276 Ga0207428_10442397 3300027907 Unclassified 948
277 Ga0265354_1003478 3300028016 Bacteria 1758
278 Ga0265357_1003603 3300028023 Bacteria 1351
279 Ga0268266_10198272 3300028379 Bacteria 1836
280 Ga0268264_10429645 3300028381 Bacteria 1275
281 Ga0265760_10296701 3300031090 Unclassified 572
282 Ga0265339_10202427 3300031249 Unclassified 979
283 Ga0265331_10086324 3300031250 Bacteria 1454
284 Ga0265314_10200126 3300031711 Bacteria 1182
285 Ga0307405_11209639 3300031731 Unclassified 654
286 Ga0307412_11047977 3300031911 Bacteria 723
287 Ga0307416_102475748 3300032002 Bacteria 618
288 Ga0307414_11510183 3300032004 Bacteria 625
289 Ga0373939_0041552 3300035114 Unclassified 1386
290 Ga0373941_0383859 3300035115 Unclassified 578
291 Ga0373953_0123241 3300035117 Unclassified 1102
292 Ga0373956_0343267 3300035119 Unclassified 712
293 Ga0373960_0460195 3300035121 Bacteria 500
294 Ga0373955_0092076 3300035172 Bacteria 1729
295 Ga0373931_0041304 3300035691 Bacteria 2422
296 Ga0373935_0595257 3300035692 Unclassified 808
297 Ga0373935_0978004 3300035692 Bacteria 628
298 Ga0373937_0116589 3300036401 Bacteria 2487
299 Ga0373937_0467863 3300036401 Bacteria 1197
300 Ga0373937_0780338 3300036401 Unclassified 903
301 Ga0373937_1074228 3300036401 Bacteria 754
302 Ga0373925_1303691 3300037068 Bacteria 596
303 Ga0395900_1368719 3300037418 Unclassified 621
304 Ga0436364_0204952 3300037853 Unclassified 2176
305 Ga0436364_0807075 3300037853 Bacteria 20712
306 Ga0436364_1269553 3300037853 Unclassified 2014
307 Ga0436364_1477331 3300037853 Unclassified 1473
308 Ga0436364_1509407 3300037853 Unclassified 556
309 Ga0436365_0378754 3300039437 Bacteria 5677
310 Ga0436360_0094871 3300039438 Bacteria 9220
311 Ga0436362_0518050 3300039453 Unclassified 993
312 Ga0436362_1244206 3300039453 Bacteria 2399
313 Ga0451577_0282704 3300042876 Bacteria 1503
314 Ga0451577_0475192 3300042876 Bacteria 1135
315 Ga0451577_1526341 3300042876 Unclassified 590
316 Ga0453683_0198484 3300044673 Unclassified 1274
317 Ga0466959_0232627 3300045049 Bacteria 1275
318 Ga0466959_0700503 3300045049 Bacteria 679
319 Ga0451576_0144784 3300045051 Bacteria 2478
320 Ga0466958_0036514 3300045836 Bacteria 2942
321 Ga0466958_0102577 3300045836 Bacteria 1780
322 Ga0495580_0112372 3300046472 Bacteria 1892
323 Ga0495580_0265464 3300046472 Bacteria 1173
324 Ga0495582_0038818 3300046473 Unclassified 2621
325 Ga0495664_0711369 3300046477 Bacteria 593
326 Ga0495594_0058843 3300046499 Bacteria 2124
327 Ga0495608_0358991 3300046511 Bacteria 896
328 Ga0495628_0070366 3300046516 Unclassified 2728
329 Ga0495628_0117110 3300046516 Bacteria 2046
330 Ga0495630_0493274 3300046517 Bacteria 939
331 Ga0495666_0149355 3300046526 Bacteria 1087
332 Ga0495652_0961894 3300046529 Bacteria 560
333 Ga0495640_0428973 3300046533 Bacteria 809
334 Ga0495640_0591257 3300046533 Unclassified 671
335 Ga0495586_0696329 3300046535 Unclassified 587
336 Ga0495587_0274680 3300046536 Unclassified 945
337 Ga0495587_0393805 3300046536 Unclassified 770
338 Ga0495645_0526730 3300046543 Bacteria 735
339 Ga0495645_0691698 3300046543 Bacteria 620
340 Ga0495667_0314607 3300046559 Unclassified 991
341 Ga0495635_0411787 3300046663 Unclassified 897
342 Ga0495635_0679061 3300046663 Unclassified 669
343 Ga0495623_0147133 3300046679 Bacteria 1396
344 Ga0495623_0182614 3300046679 Bacteria 1217
345 Ga0495623_0335267 3300046679 Unclassified 827
346 Ga0495658_0102027 3300046683 Bacteria 1714
347 Ga0495613_0456069 3300046689 Bacteria 866
348 Ga0495671_0457362 3300046692 Bacteria 610
349 Ga0495674_0073487 3300047319 Unclassified 2947
350 Ga0495674_0249662 3300047319 Bacteria 1460
351 Ga0495674_0320330 3300047319 Bacteria 1263
352 Ga0495674_0511065 3300047319 Bacteria 960
353 Ga0495675_0095123 3300047444 Bacteria 1868
354 Ga0495675_0429602 3300047444 Bacteria 766
355 Ga0495675_0802382 3300047444 Unclassified 521
356 Ga0495684_0157179 3300047471 Unclassified 1698
357 Ga0495684_0164927 3300047471 Bacteria 1651
358 Ga0495602_0268909 3300048088 Bacteria 1261
359 Ga0495602_0271381 3300048088 Unclassified 1254
360 Ga0495602_0337882 3300048088 Bacteria 1090
361 Ga0496104_0021887 3300048907 Bacteria 5872
362 Ga0496105_0134075 3300048908 Bacteria 2041
363 Ga0496106_0687947 3300048909 Unclassified 816
364 Ga0496108_1638395 3300048911 Unclassified 531
365 Ga0496109_0000027 3300048912 Bacteria 169870
366 Ga0496109_0026573 3300048912 Bacteria 5163
367 Ga0496110_0198110 3300048913 Bacteria 1824
368 Ga0496110_1815398 3300048913 Bacteria 520
369 Ga0496111_0071559 3300048914 Bacteria 2524
370 Ga0496112_0003645 3300048915 Bacteria 12829
371 Ga0496113_0029248 3300048916 Bacteria 3976
372 Ga0496115_0419724 3300048918 Unclassified 1084
373 Ga0501031_0876599 3300049568 Bacteria 575
374 Ga0501039_0184863 3300049575 Bacteria 1639
375 Ga0501040_1059965 3300049576 Bacteria 588
376 Ga0501041_0911845 3300049577 Unclassified 565
377 Ga0501042_1074311 3300049578 Unclassified 587
378 Ga0501071_1217432 3300049587 Unclassified 582
379 Ga0501072_0975455 3300049588 Unclassified 661
380 Ga0501073_1054528 3300049589 Unclassified 559
381 Ga0501233_207275 3300049668 Bacteria 573
382 Ga0501081_0658306 3300049743 Unclassified 785
383 Ga0501045_0400769 3300049824 Bacteria 1021
384 nmdc:mga05p37_29068_c1 3300050507 Bacteria 6746
385 nmdc:mga05p37_29252_c1 3300050507 Bacteria 6725
386 nmdc:mga05p37_340074_c1 3300050507 Unclassified 1770
387 nmdc:mga05p37_455437_c1 3300050507 Bacteria 1480
388 nmdc:mga05p37_546146_c1 3300050507 Bacteria 1320
389 nmdc:mga05p37_702628_c1 3300050507 Bacteria 1123
390 nmdc:mga09592_206290_c1 3300050508 Bacteria 1702
391 nmdc:mga09592_529716_c1 3300050508 Bacteria 1013
392 nmdc:mga09592_65387_c1 3300050508 Bacteria 3081
393 nmdc:mga0qj67_451025_c1 3300050509 Unclassified 1036
394 nmdc:mga0qj67_499066_c1 3300050509 Bacteria 978
395 nmdc:mga0qj67_956728_c1 3300050509 Unclassified 673
396 nmdc:mga06r32_104977_c1 3300050510 Bacteria 2775
397 nmdc:mga06r32_1199278_c1 3300050510 Unclassified 705
398 nmdc:mga06r32_158409_c1 3300050510 Bacteria 2246
399 nmdc:mga06r32_1651027_c1 3300050510 Unclassified 579
400 nmdc:mga06r32_1733109_c1 3300050510 Unclassified 561
401 nmdc:mga06r32_23416_c1 3300050510 Bacteria 5713
402 nmdc:mga06r32_38210_c1 3300050510 Bacteria 4546
403 nmdc:mga06r32_52657_c2 3300050510 Unclassified 3065
404 nmdc:mga06r32_573522_c1 3300050510 Bacteria 1101
405 nmdc:mga06r32_840918_c1 3300050510 Bacteria 877
406 nmdc:mga06r32_919206_c1 3300050510 Unclassified 831
407 nmdc:mga08y16_30419_c1 3300050511 Bacteria 5683
408 nmdc:mga08y16_3702_c1 3300050511 Bacteria 15914
409 nmdc:mga0n895_105143_c1 3300050512 Bacteria 2835
410 nmdc:mga0n895_15653_c1 3300050512 Bacteria 6926
411 nmdc:mga0n895_62238_c1 3300050512 Bacteria 3687
412 nmdc:mga0rr50_40841_c1 3300050513 Unclassified 3375
413 nmdc:mga0rr50_699811_c1 3300050513 Unclassified 865
414 nmdc:mga0rr50_855964_c1 3300050513 Unclassified 775
415 nmdc:mga0a205_1140265_c1 3300050515 Unclassified 627
416 nmdc:mga0a205_153446_c2 3300050515 Bacteria 1457
417 nmdc:mga0a205_39727_c1 3300050515 Bacteria 4528
418 nmdc:mga0a205_477410_c1 3300050515 Unclassified 1105
419 Ga0500555_001907 3300053103 Bacteria 6188
420 Ga0500579_169247 3300053143 Unclassified 895
421 Ga0501084_0195906 3300054114 Unclassified 1704
422 Ga0501082_0000083 3300060353 Bacteria 70665
423 Ga0501082_0135033 3300060353 Bacteria 2141
424 Ga0075434_100410582
425 Ga0065704_10283344
426 Ga0065712_10079477
427 Ga0065715_10644190
428 Ga0070676_10952146
429 Ga0070683_100012211
430 Ga0070683_100015875
431 Ga0070690_101159360
432 Ga0070680_100048704
433 Ga0070682_100111029
434 Ga0070682_101562825
435 Ga0068868_100703988
436 Ga0070661_100034990
437 Ga0070668_100460230
438 Ga0070675_100059828
439 Ga0070673_100106495
440 Ga0070667_100498780
441 Ga0070667_100912574
442 Ga0070703_10009096
443 Ga0070709_10007637
444 Ga0070709_10018663
445 Ga0070709_10247782
446 Ga0070709_10296801
447 Ga0070709_10323218
448 Ga0070709_10748072
449 Ga0070709_10804778
450 Ga0070709_11170093
451 Ga0070714_100070533
452 Ga0070714_100213375
453 Ga0070714_100781601
454 Ga0070713_100007491
455 Ga0070713_100124610
456 Ga0070713_100281052
457 Ga0070713_100982019
458 Ga0070713_101367946
459 Ga0070713_101441629
460 Ga0070713_101921427
461 Ga0070710_10052102
462 Ga0070710_10589805
463 Ga0070710_10720154
464 Ga0070711_100001871
465 Ga0070711_100239419
466 Ga0070711_100256368
467 Ga0070711_100302113
468 Ga0070705_100009689
469 Ga0070705_100088180
470 Ga0070694_100010607
471 Ga0070694_100063962
472 Ga0070694_100816701
473 Ga0070708_100003744
474 Ga0070708_100050616
475 Ga0070708_101169280
476 Ga0070663_100058044
477 Ga0070678_100141802
478 Ga0070706_100001399
479 Ga0070706_100039298
480 Ga0070707_100701361
481 Ga0070699_100038358
482 Ga0070684_100000301
483 Ga0070684_100107636
484 Ga0070684_100256272
485 Ga0070697_100000698
486 Ga0070697_100009808
487 Ga0070697_100137171
488 Ga0070697_100457647
489 Ga0070697_100936512
490 Ga0070672_100424584
491 Ga0070686_100848279
492 Ga0070686_101269884
493 Ga0070696_100000936
494 Ga0070696_101196186
495 Ga0070693_100000426
496 Ga0070665_100100479
497 Ga0070665_100392832
498 Ga0070665_101433223
499 Ga0070704_100691847
500 Ga0068855_101925512
501 Ga0070664_100002048
502 Ga0068856_102590440
503 Ga0068859_100358425
504 Ga0068859_100812583
505 Ga0068859_102265700
506 Ga0068859_103141069
507 Ga0068864_100315828
508 Ga0068864_100679646
509 Ga0068866_11173803
510 Ga0068863_100108148
511 Ga0068863_100929053
512 Ga0068858_100155972
513 Ga0068858_100403060
514 Ga0068858_100662568
515 Ga0068858_100764177
516 Ga0068858_100853805
517 Ga0068860_100841094
518 Ga0068862_102322043
519 Ga0081539_10300606
520 Ga0070717_10077462
521 Ga0070717_10231216
522 Ga0070717_10358492
523 Ga0070717_10584395
524 Ga0070715_10129415
525 Ga0070716_100020762
526 Ga0070716_100039722
527 Ga0070716_100071719
528 Ga0070716_100226078
529 Ga0070716_100237803
530 Ga0070716_100627446
531 Ga0070712_100218560
532 Ga0070712_101117791
533 Ga0097621_100130208
534 Ga0075428_100096779
535 Ga0075428_100407571
536 Ga0075430_100469348
537 Ga0075430_101289858
538 Ga0075431_100058964
539 Ga0075431_100062824
540 Ga0075431_100099454
541 Ga0075431_100171527
542 Ga0075431_100335357
543 Ga0075431_100386341
544 Ga0075431_100580303
545 Ga0075431_100640621
546 Ga0075431_100966418
547 Ga0075433_10261012
548 Ga0075433_10289082
549 Ga0075434_100000988
550 Ga0075434_100039424
551 Ga0075434_100065117
552 Ga0075434_100100395
553 Ga0075434_102340622
554 Ga0075429_100174367
555 Ga0075429_100466341
556 Ga0075429_101024078
557 Ga0075436_100111786
558 Ga0075436_100180888
559 Ga0075436_100273664
560 Ga0075436_100829897
561 Ga0097620_100358441
562 Ga0097620_100636011
563 Ga0097620_100812580
564 Ga0097620_102265272
565 Ga0097620_103141841
566 Ga0075435_100245411
567 Ga0099794_10244569
568 Ga0099794_10246845
569 Ga0099794_10372955
570 Ga0099795_10100149
571 Ga0099795_10338243
572 Ga0105240_10002362
573 Ga0105240_10057863
574 Ga0105240_12001798
575 Ga0111539_10036125
576 Ga0111539_10317851
577 Ga0111539_13543721
578 Ga0105247_10321801
579 Ga0105247_11248227
580 Ga0105247_11844014
581 Ga0114129_10010174
582 Ga0114129_10100611
583 Ga0114129_10222102
584 Ga0114129_10233251
585 Ga0114129_10488875
586 Ga0105243_12853423
587 Ga0105241_11468706
588 Ga0105242_12162766
589 Ga0105248_10066273
590 Ga0105248_10134943
591 Ga0105248_10273418
592 Ga0105248_10303354
593 Ga0105248_11203982
594 Ga0105237_10141552
595 Ga0105237_10147625
596 Ga0105237_10441796
597 Ga0105238_11118445
598 Ga0105238_13059353
599 Ga0105249_10172689
600 Ga0105249_12429352
601 Ga0105239_10286271
602 Ga0105239_10603930
603 Ga0105246_12397949
604 Ga0157373_10270487
605 Ga0157370_10123718
606 Ga0157369_10214367
607 Ga0157369_11281582
608 Ga0157374_10192582
609 Ga0157378_10034750
610 Ga0157372_10125758
611 Ga0157375_10556824
612 Ga0157375_11103106
613 Ga0157375_11771171
614 Ga0163163_10020748
615 Ga0163163_10062653
616 Ga0163163_10213902
617 Ga0163163_10706899
618 Ga0163163_10842436
619 Ga0163163_11759653
620 Ga0157380_10170383
621 Ga0157379_10238599
622 Ga0157379_11071724
623 Ga0157379_11799234
624 Ga0157376_11921413
625 Ga0213873_10100700
626 Ga0213875_10001039
627 Ga0213875_10152441
628 Ga0224572_1008776
629 Ga0228598_1007108
630 Ga0207697_10027775
631 Ga0207653_10000850
632 Ga0207682_10544127
633 Ga0207692_10063959
634 Ga0207692_10628396
635 Ga0207680_10472342
636 Ga0207699_10034092
637 Ga0207699_10066359
638 Ga0207699_10092824
639 Ga0207699_10093007
640 Ga0207699_10250692
641 Ga0207699_10262302
642 Ga0207699_10504613
643 Ga0207699_10936772
644 Ga0207684_10005467
645 Ga0207684_10035082
646 Ga0207695_10013271
647 Ga0207695_10028537
648 Ga0207695_10099512
649 Ga0207671_10133146
650 Ga0207671_10513050
651 Ga0207693_10182405
652 Ga0207693_10417891
653 Ga0207693_10707472
654 Ga0207693_10889536
655 Ga0207663_10029307
656 Ga0207660_10117276
657 Ga0207649_10006301
658 Ga0207652_10034476
659 Ga0207694_11034459
660 Ga0207700_10033740
661 Ga0207700_10091562
662 Ga0207700_10364711
663 Ga0207700_10490016
664 Ga0207664_10037917
665 Ga0207664_10177274
666 Ga0207664_10553188
667 Ga0207669_11691109
668 Ga0207665_10024427
669 Ga0207665_10254154
670 Ga0207665_10339352
671 Ga0207665_10773140
672 Ga0207665_11454131
673 Ga0207711_10194841
674 Ga0207711_10210377
675 Ga0207711_11089124
676 Ga0207711_11172741
677 Ga0207661_10030342
678 Ga0207661_10100903
679 Ga0207679_10898104
680 Ga0207667_11597125
681 Ga0207651_10065463
682 Ga0207712_10219994
683 Ga0207668_10723441
684 Ga0207640_11578260
685 Ga0207658_10571584
686 Ga0207658_11007207
687 Ga0207703_10621825
688 Ga0207639_10186295
689 Ga0207639_10684607
690 Ga0207678_10067909
691 Ga0207702_11206168
692 Ga0207641_10063416
693 Ga0207676_10854870
694 Ga0207676_10998863
695 Ga0207674_10523644
696 Ga0207683_10169260
697 Ga0209179_1005892
698 Ga0207428_10369262
699 Ga0207428_10442397
700 Ga0265354_1003478
701 Ga0265357_1003603
702 Ga0268266_10198272
703 Ga0268264_10429645
704 Ga0265760_10296701
705 Ga0265339_10202427
706 Ga0265331_10086324
707 Ga0265314_10200126
708 Ga0307405_11209639
709 Ga0307412_11047977
710 Ga0307416_102475748
711 Ga0307414_11510183
712 Ga0373939_0041552
713 Ga0373941_0383859
714 Ga0373953_0123241
715 Ga0373956_0343267
716 Ga0373960_0460195
717 Ga0373955_0092076
718 Ga0373931_0041304
719 Ga0373935_0595257
720 Ga0373935_0978004
721 Ga0373937_0116589
722 Ga0373937_0467863
723 Ga0373937_0780338
724 Ga0373937_1074228
725 Ga0373925_1303691
726 Ga0395900_1368719
727 Ga0436364_0204952
728 Ga0436364_0807075
729 Ga0436364_1269553
730 Ga0436364_1477331
731 Ga0436364_1509407
732 Ga0436365_0378754
733 Ga0436360_0094871
734 Ga0436362_0518050
735 Ga0436362_1244206
736 Ga0451577_0282704
737 Ga0451577_0475192
738 Ga0451577_1526341
739 Ga0453683_0198484
740 Ga0466959_0232627
741 Ga0466959_0700503
742 Ga0451576_0144784
743 Ga0466958_0036514
744 Ga0466958_0102577
745 Ga0495580_0112372
746 Ga0495580_0265464
747 Ga0495582_0038818
748 Ga0495664_0711369
749 Ga0495594_0058843
750 Ga0495608_0358991
751 Ga0495628_0070366
752 Ga0495628_0117110
753 Ga0495630_0493274
754 Ga0495666_0149355
755 Ga0495652_0961894
756 Ga0495640_0428973
757 Ga0495640_0591257
758 Ga0495586_0696329
759 Ga0495587_0274680
760 Ga0495587_0393805
761 Ga0495645_0526730
762 Ga0495645_0691698
763 Ga0495667_0314607
764 Ga0495635_0411787
765 Ga0495635_0679061
766 Ga0495623_0147133
767 Ga0495623_0182614
768 Ga0495623_0335267
769 Ga0495658_0102027
770 Ga0495613_0456069
771 Ga0495671_0457362
772 Ga0495674_0073487
773 Ga0495674_0249662
774 Ga0495674_0320330
775 Ga0495674_0511065
776 Ga0495675_0095123
777 Ga0495675_0429602
778 Ga0495675_0802382
779 Ga0495684_0157179
780 Ga0495684_0164927
781 Ga0495602_0268909
782 Ga0495602_0271381
783 Ga0495602_0337882
784 Ga0496104_0021887
785 Ga0496105_0134075
786 Ga0496106_0687947
787 Ga0496108_1638395
788 Ga0496109_0000027
789 Ga0496109_0026573
790 Ga0496110_0198110
791 Ga0496110_1815398
792 Ga0496111_0071559
793 Ga0496112_0003645
794 Ga0496113_0029248
795 Ga0496115_0419724
796 Ga0501031_0876599
797 Ga0501039_0184863
798 Ga0501040_1059965
799 Ga0501041_0911845
800 Ga0501042_1074311
801 Ga0501071_1217432
802 Ga0501072_0975455
803 Ga0501073_1054528
804 Ga0501233_207275
805 Ga0501081_0658306
806 Ga0501045_0400769
807 nmdc:mga05p37_29068_c1
808 nmdc:mga05p37_29252_c1
809 nmdc:mga05p37_340074_c1
810 nmdc:mga05p37_455437_c1
811 nmdc:mga05p37_546146_c1
812 nmdc:mga05p37_702628_c1
813 nmdc:mga09592_206290_c1
814 nmdc:mga09592_529716_c1
815 nmdc:mga09592_65387_c1
816 nmdc:mga0qj67_451025_c1
817 nmdc:mga0qj67_499066_c1
818 nmdc:mga0qj67_956728_c1
819 nmdc:mga06r32_104977_c1
820 nmdc:mga06r32_1199278_c1
821 nmdc:mga06r32_158409_c1
822 nmdc:mga06r32_1651027_c1
823 nmdc:mga06r32_1733109_c1
824 nmdc:mga06r32_23416_c1
825 nmdc:mga06r32_38210_c1
826 nmdc:mga06r32_52657_c2
827 nmdc:mga06r32_573522_c1
828 nmdc:mga06r32_840918_c1
829 nmdc:mga06r32_919206_c1
830 nmdc:mga08y16_30419_c1
831 nmdc:mga08y16_3702_c1
832 nmdc:mga0n895_105143_c1
833 nmdc:mga0n895_15653_c1
834 nmdc:mga0n895_62238_c1
835 nmdc:mga0rr50_40841_c1
836 nmdc:mga0rr50_699811_c1
837 nmdc:mga0rr50_855964_c1
838 nmdc:mga0a205_1140265_c1
839 nmdc:mga0a205_153446_c2
840 nmdc:mga0a205_39727_c1
841 nmdc:mga0a205_477410_c1
842 Ga0500555_001907
843 Ga0500579_169247
844 Ga0501084_0195906
845 Ga0501082_0000083
846 Ga0501082_0135033

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

16

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9593 10 107
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9443 8 108
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9316 9 109
4esf-assembly1.cif.gz_A-2 crystal structure of padr-like transcriptional regulator (bce3449) from bacillus cereus strain atcc 10987 0.9295 8 105
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9164 5 107
ID Description Score Start End Superfamily
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9334 9 108 1.10.10.10
4esfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9295 8 105 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9148 12 93 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9139 5 107 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9053 5 107 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6J4S1B4-F1-model_v4 Transcriptional regulator, PadR family 0.9863 15 109
AF-A0A2V9ZD40-F1-model_v4 PadR family transcriptional regulator 0.9805 8 85
AF-A0A2E8E0J4-F1-model_v4 PadR family transcriptional regulator 0.9789 4 109
AF-A0A3E0NW68-F1-model_v4 PadR family transcriptional regulator 0.9782 8 108
AF-A0A2V8J116-F1-model_v4 PadR family transcriptional regulator 0.9759 15 106

Map