F440480

General Info

Members Datasets Scaffolds Average Seq Length
423 259 846 343

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100027300|Ga0068852_1000273002
Length 368
Sequence VKTILISAVISLLSSILCTPLVIAYFRRQGFGQEIRSDGPQSHLIKRGTPTMGGVAIIGSTVLGYTVAHISIAIRGHAGPTASGLLLLFLMVGLGAVGFVDDYIKIRKQRSLGLRARAKFGGQLLVGLVFAILAINFRNRLDLSPASTHLSYLRDIPQIGFGTIGFVLXXXXIISATSNAVNLTDGLDGLAAGASAMVFGAFTLIAFLQYRTDRASVCHAIHAAAPCYPVRDPLDVALVAASALAACFGFLWWNASPAQIFMGDTGSMALGGLMAGLAILSHVELLLVVLGGLFAAVTLSGIIQTGWFKYTRIRRGTGKRVFRMAPLHHHFELGGWEEVTIIVRFWIVAGLAVAFGMGLFYADFIGNG

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
156 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
157 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
165 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
216 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 2506783011 Frankia datiscae Dg1 Isolate Nodule
230 2508501039 Frankia saprophytica CN3 Isolate Nodule
231 2517572101 Frankia sp. DC12 Isolate Nodule
232 2527291627 Frankia casuarinae Thr Isolate Nodule
233 2527291629 Frankia sp. BMG5.23 Isolate Nodule
234 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
235 2547132424 Nocardia nova SH22a Isolate Unclassified
236 2576861822 Frankia sp. CeD Isolate Nodule
237 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
238 2619618881 Frankia sp. ACN1ag Isolate Unclassified
239 2619619003 Frankia sp. CpI1-P Isolate Nodule
240 2626541554 Frankia sp. AvcI.1 Isolate Nodule
241 2671180195 Frankia sp. CcI49 Isolate Nodule
242 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
243 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
244 2684623036 Frankia sp. CgIM4 Isolate Nodule
245 2687453737 Frankia sp. BMG5.36 Isolate Nodule
246 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
247 2710264753 Frankia sp. KB5 Isolate Nodule
248 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
249 2773857922 Frankia sp. CcI49 Isolate Nodule
250 2773857924 Frankia sp. CgIS1 Isolate Nodule
251 2773857933 Frankia sp. BMG5.30 Isolate Nodule
252 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
253 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
254 637000116 Frankia casuarinae CcI3 Isolate Nodule
255 8002775197 Frankia nepalensis CN7 Isolate Nodule
256 8002784119 Frankia sp. AgB1.9 Isolate Nodule
257 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
258 8054920844 Frankia tisae Agncl-8 Isolate Nodule
259 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.2
Metatranscriptomes 0.47
Isolates 7.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 5.67
Rhizoplane 8.27
Rhizosphere 79.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100027300 3300005616 Bacteria 4652
2 JGI24737J22298_10038871 3300001990 Bacteria 1464
3 JGI24735J21928_10001543 3300002067 Bacteria 8171
4 JGI24751J29686_10006567 3300002459 Bacteria 2371
5 Ga0070658_10096663 3300005327 Bacteria 2439
6 Ga0070690_100017016 3300005330 Bacteria 4365
7 Ga0070670_100018055 3300005331 Bacteria 6055
8 Ga0070677_10048161 3300005333 Bacteria 1711
9 Ga0068869_100009504 3300005334 Bacteria 6312
10 Ga0068869_100186750 3300005334 Bacteria 1628
11 Ga0070666_10010010 3300005335 Bacteria 5916
12 Ga0070666_10043512 3300005335 Bacteria 3008
13 Ga0070680_100032553 3300005336 Bacteria 4197
14 Ga0070682_100039460 3300005337 Bacteria 2901
15 Ga0068868_100041041 3300005338 Bacteria 3604
16 Ga0068868_100082516 3300005338 Bacteria 2578
17 Ga0070689_100042784 3300005340 Bacteria 3478
18 Ga0070691_10026007 3300005341 Bacteria 2727
19 Ga0070691_10038122 3300005341 Bacteria 2269
20 Ga0070668_100008144 3300005347 Bacteria 7788
21 Ga0070668_100012434 3300005347 Bacteria 6340
22 Ga0070675_100012749 3300005354 Bacteria 6593
23 Ga0070671_100008341 3300005355 Bacteria 8298
24 Ga0070671_100016010 3300005355 Bacteria 6058
25 Ga0070674_100059944 3300005356 Bacteria 2651
26 Ga0070673_100041969 3300005364 Bacteria 3523
27 Ga0070688_100109706 3300005365 Bacteria 1833
28 Ga0070659_100011234 3300005366 Bacteria 6617
29 Ga0070659_100083425 3300005366 Bacteria 2554
30 Ga0070709_10019670 3300005434 Bacteria 3907
31 Ga0070714_100000077 3300005435 Bacteria 84205
32 Ga0070714_100039669 3300005435 Bacteria 3965
33 Ga0070713_100040385 3300005436 Bacteria 3793
34 Ga0070701_10021143 3300005438 Bacteria 3101
35 Ga0070701_10023565 3300005438 Bacteria 2967
36 Ga0070700_100000007 3300005441 Bacteria 198866
37 Ga0070700_100232854 3300005441 Bacteria 1312
38 Ga0070663_100022830 3300005455 Bacteria 4186
39 Ga0070663_100037882 3300005455 Bacteria 3359
40 Ga0070678_100082459 3300005456 Bacteria 2441
41 Ga0070662_100020536 3300005457 Bacteria 4499
42 Ga0070681_10013684 3300005458 Bacteria 8073
43 Ga0068867_100133807 3300005459 Bacteria 1930
44 Ga0070685_10031994 3300005466 Bacteria 2944
45 Ga0070685_10102744 3300005466 Bacteria 1748
46 Ga0070679_100016862 3300005530 Bacteria 7060
47 Ga0070679_100322857 3300005530 Bacteria 1493
48 Ga0070697_100065193 3300005536 Bacteria 2976
49 Ga0068853_100028851 3300005539 Bacteria 4670
50 Ga0070672_100141605 3300005543 Bacteria 1984
51 Ga0070686_100058226 3300005544 Bacteria 2485
52 Ga0070693_100011082 3300005547 Bacteria 4535
53 Ga0070693_100042454 3300005547 Bacteria 2562
54 Ga0070665_100002405 3300005548 Bacteria 20640
55 Ga0070665_100094089 3300005548 Bacteria 3002
56 Ga0070665_100135772 3300005548 Bacteria 2462
57 Ga0070665_100156368 3300005548 Bacteria 2282
58 Ga0070704_100005699 3300005549 Bacteria 7279
59 Ga0068855_100440216 3300005563 Bacteria 1424
60 Ga0068854_100017004 3300005578 Bacteria 4859
61 Ga0068854_100141271 3300005578 Bacteria 1848
62 Ga0068856_100002544 3300005614 Bacteria 18785
63 Ga0068856_100177911 3300005614 Bacteria 2140
64 Ga0070702_100005140 3300005615 Bacteria 6057
65 Ga0068852_100028363 3300005616 Bacteria 4580
66 Ga0068852_100063277 3300005616 Bacteria 3221
67 Ga0068859_100000204 3300005617 Bacteria 58400
68 Ga0068859_100003235 3300005617 Bacteria 16579
69 Ga0068864_100078849 3300005618 Bacteria 2883
70 Ga0068864_100082468 3300005618 Bacteria 2821
71 Ga0068866_10012679 3300005718 Bacteria 3678
72 Ga0068861_100089347 3300005719 Bacteria 2428
73 Ga0068870_10001678 3300005840 Bacteria 9049
74 Ga0068863_100000878 3300005841 Bacteria 30186
75 Ga0068863_100003686 3300005841 Bacteria 15136
76 Ga0068863_100004122 3300005841 Bacteria 14368
77 Ga0068863_100191843 3300005841 Bacteria 1964
78 Ga0068863_100207965 3300005841 Bacteria 1884
79 Ga0068858_100000036 3300005842 Bacteria 138467
80 Ga0068858_100008494 3300005842 Bacteria 9868
81 Ga0068858_100015774 3300005842 Bacteria 7105
82 Ga0068860_100000043 3300005843 Bacteria 225862
83 Ga0068862_100000240 3300005844 Bacteria 60867
84 Ga0081455_10001658 3300005937 Bacteria 26983
85 Ga0081455_10081818 3300005937 Bacteria 2643
86 Ga0081538_10087592 3300005981 Bacteria 1624
87 Ga0081540_1023939 3300005983 Bacteria 3555
88 Ga0070717_10143350 3300006028 Bacteria 2062
89 Ga0070715_10041658 3300006163 Bacteria 1926
90 Ga0070716_100031918 3300006173 Bacteria 2868
91 Ga0070712_100036178 3300006175 Bacteria 3357
92 Ga0097621_100034599 3300006237 Bacteria 4031
93 Ga0097621_100377560 3300006237 Bacteria 1265
94 Ga0068871_100020816 3300006358 Bacteria 5031
95 Ga0068871_100022037 3300006358 Bacteria 4907
96 Ga0075431_100089739 3300006847 Bacteria 3172
97 Ga0075433_10021165 3300006852 Bacteria 5450
98 Ga0075433_10139621 3300006852 Bacteria 2154
99 Ga0075434_100019879 3300006871 Bacteria 6503
100 Ga0075434_100047484 3300006871 Bacteria 4261
101 Ga0068865_100106250 3300006881 Bacteria 2063
102 Ga0075436_100016582 3300006914 Bacteria 5042
103 Ga0075436_100020124 3300006914 Bacteria 4580
104 Ga0097620_100000204 3300006931 Bacteria 58400
105 Ga0097620_100003235 3300006931 Bacteria 16579
106 Ga0075435_100020389 3300007076 Bacteria 5079
107 Ga0075435_100029579 3300007076 Bacteria 4300
108 Ga0105240_10157794 3300009093 Bacteria 2697
109 Ga0111539_10070950 3300009094 Bacteria 4111
110 Ga0111539_10084345 3300009094 Bacteria 3735
111 Ga0105245_10055758 3300009098 Bacteria 3550
112 Ga0105245_10116140 3300009098 Bacteria 2495
113 Ga0105245_10132494 3300009098 Bacteria 2339
114 Ga0105247_10000041 3300009101 Bacteria 158571
115 Ga0105247_10000749 3300009101 Bacteria 25081
116 Ga0114129_10144813 3300009147 Bacteria 3255
117 Ga0105243_10011612 3300009148 Bacteria 6664
118 Ga0105243_10155024 3300009148 Bacteria 1969
119 Ga0105241_10124966 3300009174 Bacteria 2076
120 Ga0105242_10011682 3300009176 Bacteria 6757
121 Ga0105248_10000028 3300009177 Bacteria 225683
122 Ga0105248_10020315 3300009177 Bacteria 7358
123 Ga0105248_10136467 3300009177 Bacteria 2767
124 Ga0105237_10025806 3300009545 Bacteria 6009
125 Ga0105237_10059193 3300009545 Bacteria 3832
126 Ga0105237_10167512 3300009545 Bacteria 2196
127 Ga0105238_10062713 3300009551 Bacteria 3718
128 Ga0105238_10166811 3300009551 Bacteria 2178
129 Ga0105249_10032172 3300009553 Bacteria 4744
130 Ga0105249_10125645 3300009553 Bacteria 2442
131 Ga0105249_10357607 3300009553 Bacteria 1481
132 Ga0105239_10046577 3300010375 Bacteria 4752
133 Ga0105246_10018967 3300011119 Bacteria 4388
134 Ga0105246_10033943 3300011119 Bacteria 3394
135 Ga0157373_10072209 3300013100 Bacteria 2436
136 Ga0157371_10016737 3300013102 Bacteria 5463
137 Ga0157371_10050238 3300013102 Bacteria 2963
138 Ga0157370_10070224 3300013104 Bacteria 3306
139 Ga0157370_10084061 3300013104 Bacteria 2992
140 Ga0157370_10085966 3300013104 Bacteria 2955
141 Ga0157369_10050209 3300013105 Bacteria 4519
142 Ga0157374_10018755 3300013296 Bacteria 6113
143 Ga0157374_10080781 3300013296 Bacteria 3084
144 Ga0157378_10246906 3300013297 Bacteria 1707
145 Ga0163162_10019777 3300013306 Bacteria 6611
146 Ga0157372_10000025 3300013307 Bacteria 195491
147 Ga0157372_10019840 3300013307 Bacteria 7244
148 Ga0157375_10013121 3300013308 Bacteria 7364
149 Ga0157375_10228955 3300013308 Bacteria 2018
150 Ga0163163_10015869 3300014325 Bacteria 6977
151 Ga0163163_10067070 3300014325 Bacteria 3566
152 Ga0163163_10238715 3300014325 Bacteria 1867
153 Ga0157377_10019047 3300014745 Bacteria 3580
154 Ga0157379_10000062 3300014968 Bacteria 68612
155 Ga0157379_10010201 3300014968 Bacteria 8186
156 Ga0157379_10019462 3300014968 Bacteria 5996
157 Ga0157379_10075916 3300014968 Bacteria 3010
158 Ga0157376_10090982 3300014969 Bacteria 2642
159 Ga0157376_10111397 3300014969 Bacteria 2409
160 Ga0163161_10006125 3300017792 Bacteria 8335
161 Ga0206356_11444655 3300020070 Bacteria 1912
162 Ga0206353_10409162 3300020082 Bacteria 6293
163 Ga0213876_10007985 3300021384 Bacteria 5737
164 Ga0213876_10059914 3300021384 Bacteria 2009
165 Ga0213875_10105420 3300021388 Bacteria 1316
166 Ga0207710_10000012 3300025900 Bacteria 409603
167 Ga0207710_10000038 3300025900 Bacteria 241794
168 Ga0207710_10024364 3300025900 Bacteria 2606
169 Ga0207688_10003782 3300025901 Bacteria 8250
170 Ga0207688_10004578 3300025901 Bacteria 7526
171 Ga0207680_10009479 3300025903 Bacteria 4831
172 Ga0207685_10025964 3300025905 Bacteria 2030
173 Ga0207699_10125246 3300025906 Bacteria 1667
174 Ga0207643_10000829 3300025908 Bacteria 18766
175 Ga0207705_10189407 3300025909 Bacteria 1555
176 Ga0207654_10036713 3300025911 Bacteria 2740
177 Ga0207654_10122349 3300025911 Bacteria 1636
178 Ga0207695_10061092 3300025913 Bacteria 3896
179 Ga0207663_10026072 3300025916 Bacteria 3388
180 Ga0207660_10019684 3300025917 Bacteria 4516
181 Ga0207662_10108785 3300025918 Bacteria 1726
182 Ga0207657_10010771 3300025919 Bacteria 9102
183 Ga0207657_10017936 3300025919 Bacteria 6773
184 Ga0207650_10010854 3300025925 Bacteria 6260
185 Ga0207659_10034625 3300025926 Bacteria 3484
186 Ga0207687_10005089 3300025927 Bacteria 8708
187 Ga0207687_10047718 3300025927 Bacteria 2970
188 Ga0207700_10088564 3300025928 Bacteria 2437
189 Ga0207664_10000091 3300025929 Bacteria 84244
190 Ga0207664_10087728 3300025929 Bacteria 2544
191 Ga0207664_10228166 3300025929 Bacteria 1618
192 Ga0207644_10011951 3300025931 Bacteria 5757
193 Ga0207644_10083807 3300025931 Bacteria 2362
194 Ga0207670_10009072 3300025936 Bacteria 5650
195 Ga0207670_10013951 3300025936 Bacteria 4757
196 Ga0207704_10045236 3300025938 Bacteria 2614
197 Ga0207665_10002599 3300025939 Bacteria 12142
198 Ga0207665_10034348 3300025939 Bacteria 3364
199 Ga0207691_10085421 3300025940 Bacteria 2832
200 Ga0207711_10000090 3300025941 Bacteria 97320
201 Ga0207711_10119884 3300025941 Bacteria 2348
202 Ga0207711_10154256 3300025941 Bacteria 2074
203 Ga0207689_10004570 3300025942 Bacteria 12531
204 Ga0207661_10005683 3300025944 Bacteria 8796
205 Ga0207679_10043436 3300025945 Bacteria 3236
206 Ga0207667_10023018 3300025949 Bacteria 6867
207 Ga0207667_10071430 3300025949 Bacteria 3609
208 Ga0207712_10062336 3300025961 Bacteria 2650
209 Ga0207712_10261152 3300025961 Bacteria 1405
210 Ga0207668_10007845 3300025972 Bacteria 6349
211 Ga0207640_10061159 3300025981 Bacteria 2493
212 Ga0207658_10008848 3300025986 Bacteria 6832
213 Ga0207677_10006425 3300026023 Bacteria 6448
214 Ga0207677_10024362 3300026023 Bacteria 3758
215 Ga0207703_10000063 3300026035 Bacteria 127040
216 Ga0207703_10033197 3300026035 Bacteria 4089
217 Ga0207703_10126377 3300026035 Bacteria 2202
218 Ga0207639_10079587 3300026041 Bacteria 2590
219 Ga0207639_10382498 3300026041 Bacteria 1264
220 Ga0207678_10000537 3300026067 Bacteria 34608
221 Ga0207678_10028480 3300026067 Bacteria 4877
222 Ga0207708_10000006 3300026075 Bacteria 266916
223 Ga0207708_10022403 3300026075 Bacteria 4771
224 Ga0207708_10140284 3300026075 Bacteria 1895
225 Ga0207702_10006347 3300026078 Bacteria 10211
226 Ga0207702_10010215 3300026078 Bacteria 7859
227 Ga0207641_10006184 3300026088 Bacteria 10128
228 Ga0207641_10007191 3300026088 Bacteria 9281
229 Ga0207641_10062222 3300026088 Bacteria 3184
230 Ga0207641_10064842 3300026088 Bacteria 3123
231 Ga0207676_10001429 3300026095 Bacteria 17746
232 Ga0207675_100010774 3300026118 Bacteria 8567
233 Ga0207675_100088874 3300026118 Bacteria 2903
234 Ga0207683_10016169 3300026121 Bacteria 6350
235 Ga0207683_10144880 3300026121 Bacteria 2142
236 Ga0207698_10135278 3300026142 Bacteria 2114
237 Ga0207698_10268980 3300026142 Bacteria 1570
238 Ga0268266_10002418 3300028379 Bacteria 20119
239 Ga0268265_10000252 3300028380 Bacteria 60859
240 Ga0268264_10000027 3300028381 Bacteria 440852
241 Ga0268264_10055805 3300028381 Bacteria 3301
242 Ga0265338_10064116 3300028800 Bacteria 3198
243 Ga0265325_10002422 3300031241 Bacteria 12595
244 Ga0265339_10007013 3300031249 Bacteria 7322
245 Ga0265316_10033805 3300031344 Bacteria 4160
246 Ga0265314_10015953 3300031711 Bacteria 5948
247 Ga0373938_0003434 3300034957 Bacteria 2598
248 Ga0373952_0023133 3300035092 Bacteria 1326
249 Ga0373939_0003687 3300035114 Bacteria 3607
250 Ga0373941_0014927 3300035115 Bacteria 2085
251 Ga0373945_0016271 3300035116 Bacteria 2506
252 Ga0373960_0018355 3300035121 Bacteria 1823
253 Ga0373943_0098711 3300035170 Bacteria 1524
254 Ga0436364_1306216 3300037853 Bacteria 1450
255 Ga0436365_0457442 3300039437 Bacteria 2059
256 Ga0436365_0644730 3300039437 Bacteria 20547
257 Ga0439448_0004591 3300042005 Bacteria 3904
258 Ga0439463_029758 3300042016 Bacteria 1376
259 Ga0439459_0005561 3300042438 Bacteria 2075
260 Ga0466969_0067422 3300044656 Bacteria 1727
261 Ga0466966_0019184 3300044684 Bacteria 4501
262 Ga0466966_0043014 3300044684 Bacteria 2897
263 Ga0466966_0072563 3300044684 Bacteria 2155
264 Ga0466966_0163718 3300044684 Bacteria 1354
265 Ga0466961_0004122 3300044693 Bacteria 9076
266 Ga0466961_0008313 3300044693 Bacteria 6607
267 Ga0466961_0014098 3300044693 Bacteria 5127
268 Ga0466961_0089045 3300044693 Bacteria 1950
269 Ga0466963_0005581 3300044694 Bacteria 7376
270 Ga0466963_0007662 3300044694 Bacteria 6446
271 Ga0466963_0053915 3300044694 Bacteria 2671
272 Ga0466963_0054426 3300044694 Bacteria 2660
273 Ga0466963_0056812 3300044694 Bacteria 2605
274 Ga0466963_0111377 3300044694 Bacteria 1879
275 Ga0466963_0153164 3300044694 Bacteria 1602
276 Ga0466971_0004223 3300044719 Bacteria 6191
277 Ga0466971_0024616 3300044719 Bacteria 2686
278 Ga0466968_0033076 3300044735 Bacteria 2154
279 Ga0466957_0001673 3300044842 Bacteria 11652
280 Ga0466957_0049814 3300044842 Bacteria 2547
281 Ga0466957_0125175 3300044842 Bacteria 1642
282 Ga0466957_0142528 3300044842 Bacteria 1545
283 Ga0466957_0176440 3300044842 Bacteria 1394
284 Ga0466960_0007733 3300044901 Bacteria 4377
285 Ga0466960_0020663 3300044901 Bacteria 2920
286 Ga0466959_0095687 3300045049 Bacteria 2130
287 Ga0466959_0095832 3300045049 Bacteria 2128
288 Ga0466958_0018091 3300045836 Bacteria 4084
289 Ga0466958_0026907 3300045836 Bacteria 3401
290 Ga0466958_0052273 3300045836 Bacteria 2476
291 Ga0466967_0001494 3300045976 Bacteria 13648
292 Ga0466967_0004741 3300045976 Bacteria 9252
293 Ga0466967_0040045 3300045976 Bacteria 4032
294 Ga0466967_0064176 3300045976 Bacteria 3265
295 Ga0466967_0083644 3300045976 Bacteria 2886
296 Ga0466967_0185999 3300045976 Bacteria 1961
297 Ga0466967_0288310 3300045976 Bacteria 1576
298 Ga0466967_0376527 3300045976 Bacteria 1378
299 Ga0466967_0510992 3300045976 Bacteria 1180
300 Ga0495603_0128919 3300046455 Bacteria 1473
301 Ga0495629_0001778 3300046459 Bacteria 16912
302 Ga0495641_0047520 3300046461 Bacteria 1970
303 Ga0495580_0110227 3300046472 Bacteria 1912
304 Ga0495582_0000234 3300046473 Bacteria 30821
305 Ga0495630_0096117 3300046517 Bacteria 2240
306 Ga0495665_0026026 3300046531 Bacteria 3142
307 Ga0495658_0002257 3300046683 Bacteria 9749
308 Ga0495658_0065159 3300046683 Bacteria 2101
309 Ga0495613_0000835 3300046689 Bacteria 23811
310 Ga0495613_0014374 3300046689 Bacteria 5876
311 Ga0496101_0024986 3300048904 Bacteria 4141
312 Ga0496101_0128194 3300048904 Bacteria 1924
313 Ga0496101_0264498 3300048904 Bacteria 1342
314 Ga0496102_0000072 3300048905 Bacteria 150284
315 Ga0496102_0000791 3300048905 Bacteria 30774
316 Ga0496102_0005958 3300048905 Bacteria 10383
317 Ga0496102_0009054 3300048905 Bacteria 8543
318 Ga0496102_0134084 3300048905 Bacteria 2320
319 Ga0496102_0465318 3300048905 Bacteria 1185
320 Ga0496103_0000053 3300048906 Bacteria 148944
321 Ga0496103_0015175 3300048906 Bacteria 4580
322 Ga0496104_0141007 3300048907 Bacteria 2315
323 Ga0496104_0205560 3300048907 Bacteria 1881
324 Ga0496104_0298689 3300048907 Bacteria 1522
325 Ga0496105_0013326 3300048908 Bacteria 6524
326 Ga0496105_0062062 3300048908 Bacteria 3084
327 Ga0496106_0030436 3300048909 Bacteria 4025
328 Ga0496106_0088695 3300048909 Bacteria 2384
329 Ga0496107_0131151 3300048910 Bacteria 1850
330 Ga0496108_0048229 3300048911 Bacteria 3561
331 Ga0496108_0171843 3300048911 Bacteria 1875
332 Ga0496109_0014395 3300048912 Bacteria 6883
333 Ga0496109_0040332 3300048912 Bacteria 4228
334 Ga0496109_0055197 3300048912 Bacteria 3624
335 Ga0496109_0231602 3300048912 Bacteria 1738
336 Ga0496110_0026446 3300048913 Bacteria 4966
337 Ga0496111_0007759 3300048914 Bacteria 7063
338 Ga0496111_0043116 3300048914 Bacteria 3242
339 Ga0496112_0002822 3300048915 Bacteria 14113
340 Ga0496112_0345746 3300048915 Bacteria 1430
341 Ga0496113_0166859 3300048916 Bacteria 1742
342 Ga0496114_0153788 3300048917 Bacteria 1996
343 Ga0496115_0007175 3300048918 Bacteria 8185
344 Ga0496115_0185255 3300048918 Bacteria 1720
345 Ga0496116_0000150 3300048919 Bacteria 141440
346 Ga0496117_0055391 3300048920 Bacteria 2771
347 Ga0496117_0121222 3300048920 Bacteria 1606
348 Ga0496118_0000521 3300048921 Bacteria 63196
349 Ga0496118_0017445 3300048921 Bacteria 6535
350 Ga0496118_0123512 3300048921 Bacteria 1681
351 Ga0496119_0000287 3300048922 Bacteria 70711
352 Ga0496119_0000698 3300048922 Bacteria 45004
353 Ga0496119_0075247 3300048922 Bacteria 1963
354 Ga0496120_0001671 3300048923 Bacteria 25524
355 Ga0496120_0013282 3300048923 Bacteria 5554
356 Ga0496120_0122888 3300048923 Bacteria 1340
357 Ga0496121_0012531 3300048924 Bacteria 9229
358 Ga0496121_0012734 3300048924 Bacteria 9118
359 Ga0496121_0031693 3300048924 Bacteria 4824
360 Ga0496121_0106939 3300048924 Bacteria 2144
361 Ga0501032_0002729 3300049569 Bacteria 13755
362 Ga0501037_0057684 3300049573 Bacteria 2834
363 Ga0501038_0004276 3300049574 Bacteria 13280
364 Ga0501043_0030506 3300049579 Bacteria 4238
365 Ga0501047_0029875 3300049581 Bacteria 5253
366 Ga0501047_0363781 3300049581 Bacteria 1282
367 Ga0501048_0000993 3300049582 Bacteria 21113
368 Ga0501069_0008030 3300049585 Bacteria 5543
369 Ga0501070_0001777 3300049586 Bacteria 19049
370 Ga0501070_0010497 3300049586 Bacteria 7833
371 Ga0501070_0076059 3300049586 Bacteria 2779
372 Ga0501073_0151190 3300049589 Bacteria 1609
373 Ga0501074_0082569 3300049590 Bacteria 2304
374 Ga0501079_0000159 3300049741 Bacteria 37178
375 Ga0501080_0000253 3300049742 Bacteria 40425
376 Ga0501080_0115588 3300049742 Bacteria 2487
377 Ga0501080_0172296 3300049742 Bacteria 1995
378 Ga0501081_0234474 3300049743 Bacteria 1337
379 Ga0501035_0052441 3300049822 Bacteria 3650
380 Ga0501035_0076821 3300049822 Bacteria 2952
381 Ga0501044_0000983 3300049823 Bacteria 34250
382 Ga0501044_0012441 3300049823 Bacteria 9215
383 Ga0501044_0205773 3300049823 Bacteria 1925
384 nmdc:mga08y16_23854_c1 3300050511 Bacteria 6461
385 nmdc:mga0n895_21974_c1 3300050512 Bacteria 5977
386 nmdc:mga0n895_57555_c1 3300050512 Bacteria 3832
387 nmdc:mga08x19_85339_c1 3300050514 Bacteria 2078
388 nmdc:mga0a205_106888_c1 3300050515 Bacteria 2696
389 nmdc:mga0a205_22154_c1 3300050515 Bacteria 6013
390 Ga0495595_0058890 3300053084 Bacteria 1795
391 Ga0500643_000127 3300053087 Bacteria 78546
392 Ga0466962_0136718 3300061719 Bacteria 1186
393 2506867672 2506783011 Bacteria 5323186
394 2508675742 2508501039 Bacteria 9978592
395 2517763902 2517572101 Bacteria 6884336
396 2528206244 2527291627 Bacteria 5309833
397 2528213080 2527291629 Bacteria 5267418
398 2546949296 2546825537 Bacteria 5389291
399 2548694627 2547132424 Bacteria 8348532
400 2579748000 2576861822 Bacteria 5004595
401 2579852916 2579778521 Bacteria 7624758
402 2619854090 2619618881 Bacteria 7521104
403 2620348933 2619619003 Bacteria 7619552
404 2626639591 2626541554 Bacteria 7741902
405 2671832942 2671180195 Bacteria 9757215
406 2676200856 2675902999 Bacteria 9438463
407 2686537253 2684623035 Bacteria 8032739
408 2686544880 2684623036 Bacteria 5199090
409 2689957791 2687453737 Bacteria 11203906
410 2689991079 2687453743 Bacteria 8361025
411 2710601991 2710264753 Bacteria 5455564
412 2774845434 2773857921 Bacteria 9435764
413 2774851098 2773857922 Bacteria 9757215
414 2774863561 2773857924 Bacteria 5256821
415 2774901989 2773857933 Bacteria 5818019
416 2895887277 2895880812 Bacteria 11255272
417 2919718743 2919713450 Bacteria 7431245
418 637878749 637000116 Bacteria 5433628
419 8002780365 8002775197 Bacteria 10728764
420 8002790037 8002784119 Bacteria 9788632
421 8054915369 8054913762 Bacteria 7713009
422 8054922807 8054920844 Bacteria 7068637
423 8055162866 8055157932 Bacteria 6429399
424 Ga0068852_100027300
425 JGI24737J22298_10038871
426 JGI24735J21928_10001543
427 JGI24751J29686_10006567
428 Ga0070658_10096663
429 Ga0070690_100017016
430 Ga0070670_100018055
431 Ga0070677_10048161
432 Ga0068869_100009504
433 Ga0068869_100186750
434 Ga0070666_10010010
435 Ga0070666_10043512
436 Ga0070680_100032553
437 Ga0070682_100039460
438 Ga0068868_100041041
439 Ga0068868_100082516
440 Ga0070689_100042784
441 Ga0070691_10026007
442 Ga0070691_10038122
443 Ga0070668_100008144
444 Ga0070668_100012434
445 Ga0070675_100012749
446 Ga0070671_100008341
447 Ga0070671_100016010
448 Ga0070674_100059944
449 Ga0070673_100041969
450 Ga0070688_100109706
451 Ga0070659_100011234
452 Ga0070659_100083425
453 Ga0070709_10019670
454 Ga0070714_100000077
455 Ga0070714_100039669
456 Ga0070713_100040385
457 Ga0070701_10021143
458 Ga0070701_10023565
459 Ga0070700_100000007
460 Ga0070700_100232854
461 Ga0070663_100022830
462 Ga0070663_100037882
463 Ga0070678_100082459
464 Ga0070662_100020536
465 Ga0070681_10013684
466 Ga0068867_100133807
467 Ga0070685_10031994
468 Ga0070685_10102744
469 Ga0070679_100016862
470 Ga0070679_100322857
471 Ga0070697_100065193
472 Ga0068853_100028851
473 Ga0070672_100141605
474 Ga0070686_100058226
475 Ga0070693_100011082
476 Ga0070693_100042454
477 Ga0070665_100002405
478 Ga0070665_100094089
479 Ga0070665_100135772
480 Ga0070665_100156368
481 Ga0070704_100005699
482 Ga0068855_100440216
483 Ga0068854_100017004
484 Ga0068854_100141271
485 Ga0068856_100002544
486 Ga0068856_100177911
487 Ga0070702_100005140
488 Ga0068852_100028363
489 Ga0068852_100063277
490 Ga0068859_100000204
491 Ga0068859_100003235
492 Ga0068864_100078849
493 Ga0068864_100082468
494 Ga0068866_10012679
495 Ga0068861_100089347
496 Ga0068870_10001678
497 Ga0068863_100000878
498 Ga0068863_100003686
499 Ga0068863_100004122
500 Ga0068863_100191843
501 Ga0068863_100207965
502 Ga0068858_100000036
503 Ga0068858_100008494
504 Ga0068858_100015774
505 Ga0068860_100000043
506 Ga0068862_100000240
507 Ga0081455_10001658
508 Ga0081455_10081818
509 Ga0081538_10087592
510 Ga0081540_1023939
511 Ga0070717_10143350
512 Ga0070715_10041658
513 Ga0070716_100031918
514 Ga0070712_100036178
515 Ga0097621_100034599
516 Ga0097621_100377560
517 Ga0068871_100020816
518 Ga0068871_100022037
519 Ga0075431_100089739
520 Ga0075433_10021165
521 Ga0075433_10139621
522 Ga0075434_100019879
523 Ga0075434_100047484
524 Ga0068865_100106250
525 Ga0075436_100016582
526 Ga0075436_100020124
527 Ga0097620_100000204
528 Ga0097620_100003235
529 Ga0075435_100020389
530 Ga0075435_100029579
531 Ga0105240_10157794
532 Ga0111539_10070950
533 Ga0111539_10084345
534 Ga0105245_10055758
535 Ga0105245_10116140
536 Ga0105245_10132494
537 Ga0105247_10000041
538 Ga0105247_10000749
539 Ga0114129_10144813
540 Ga0105243_10011612
541 Ga0105243_10155024
542 Ga0105241_10124966
543 Ga0105242_10011682
544 Ga0105248_10000028
545 Ga0105248_10020315
546 Ga0105248_10136467
547 Ga0105237_10025806
548 Ga0105237_10059193
549 Ga0105237_10167512
550 Ga0105238_10062713
551 Ga0105238_10166811
552 Ga0105249_10032172
553 Ga0105249_10125645
554 Ga0105249_10357607
555 Ga0105239_10046577
556 Ga0105246_10018967
557 Ga0105246_10033943
558 Ga0157373_10072209
559 Ga0157371_10016737
560 Ga0157371_10050238
561 Ga0157370_10070224
562 Ga0157370_10084061
563 Ga0157370_10085966
564 Ga0157369_10050209
565 Ga0157374_10018755
566 Ga0157374_10080781
567 Ga0157378_10246906
568 Ga0163162_10019777
569 Ga0157372_10000025
570 Ga0157372_10019840
571 Ga0157375_10013121
572 Ga0157375_10228955
573 Ga0163163_10015869
574 Ga0163163_10067070
575 Ga0163163_10238715
576 Ga0157377_10019047
577 Ga0157379_10000062
578 Ga0157379_10010201
579 Ga0157379_10019462
580 Ga0157379_10075916
581 Ga0157376_10090982
582 Ga0157376_10111397
583 Ga0163161_10006125
584 Ga0206356_11444655
585 Ga0206353_10409162
586 Ga0213876_10007985
587 Ga0213876_10059914
588 Ga0213875_10105420
589 Ga0207710_10000012
590 Ga0207710_10000038
591 Ga0207710_10024364
592 Ga0207688_10003782
593 Ga0207688_10004578
594 Ga0207680_10009479
595 Ga0207685_10025964
596 Ga0207699_10125246
597 Ga0207643_10000829
598 Ga0207705_10189407
599 Ga0207654_10036713
600 Ga0207654_10122349
601 Ga0207695_10061092
602 Ga0207663_10026072
603 Ga0207660_10019684
604 Ga0207662_10108785
605 Ga0207657_10010771
606 Ga0207657_10017936
607 Ga0207650_10010854
608 Ga0207659_10034625
609 Ga0207687_10005089
610 Ga0207687_10047718
611 Ga0207700_10088564
612 Ga0207664_10000091
613 Ga0207664_10087728
614 Ga0207664_10228166
615 Ga0207644_10011951
616 Ga0207644_10083807
617 Ga0207670_10009072
618 Ga0207670_10013951
619 Ga0207704_10045236
620 Ga0207665_10002599
621 Ga0207665_10034348
622 Ga0207691_10085421
623 Ga0207711_10000090
624 Ga0207711_10119884
625 Ga0207711_10154256
626 Ga0207689_10004570
627 Ga0207661_10005683
628 Ga0207679_10043436
629 Ga0207667_10023018
630 Ga0207667_10071430
631 Ga0207712_10062336
632 Ga0207712_10261152
633 Ga0207668_10007845
634 Ga0207640_10061159
635 Ga0207658_10008848
636 Ga0207677_10006425
637 Ga0207677_10024362
638 Ga0207703_10000063
639 Ga0207703_10033197
640 Ga0207703_10126377
641 Ga0207639_10079587
642 Ga0207639_10382498
643 Ga0207678_10000537
644 Ga0207678_10028480
645 Ga0207708_10000006
646 Ga0207708_10022403
647 Ga0207708_10140284
648 Ga0207702_10006347
649 Ga0207702_10010215
650 Ga0207641_10006184
651 Ga0207641_10007191
652 Ga0207641_10062222
653 Ga0207641_10064842
654 Ga0207676_10001429
655 Ga0207675_100010774
656 Ga0207675_100088874
657 Ga0207683_10016169
658 Ga0207683_10144880
659 Ga0207698_10135278
660 Ga0207698_10268980
661 Ga0268266_10002418
662 Ga0268265_10000252
663 Ga0268264_10000027
664 Ga0268264_10055805
665 Ga0265338_10064116
666 Ga0265325_10002422
667 Ga0265339_10007013
668 Ga0265316_10033805
669 Ga0265314_10015953
670 Ga0373938_0003434
671 Ga0373952_0023133
672 Ga0373939_0003687
673 Ga0373941_0014927
674 Ga0373945_0016271
675 Ga0373960_0018355
676 Ga0373943_0098711
677 Ga0436364_1306216
678 Ga0436365_0457442
679 Ga0436365_0644730
680 Ga0439448_0004591
681 Ga0439463_029758
682 Ga0439459_0005561
683 Ga0466969_0067422
684 Ga0466966_0019184
685 Ga0466966_0043014
686 Ga0466966_0072563
687 Ga0466966_0163718
688 Ga0466961_0004122
689 Ga0466961_0008313
690 Ga0466961_0014098
691 Ga0466961_0089045
692 Ga0466963_0005581
693 Ga0466963_0007662
694 Ga0466963_0053915
695 Ga0466963_0054426
696 Ga0466963_0056812
697 Ga0466963_0111377
698 Ga0466963_0153164
699 Ga0466971_0004223
700 Ga0466971_0024616
701 Ga0466968_0033076
702 Ga0466957_0001673
703 Ga0466957_0049814
704 Ga0466957_0125175
705 Ga0466957_0142528
706 Ga0466957_0176440
707 Ga0466960_0007733
708 Ga0466960_0020663
709 Ga0466959_0095687
710 Ga0466959_0095832
711 Ga0466958_0018091
712 Ga0466958_0026907
713 Ga0466958_0052273
714 Ga0466967_0001494
715 Ga0466967_0004741
716 Ga0466967_0040045
717 Ga0466967_0064176
718 Ga0466967_0083644
719 Ga0466967_0185999
720 Ga0466967_0288310
721 Ga0466967_0376527
722 Ga0466967_0510992
723 Ga0495603_0128919
724 Ga0495629_0001778
725 Ga0495641_0047520
726 Ga0495580_0110227
727 Ga0495582_0000234
728 Ga0495630_0096117
729 Ga0495665_0026026
730 Ga0495658_0002257
731 Ga0495658_0065159
732 Ga0495613_0000835
733 Ga0495613_0014374
734 Ga0496101_0024986
735 Ga0496101_0128194
736 Ga0496101_0264498
737 Ga0496102_0000072
738 Ga0496102_0000791
739 Ga0496102_0005958
740 Ga0496102_0009054
741 Ga0496102_0134084
742 Ga0496102_0465318
743 Ga0496103_0000053
744 Ga0496103_0015175
745 Ga0496104_0141007
746 Ga0496104_0205560
747 Ga0496104_0298689
748 Ga0496105_0013326
749 Ga0496105_0062062
750 Ga0496106_0030436
751 Ga0496106_0088695
752 Ga0496107_0131151
753 Ga0496108_0048229
754 Ga0496108_0171843
755 Ga0496109_0014395
756 Ga0496109_0040332
757 Ga0496109_0055197
758 Ga0496109_0231602
759 Ga0496110_0026446
760 Ga0496111_0007759
761 Ga0496111_0043116
762 Ga0496112_0002822
763 Ga0496112_0345746
764 Ga0496113_0166859
765 Ga0496114_0153788
766 Ga0496115_0007175
767 Ga0496115_0185255
768 Ga0496116_0000150
769 Ga0496117_0055391
770 Ga0496117_0121222
771 Ga0496118_0000521
772 Ga0496118_0017445
773 Ga0496118_0123512
774 Ga0496119_0000287
775 Ga0496119_0000698
776 Ga0496119_0075247
777 Ga0496120_0001671
778 Ga0496120_0013282
779 Ga0496120_0122888
780 Ga0496121_0012531
781 Ga0496121_0012734
782 Ga0496121_0031693
783 Ga0496121_0106939
784 Ga0501032_0002729
785 Ga0501037_0057684
786 Ga0501038_0004276
787 Ga0501043_0030506
788 Ga0501047_0029875
789 Ga0501047_0363781
790 Ga0501048_0000993
791 Ga0501069_0008030
792 Ga0501070_0001777
793 Ga0501070_0010497
794 Ga0501070_0076059
795 Ga0501073_0151190
796 Ga0501074_0082569
797 Ga0501079_0000159
798 Ga0501080_0000253
799 Ga0501080_0115588
800 Ga0501080_0172296
801 Ga0501081_0234474
802 Ga0501035_0052441
803 Ga0501035_0076821
804 Ga0501044_0000983
805 Ga0501044_0012441
806 Ga0501044_0205773
807 nmdc:mga08y16_23854_c1
808 nmdc:mga0n895_21974_c1
809 nmdc:mga0n895_57555_c1
810 nmdc:mga08x19_85339_c1
811 nmdc:mga0a205_106888_c1
812 nmdc:mga0a205_22154_c1
813 Ga0495595_0058890
814 Ga0500643_000127
815 Ga0466962_0136718
816 2506867672
817 2508675742
818 2517763902
819 2528206244
820 2528213080
821 2546949296
822 2548694627
823 2579748000
824 2579852916
825 2619854090
826 2620348933
827 2626639591
828 2671832942
829 2676200856
830 2686537253
831 2686544880
832 2689957791
833 2689991079
834 2710601991
835 2774845434
836 2774851098
837 2774863561
838 2774901989
839 2895887277
840 2919718743
841 637878749
842 8002780365
843 8002790037
844 8054915369
845 8054922807
846 8055162866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

46

58

0.98

PF00953

Glycos_transf_4

Glycosyl transferase family 4

84

282

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyh-assembly2.cif.gz_C crystal structure of mray bound to carbacaprazamycin 0.8896 9 357
6oz6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8895 5 357
8cxr-assembly2.cif.gz_C crystal structure of mray bound to a sphaerimicin analogue 0.888 5 357
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8858 5 357
6oyz-assembly3.cif.gz_B crystal structure of mray bound to capuramycin 0.8855 5 357
ID Description Score Start End Superfamily
af_Q4D9X4_97_223_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3998 281 362 1.10.287.70
af_Q4DMD4_110_261_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.3254 281 362 3.30.40.10
af_Q9FHX2_244_410_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.3162 84 173 1.50.40.10
af_A0A0R0GC05_3_236_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.3157 9 137 1.50.40.10
af_Q46755_4_127_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.295 4 128 1.20.120.550
ID Description Score Start End GO Terms
AF-J9DWZ0-F1-model_v4 deleted 0.9751 92 291
AF-A0A7K0T0X0-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9611 60 363 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0051992
GO:0071555
AF-A0A838SNB1-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9549 76 362 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0071555
AF-A0A0Y1CT68-F1-model_v4 deleted 0.9544 55 364
AF-A0A6J7SWU6-F1-model_v4 Unannotated protein 0.9544 55 363 GO:0005886
GO:0008963
GO:0044038
GO:0071555

Map