F440459

General Info

Members Datasets Scaffolds Average Seq Length
423 225 846 186

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10051944|Ga0070709_100519443
Length 210
Sequence MNSSREALAVTVGGASPADDARMPSGNSPVSHEPAPQKFRQVLGHFCTGVTVVTAIDDGEPVGFACQAFAALSLRPPLVVFCPALTSNTWPRIAKGKMFAVNVLTEDQHDVAMRFGRSGPRKFDGVTWMPDAAGSPVIDGVLTWAGCEIEAVHPGGDHNVVIGRVRELGECGSQRPLLFYRGRFATSAESGGPPEVVETLLAWPRHADWM

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
93 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
94 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
152 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
153 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
154 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
178 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
212 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
213 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
214 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
215 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
216 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
217 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
218 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
219 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
220 2558860280 Kutzneria sp. 744 Isolate Unclassified
221 2582580736 Prauserella sp. Am3 Isolate Unclassified
222 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
223 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
224 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
225 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 96.45
Metatranscriptomes 0.95
Isolates 2.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 1.65
Rhizosphere 91.96
Stem 0
Stem Tuber 0.24
Unclassified 0.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10051944 3300005434 Bacteria 2574
2 rootL2_10100306 3300003322 Bacteria 1981
3 Ga0070683_100121392 3300005329 Bacteria 2469
4 Ga0070683_100287394 3300005329 Bacteria 1564
5 Ga0070690_100457219 3300005330 Bacteria 948
6 Ga0070682_100543698 3300005337 Bacteria 908
7 Ga0068868_100154459 3300005338 Bacteria 1892
8 Ga0070668_100000642 3300005347 Bacteria 23581
9 Ga0070668_100106314 3300005347 Bacteria 2230
10 Ga0070674_100109239 3300005356 Bacteria 2028
11 Ga0070667_100151305 3300005367 Bacteria 2039
12 Ga0070709_10058237 3300005434 Bacteria 2449
13 Ga0070709_10262065 3300005434 Bacteria 1249
14 Ga0070709_10262884 3300005434 Bacteria 1247
15 Ga0070714_100001784 3300005435 Bacteria 15666
16 Ga0070714_100010001 3300005435 Bacteria 7482
17 Ga0070714_100080488 3300005435 Bacteria 2835
18 Ga0070714_100813123 3300005435 Bacteria 905
19 Ga0070713_100374085 3300005436 Bacteria 1326
20 Ga0070711_100138556 3300005439 Bacteria 1821
21 Ga0070708_100020771 3300005445 Bacteria 5543
22 Ga0070678_100799927 3300005456 Bacteria 856
23 Ga0070681_10332164 3300005458 Bacteria 1430
24 Ga0070681_11186468 3300005458 Bacteria 685
25 Ga0070706_100097564 3300005467 Bacteria 2730
26 Ga0070706_100266858 3300005467 Bacteria 1598
27 Ga0070707_100002696 3300005468 Bacteria 16886
28 Ga0070707_100092633 3300005468 Bacteria 2926
29 Ga0070707_100176650 3300005468 Bacteria 2081
30 Ga0070707_100370406 3300005468 Bacteria 1392
31 Ga0070707_100536598 3300005468 Bacteria 1132
32 Ga0070698_100014548 3300005471 Bacteria 8307
33 Ga0070698_100077424 3300005471 Bacteria 3326
34 Ga0070679_100753027 3300005530 Bacteria 917
35 Ga0070684_100335495 3300005535 Bacteria 1390
36 Ga0068853_100006867 3300005539 Bacteria 9079
37 Ga0068853_100171320 3300005539 Bacteria 1964
38 Ga0068853_100583531 3300005539 Bacteria 1061
39 Ga0070665_100781280 3300005548 Bacteria 968
40 Ga0068855_100106997 3300005563 Bacteria 3213
41 Ga0068855_100132138 3300005563 Bacteria 2850
42 Ga0068855_100568603 3300005563 Bacteria 1225
43 Ga0068857_100192986 3300005577 Bacteria 1855
44 Ga0068856_100095616 3300005614 Bacteria 2959
45 Ga0068856_100125185 3300005614 Bacteria 2573
46 Ga0068856_100218170 3300005614 Bacteria 1922
47 Ga0068856_100495099 3300005614 Bacteria 1243
48 Ga0068852_100003383 3300005616 Bacteria 11137
49 Ga0068852_100124460 3300005616 Bacteria 2365
50 Ga0068852_100851283 3300005616 Bacteria 927
51 Ga0068852_101009434 3300005616 Bacteria 851
52 Ga0068859_100170944 3300005617 Bacteria 2254
53 Ga0068864_100067618 3300005618 Bacteria 3103
54 Ga0068866_10270937 3300005718 Bacteria 1048
55 Ga0068863_100594621 3300005841 Bacteria 1095
56 Ga0068863_101296151 3300005841 Bacteria 735
57 Ga0068858_100007728 3300005842 Bacteria 10376
58 Ga0068858_100165460 3300005842 Bacteria 2084
59 Ga0068860_100013888 3300005843 Bacteria 7896
60 Ga0068862_100054406 3300005844 Bacteria 3427
61 Ga0068862_100069927 3300005844 Bacteria 3030
62 Ga0068862_100413037 3300005844 Bacteria 1265
63 Ga0081539_10030046 3300005985 Bacteria 3382
64 Ga0070717_10131450 3300006028 Bacteria 2153
65 Ga0070717_10332201 3300006028 Bacteria 1356
66 Ga0070717_10438733 3300006028 Bacteria 1176
67 Ga0070717_10646453 3300006028 Bacteria 960
68 Ga0070717_10807251 3300006028 Bacteria 854
69 Ga0070717_10851850 3300006028 Bacteria 829
70 Ga0070712_100235554 3300006175 Bacteria 1456
71 Ga0070712_100551135 3300006175 Unclassified 971
72 Ga0097621_100401774 3300006237 Bacteria 1227
73 Ga0068871_100456772 3300006358 Bacteria 1146
74 Ga0075428_100026332 3300006844 Bacteria 6438
75 Ga0075430_100562391 3300006846 Unclassified 941
76 Ga0075431_100012552 3300006847 Bacteria 8551
77 Ga0075434_100679730 3300006871 Bacteria 1047
78 Ga0075434_101214965 3300006871 Bacteria 766
79 Ga0097620_100170949 3300006931 Bacteria 2254
80 Ga0099794_10081969 3300007265 Unclassified 1592
81 Ga0105245_10059775 3300009098 Bacteria 3432
82 Ga0114129_10635124 3300009147 Bacteria 1380
83 Ga0105241_10084581 3300009174 Bacteria 2491
84 Ga0105241_10314544 3300009174 Bacteria 1348
85 Ga0105241_10981419 3300009174 Bacteria 789
86 Ga0105237_10127256 3300009545 Bacteria 2542
87 Ga0105237_10448829 3300009545 Bacteria 1295
88 Ga0105239_10870538 3300010375 Bacteria 1034
89 Ga0105246_10481392 3300011119 Bacteria 1050
90 Ga0157370_10126047 3300013104 Bacteria 2390
91 Ga0157372_10648794 3300013307 Bacteria 1229
92 Ga0157375_10969994 3300013308 Bacteria 991
93 Ga0163163_10013062 3300014325 Bacteria 7585
94 Ga0157379_10011411 3300014968 Bacteria 7754
95 Ga0157379_10172455 3300014968 Bacteria 1953
96 Ga0157376_10050181 3300014969 Bacteria 3461
97 Ga0206354_10114562 3300020081 Bacteria 2635
98 Ga0206354_11252411 3300020081 Bacteria 997
99 Ga0224712_10206269 3300022467 Bacteria 895
100 Ga0207692_10022235 3300025898 Bacteria 2915
101 Ga0207647_10273511 3300025904 Bacteria 965
102 Ga0207699_10116924 3300025906 Bacteria 1718
103 Ga0207684_10004936 3300025910 Bacteria 12444
104 Ga0207684_10021546 3300025910 Bacteria 5503
105 Ga0207654_10386830 3300025911 Bacteria 970
106 Ga0207654_10592570 3300025911 Bacteria 790
107 Ga0207707_10411308 3300025912 Bacteria 1161
108 Ga0207671_10742620 3300025914 Bacteria 780
109 Ga0207693_10257132 3300025915 Bacteria 1370
110 Ga0207693_10338948 3300025915 Bacteria 1177
111 Ga0207663_10226928 3300025916 Bacteria 1362
112 Ga0207663_10332347 3300025916 Bacteria 1145
113 Ga0207652_10809894 3300025921 Bacteria 831
114 Ga0207646_10007233 3300025922 Bacteria 11321
115 Ga0207646_10087117 3300025922 Bacteria 2794
116 Ga0207646_10091567 3300025922 Bacteria 2721
117 Ga0207646_10155137 3300025922 Bacteria 2065
118 Ga0207646_10274483 3300025922 Bacteria 1524
119 Ga0207687_10049946 3300025927 Bacteria 2910
120 Ga0207700_10983448 3300025928 Bacteria 755
121 Ga0207664_10004900 3300025929 Bacteria 9096
122 Ga0207664_10063981 3300025929 Bacteria 2941
123 Ga0207664_10191336 3300025929 Bacteria 1761
124 Ga0207669_10086385 3300025937 Bacteria 2028
125 Ga0207665_10048699 3300025939 Bacteria 2846
126 Ga0207689_10050515 3300025942 Bacteria 3428
127 Ga0207661_10183440 3300025944 Bacteria 1830
128 Ga0207661_10242498 3300025944 Bacteria 1600
129 Ga0207667_10035492 3300025949 Bacteria 5349
130 Ga0207667_10109923 3300025949 Bacteria 2843
131 Ga0207668_10002146 3300025972 Bacteria 11505
132 Ga0207668_10076257 3300025972 Bacteria 2413
133 Ga0207703_10155220 3300026035 Bacteria 1999
134 Ga0207703_10667242 3300026035 Bacteria 987
135 Ga0207639_10033387 3300026041 Bacteria 3796
136 Ga0207678_10068865 3300026067 Bacteria 3035
137 Ga0207702_10029806 3300026078 Bacteria 4542
138 Ga0207702_10139684 3300026078 Bacteria 2190
139 Ga0207641_10289122 3300026088 Bacteria 1545
140 Ga0207641_10339619 3300026088 Bacteria 1429
141 Ga0207676_10215343 3300026095 Bacteria 1707
142 Ga0207674_10159082 3300026116 Bacteria 2214
143 Ga0207683_10317212 3300026121 Bacteria 1427
144 Ga0207683_10708406 3300026121 Bacteria 933
145 Ga0207698_10055762 3300026142 Bacteria 3048
146 Ga0207698_10152976 3300026142 Bacteria 2005
147 Ga0207698_10445307 3300026142 Bacteria 1249
148 Ga0268266_10147232 3300028379 Bacteria 2119
149 Ga0268265_10399944 3300028380 Bacteria 1269
150 Ga0268264_10140334 3300028381 Bacteria 2154
151 Ga0307515_10000192 3300028794 Bacteria 149030
152 Ga0307515_10006596 3300028794 Bacteria 23161
153 Ga0307511_10000710 3300030521 Bacteria 35487
154 Ga0307512_10052339 3300030522 Bacteria 3257
155 Ga0265340_10002821 3300031247 Bacteria 9890
156 Ga0307513_10036349 3300031456 Bacteria 5495
157 Ga0307509_10010476 3300031507 Bacteria 11349
158 Ga0307509_10132567 3300031507 Bacteria 2444
159 Ga0307508_10008065 3300031616 Bacteria 9766
160 Ga0307514_10464877 3300031649 Bacteria 616
161 Ga0307516_10001960 3300031730 Bacteria 28187
162 Ga0307516_10018627 3300031730 Bacteria 7210
163 Ga0307410_10382914 3300031852 Bacteria 1132
164 Ga0307407_10178286 3300031903 Bacteria 1406
165 Ga0307409_100019191 3300031995 Bacteria 4622
166 Ga0307409_100090990 3300031995 Bacteria 2499
167 Ga0307416_100946704 3300032002 Bacteria 963
168 Ga0307414_10259751 3300032004 Bacteria 1449
169 Ga0307415_100004665 3300032126 Bacteria 7163
170 Ga0307507_10014654 3300033179 Bacteria 9324
171 Ga0373934_0056653 3300035086 Bacteria 1559
172 Ga0373934_0088825 3300035086 Bacteria 1245
173 Ga0373940_0032574 3300035088 Bacteria 1397
174 Ga0373944_0000933 3300035089 Bacteria 7245
175 Ga0373944_0056648 3300035089 Bacteria 1248
176 Ga0373923_0006952 3300035111 Bacteria 3948
177 Ga0373923_0014585 3300035111 Bacteria 2955
178 Ga0373932_0032565 3300035112 Bacteria 1459
179 Ga0373936_0001965 3300035113 Bacteria 7603
180 Ga0373936_0227125 3300035113 Bacteria 829
181 Ga0373939_0071107 3300035114 Bacteria 1133
182 Ga0373945_0000063 3300035116 Bacteria 23921
183 Ga0373954_0014967 3300035118 Bacteria 3463
184 Ga0373956_0186996 3300035119 Bacteria 980
185 Ga0373943_0081469 3300035170 Bacteria 1660
186 Ga0373946_0002355 3300035171 Bacteria 6680
187 Ga0373946_0073746 3300035171 Bacteria 1480
188 Ga0373946_0294132 3300035171 Bacteria 802
189 Ga0373955_0060772 3300035172 Bacteria 2085
190 Ga0373955_0125442 3300035172 Bacteria 1495
191 Ga0373942_0000165 3300035207 Bacteria 16207
192 Ga0373962_0004350 3300035242 Bacteria 3421
193 Ga0373924_0020390 3300035410 Bacteria 2576
194 Ga0373935_0010347 3300035692 Bacteria 5595
195 Ga0373935_0011868 3300035692 Bacteria 5234
196 Ga0373935_0269799 3300035692 Bacteria 1195
197 Ga0373935_0436361 3300035692 Bacteria 944
198 Ga0373927_0001934 3300035695 Bacteria 15296
199 Ga0373927_0454536 3300035695 Bacteria 846
200 Ga0373933_0005089 3300035724 Bacteria 7169
201 Ga0373947_0000952 3300035725 Bacteria 17638
202 Ga0373947_0394994 3300035725 Bacteria 932
203 Ga0373937_0035271 3300036401 Bacteria 4552
204 Ga0373937_0142431 3300036401 Bacteria 2243
205 Ga0373937_0159771 3300036401 Bacteria 2113
206 Ga0372808_006301 3300036459 Bacteria 1595
207 Ga0373925_0011397 3300037068 Bacteria 6444
208 Ga0373925_0063320 3300037068 Bacteria 2783
209 Ga0373925_0091159 3300037068 Bacteria 2330
210 Ga0373925_0122286 3300037068 Bacteria 2021
211 Ga0373925_0134189 3300037068 Bacteria 1933
212 Ga0373925_0213533 3300037068 Bacteria 1538
213 Ga0373925_0327006 3300037068 Bacteria 1241
214 Ga0373925_0499538 3300037068 Bacteria 998
215 Ga0373925_0593170 3300037068 Bacteria 912
216 Ga0436364_1113755 3300037853 Bacteria 3510
217 Ga0451851_1253244 3300041507 Bacteria 710
218 Ga0451853_0390109 3300041512 Bacteria 9634
219 Ga0466969_0028966 3300044656 Bacteria 2829
220 Ga0466969_0057438 3300044656 Bacteria 1897
221 Ga0466969_0058537 3300044656 Bacteria 1875
222 Ga0466969_0278703 3300044656 Bacteria 757
223 Ga0466972_0016371 3300044658 Bacteria 3708
224 Ga0466972_0176440 3300044658 Bacteria 1002
225 Ga0466966_0001650 3300044684 Bacteria 14382
226 Ga0466966_0026200 3300044684 Bacteria 3808
227 Ga0466966_0031267 3300044684 Bacteria 3453
228 Ga0466966_0187505 3300044684 Bacteria 1254
229 Ga0466966_0237401 3300044684 Bacteria 1099
230 Ga0466961_0004033 3300044693 Bacteria 9201
231 Ga0466961_0004276 3300044693 Bacteria 8940
232 Ga0466961_0022184 3300044693 Bacteria 4084
233 Ga0466961_0041146 3300044693 Bacteria 2962
234 Ga0466961_0081521 3300044693 Bacteria 2047
235 Ga0466961_0136107 3300044693 Bacteria 1539
236 Ga0466961_0209259 3300044693 Bacteria 1204
237 Ga0466961_0385203 3300044693 Bacteria 851
238 Ga0466963_0014374 3300044694 Bacteria 4880
239 Ga0466963_0026988 3300044694 Bacteria 3674
240 Ga0466963_0131025 3300044694 Bacteria 1732
241 Ga0466963_0141253 3300044694 Bacteria 1668
242 Ga0466963_0559551 3300044694 Bacteria 808
243 Ga0466964_0029158 3300044706 Bacteria 2178
244 Ga0466964_0068735 3300044706 Bacteria 1492
245 Ga0466964_0117299 3300044706 Bacteria 1195
246 Ga0466971_0051465 3300044719 Bacteria 1854
247 Ga0466971_0184604 3300044719 Bacteria 981
248 Ga0466971_0261762 3300044719 Bacteria 825
249 Ga0466970_0005415 3300044765 Bacteria 6333
250 Ga0466970_0026454 3300044765 Bacteria 3040
251 Ga0466970_0067756 3300044765 Bacteria 1917
252 Ga0466970_0152957 3300044765 Bacteria 1274
253 Ga0466970_0282915 3300044765 Bacteria 933
254 Ga0466970_0439789 3300044765 Bacteria 747
255 Ga0466957_0034901 3300044842 Bacteria 3017
256 Ga0466957_0087130 3300044842 Bacteria 1952
257 Ga0466957_0137273 3300044842 Bacteria 1573
258 Ga0466957_0232437 3300044842 Bacteria 1221
259 Ga0466960_0011462 3300044901 Bacteria 3711
260 Ga0466960_0110079 3300044901 Bacteria 1430
261 Ga0466959_0010676 3300045049 Bacteria 6575
262 Ga0466959_0011146 3300045049 Bacteria 6452
263 Ga0466959_0014151 3300045049 Bacteria 5791
264 Ga0466959_0020506 3300045049 Bacteria 4871
265 Ga0466959_0045663 3300045049 Bacteria 3226
266 Ga0466959_0434669 3300045049 Bacteria 890
267 Ga0466958_0015531 3300045836 Bacteria 4365
268 Ga0466958_0021062 3300045836 Bacteria 3806
269 Ga0466958_0032904 3300045836 Bacteria 3087
270 Ga0466958_0038351 3300045836 Bacteria 2874
271 Ga0466967_0005273 3300045976 Bacteria 8916
272 Ga0466967_0028282 3300045976 Bacteria 4679
273 Ga0466967_0041708 3300045976 Bacteria 3960
274 Ga0466967_0051496 3300045976 Bacteria 3609
275 Ga0466967_0063773 3300045976 Bacteria 3275
276 Ga0466967_0066441 3300045976 Bacteria 3213
277 Ga0466967_0644924 3300045976 Bacteria 1047
278 Ga0466967_0676595 3300045976 Bacteria 1021
279 Ga0495592_0000831 3300046454 Bacteria 21457
280 Ga0495592_0012576 3300046454 Bacteria 6433
281 Ga0495629_0026174 3300046459 Bacteria 4145
282 Ga0495641_0040633 3300046461 Bacteria 2162
283 Ga0495641_0111772 3300046461 Bacteria 1219
284 Ga0495651_0013378 3300046462 Bacteria 6347
285 Ga0495651_0023908 3300046462 Bacteria 4752
286 Ga0495653_0007038 3300046463 Bacteria 9230
287 Ga0495653_0007844 3300046463 Bacteria 8740
288 Ga0495653_0074865 3300046463 Bacteria 2521
289 Ga0495653_0197737 3300046463 Bacteria 1367
290 Ga0495653_0528906 3300046463 Bacteria 732
291 Ga0495653_0534540 3300046463 Bacteria 727
292 Ga0495580_0307516 3300046472 Bacteria 1079
293 Ga0495639_0035868 3300046475 Bacteria 2220
294 Ga0495662_0018315 3300046476 Bacteria 3389
295 Ga0495664_0000220 3300046477 Bacteria 27274
296 Ga0495664_0011588 3300046477 Bacteria 4973
297 Ga0495664_0237742 3300046477 Bacteria 1102
298 Ga0495664_0332184 3300046477 Bacteria 916
299 Ga0495608_0006046 3300046511 Bacteria 8603
300 Ga0495608_0039732 3300046511 Bacteria 3153
301 Ga0495608_0247361 3300046511 Bacteria 1112
302 Ga0495608_0590993 3300046511 Bacteria 667
303 Ga0495618_0029618 3300046514 Bacteria 3415
304 Ga0495618_0048267 3300046514 Bacteria 2687
305 Ga0495618_0322492 3300046514 Bacteria 956
306 Ga0495628_0017031 3300046516 Bacteria 6055
307 Ga0495628_0088443 3300046516 Bacteria 2400
308 Ga0495628_0088529 3300046516 Bacteria 2399
309 Ga0495628_0542930 3300046516 Bacteria 835
310 Ga0495630_0013951 3300046517 Bacteria 5846
311 Ga0495630_0037988 3300046517 Bacteria 3600
312 Ga0495632_0402031 3300046519 Bacteria 598
313 Ga0495652_0016513 3300046529 Bacteria 6602
314 Ga0495652_0060987 3300046529 Bacteria 3185
315 Ga0495652_0119261 3300046529 Bacteria 2107
316 Ga0495652_0196360 3300046529 Bacteria 1535
317 Ga0495665_0017714 3300046531 Bacteria 3830
318 Ga0495665_0274775 3300046531 Bacteria 865
319 Ga0495586_0299090 3300046535 Bacteria 922
320 Ga0495587_0000447 3300046536 Bacteria 28860
321 Ga0495587_0010978 3300046536 Bacteria 5745
322 Ga0495645_0016849 3300046543 Bacteria 5229
323 Ga0495645_0255790 3300046543 Bacteria 1162
324 Ga0495645_0381911 3300046543 Bacteria 901
325 Ga0495645_0482594 3300046543 Bacteria 777
326 Ga0495667_0016695 3300046559 Bacteria 4956
327 Ga0495667_0025994 3300046559 Bacteria 3943
328 Ga0495667_0112476 3300046559 Bacteria 1759
329 Ga0495667_0214838 3300046559 Bacteria 1228
330 Ga0495634_0024606 3300046642 Bacteria 4222
331 Ga0495634_0068544 3300046642 Bacteria 2343
332 Ga0495635_0002796 3300046663 Bacteria 11958
333 Ga0495635_0050976 3300046663 Bacteria 2853
334 Ga0495635_0104837 3300046663 Bacteria 1932
335 Ga0495657_0017210 3300046675 Bacteria 5252
336 Ga0495657_0020546 3300046675 Bacteria 4745
337 Ga0495657_0027808 3300046675 Bacteria 3986
338 Ga0495599_0003339 3300046678 Bacteria 9376
339 Ga0495599_0077020 3300046678 Bacteria 2082
340 Ga0495599_0172601 3300046678 Bacteria 1333
341 Ga0495599_0269869 3300046678 Bacteria 1032
342 Ga0495623_0045361 3300046679 Bacteria 2792
343 Ga0495623_0367397 3300046679 Bacteria 780
344 Ga0495646_0006144 3300046680 Bacteria 7613
345 Ga0495646_0057066 3300046680 Bacteria 2339
346 Ga0495646_0090674 3300046680 Bacteria 1766
347 Ga0495646_0160834 3300046680 Bacteria 1243
348 Ga0495646_0206478 3300046680 Bacteria 1068
349 Ga0495624_0015798 3300046690 Bacteria 5085
350 Ga0495600_0003949 3300046809 Bacteria 8809
351 Ga0495600_0321840 3300046809 Bacteria 972
352 Ga0495581_0034086 3300047315 Bacteria 2946
353 Ga0495604_0025669 3300047317 Bacteria 4693
354 Ga0495604_0141485 3300047317 Bacteria 1718
355 Ga0495674_0003143 3300047319 Bacteria 16039
356 Ga0495674_0027159 3300047319 Bacteria 5233
357 Ga0495674_0036929 3300047319 Bacteria 4392
358 Ga0495676_0017043 3300047321 Bacteria 6428
359 Ga0495680_0016778 3300047322 Bacteria 6278
360 Ga0495680_0063623 3300047322 Bacteria 2832
361 Ga0495680_0093809 3300047322 Bacteria 2246
362 Ga0495684_0010271 3300047471 Bacteria 7238
363 Ga0495684_0029680 3300047471 Bacteria 4196
364 Ga0495684_0079329 3300047471 Bacteria 2492
365 Ga0495684_0346809 3300047471 Bacteria 1055
366 Ga0495593_0269227 3300047673 Bacteria 852
367 Ga0495602_0025288 3300048088 Bacteria 5747
368 Ga0495602_0096004 3300048088 Bacteria 2445
369 Ga0495602_0534172 3300048088 Bacteria 815
370 Ga0495602_0633759 3300048088 Bacteria 732
371 Ga0496102_0000721 3300048905 Bacteria 32596
372 Ga0496103_0018149 3300048906 Bacteria 4219
373 Ga0496104_0029437 3300048907 Bacteria 5094
374 Ga0496105_0082271 3300048908 Bacteria 2659
375 Ga0496108_0000041 3300048911 Bacteria 147365
376 Ga0496108_0053815 3300048911 Bacteria 3376
377 Ga0496112_0120885 3300048915 Bacteria 2589
378 Ga0501031_0005462 3300049568 Bacteria 8270
379 Ga0501031_0061234 3300049568 Bacteria 2453
380 Ga0501032_0003445 3300049569 Bacteria 12118
381 Ga0501033_0029835 3300049570 Bacteria 4099
382 Ga0501033_0072692 3300049570 Bacteria 2525
383 Ga0501033_0153390 3300049570 Bacteria 1661
384 Ga0501034_0006559 3300049571 Bacteria 12500
385 Ga0501036_0194115 3300049572 Bacteria 1708
386 Ga0501038_0000163 3300049574 Bacteria 56384
387 Ga0501038_0169722 3300049574 Bacteria 1767
388 Ga0501043_0027114 3300049579 Bacteria 4497
389 Ga0501047_0005021 3300049581 Bacteria 12423
390 Ga0501047_0444660 3300049581 Bacteria 1126
391 Ga0501048_0000286 3300049582 Bacteria 34220
392 Ga0501070_0007934 3300049586 Bacteria 8993
393 Ga0501073_0244055 3300049589 Bacteria 1240
394 Ga0501035_0070848 3300049822 Bacteria 3087
395 Ga0501035_0197282 3300049822 Bacteria 1728
396 Ga0501044_0025587 3300049823 Bacteria 6257
397 Ga0501044_0037255 3300049823 Bacteria 5084
398 nmdc:mga05p37_712127_c1 3300050507 Bacteria 1113
399 nmdc:mga0qj67_191096_c1 3300050509 Bacteria 1664
400 nmdc:mga06r32_1287_c1 3300050510 Bacteria 10168
401 nmdc:mga0n895_702050_c1 3300050512 Bacteria 1007
402 Ga0495601_0012087 3300053077 Bacteria 5174
403 Ga0495612_0053101 3300053078 Bacteria 1668
404 Ga0495612_0084474 3300053078 Bacteria 1337
405 Ga0495595_0047705 3300053084 Bacteria 1976
406 Ga0495619_0432927 3300053085 Bacteria 907
407 Ga0500644_0070644 3300053088 Bacteria 1257
408 Ga0500583_0065727 3300053092 Bacteria 1724
409 Ga0500641_0143153 3300053096 Bacteria 1033
410 Ga0500600_0068113 3300053149 Bacteria 1960
411 Ga0500616_0000060 3300053153 Bacteria 252252
412 Ga0466962_0006925 3300061719 Bacteria 5435
413 2515494410 2515154088 Bacteria 5526283
414 2515719682 2515154129 Bacteria 5584369
415 2515756639 2515154137 Bacteria 5711575
416 2516084999 2515154202 Bacteria 5471270
417 2516088970 2515154203 Bacteria 5458536
418 2559431304 2558860280 Bacteria 11429938
419 2583149664 2582580736 Bacteria 5325865
420 2753265783 2751185782 Bacteria 11227053
421 2866557210 2866552031 Bacteria 5824618
422 2866618467 2866612099 Bacteria 7543886
423 2899372303 2899370129 Bacteria 6781179
424 Ga0070709_10051944
425 rootL2_10100306
426 Ga0070683_100121392
427 Ga0070683_100287394
428 Ga0070690_100457219
429 Ga0070682_100543698
430 Ga0068868_100154459
431 Ga0070668_100000642
432 Ga0070668_100106314
433 Ga0070674_100109239
434 Ga0070667_100151305
435 Ga0070709_10058237
436 Ga0070709_10262065
437 Ga0070709_10262884
438 Ga0070714_100001784
439 Ga0070714_100010001
440 Ga0070714_100080488
441 Ga0070714_100813123
442 Ga0070713_100374085
443 Ga0070711_100138556
444 Ga0070708_100020771
445 Ga0070678_100799927
446 Ga0070681_10332164
447 Ga0070681_11186468
448 Ga0070706_100097564
449 Ga0070706_100266858
450 Ga0070707_100002696
451 Ga0070707_100092633
452 Ga0070707_100176650
453 Ga0070707_100370406
454 Ga0070707_100536598
455 Ga0070698_100014548
456 Ga0070698_100077424
457 Ga0070679_100753027
458 Ga0070684_100335495
459 Ga0068853_100006867
460 Ga0068853_100171320
461 Ga0068853_100583531
462 Ga0070665_100781280
463 Ga0068855_100106997
464 Ga0068855_100132138
465 Ga0068855_100568603
466 Ga0068857_100192986
467 Ga0068856_100095616
468 Ga0068856_100125185
469 Ga0068856_100218170
470 Ga0068856_100495099
471 Ga0068852_100003383
472 Ga0068852_100124460
473 Ga0068852_100851283
474 Ga0068852_101009434
475 Ga0068859_100170944
476 Ga0068864_100067618
477 Ga0068866_10270937
478 Ga0068863_100594621
479 Ga0068863_101296151
480 Ga0068858_100007728
481 Ga0068858_100165460
482 Ga0068860_100013888
483 Ga0068862_100054406
484 Ga0068862_100069927
485 Ga0068862_100413037
486 Ga0081539_10030046
487 Ga0070717_10131450
488 Ga0070717_10332201
489 Ga0070717_10438733
490 Ga0070717_10646453
491 Ga0070717_10807251
492 Ga0070717_10851850
493 Ga0070712_100235554
494 Ga0070712_100551135
495 Ga0097621_100401774
496 Ga0068871_100456772
497 Ga0075428_100026332
498 Ga0075430_100562391
499 Ga0075431_100012552
500 Ga0075434_100679730
501 Ga0075434_101214965
502 Ga0097620_100170949
503 Ga0099794_10081969
504 Ga0105245_10059775
505 Ga0114129_10635124
506 Ga0105241_10084581
507 Ga0105241_10314544
508 Ga0105241_10981419
509 Ga0105237_10127256
510 Ga0105237_10448829
511 Ga0105239_10870538
512 Ga0105246_10481392
513 Ga0157370_10126047
514 Ga0157372_10648794
515 Ga0157375_10969994
516 Ga0163163_10013062
517 Ga0157379_10011411
518 Ga0157379_10172455
519 Ga0157376_10050181
520 Ga0206354_10114562
521 Ga0206354_11252411
522 Ga0224712_10206269
523 Ga0207692_10022235
524 Ga0207647_10273511
525 Ga0207699_10116924
526 Ga0207684_10004936
527 Ga0207684_10021546
528 Ga0207654_10386830
529 Ga0207654_10592570
530 Ga0207707_10411308
531 Ga0207671_10742620
532 Ga0207693_10257132
533 Ga0207693_10338948
534 Ga0207663_10226928
535 Ga0207663_10332347
536 Ga0207652_10809894
537 Ga0207646_10007233
538 Ga0207646_10087117
539 Ga0207646_10091567
540 Ga0207646_10155137
541 Ga0207646_10274483
542 Ga0207687_10049946
543 Ga0207700_10983448
544 Ga0207664_10004900
545 Ga0207664_10063981
546 Ga0207664_10191336
547 Ga0207669_10086385
548 Ga0207665_10048699
549 Ga0207689_10050515
550 Ga0207661_10183440
551 Ga0207661_10242498
552 Ga0207667_10035492
553 Ga0207667_10109923
554 Ga0207668_10002146
555 Ga0207668_10076257
556 Ga0207703_10155220
557 Ga0207703_10667242
558 Ga0207639_10033387
559 Ga0207678_10068865
560 Ga0207702_10029806
561 Ga0207702_10139684
562 Ga0207641_10289122
563 Ga0207641_10339619
564 Ga0207676_10215343
565 Ga0207674_10159082
566 Ga0207683_10317212
567 Ga0207683_10708406
568 Ga0207698_10055762
569 Ga0207698_10152976
570 Ga0207698_10445307
571 Ga0268266_10147232
572 Ga0268265_10399944
573 Ga0268264_10140334
574 Ga0307515_10000192
575 Ga0307515_10006596
576 Ga0307511_10000710
577 Ga0307512_10052339
578 Ga0265340_10002821
579 Ga0307513_10036349
580 Ga0307509_10010476
581 Ga0307509_10132567
582 Ga0307508_10008065
583 Ga0307514_10464877
584 Ga0307516_10001960
585 Ga0307516_10018627
586 Ga0307410_10382914
587 Ga0307407_10178286
588 Ga0307409_100019191
589 Ga0307409_100090990
590 Ga0307416_100946704
591 Ga0307414_10259751
592 Ga0307415_100004665
593 Ga0307507_10014654
594 Ga0373934_0056653
595 Ga0373934_0088825
596 Ga0373940_0032574
597 Ga0373944_0000933
598 Ga0373944_0056648
599 Ga0373923_0006952
600 Ga0373923_0014585
601 Ga0373932_0032565
602 Ga0373936_0001965
603 Ga0373936_0227125
604 Ga0373939_0071107
605 Ga0373945_0000063
606 Ga0373954_0014967
607 Ga0373956_0186996
608 Ga0373943_0081469
609 Ga0373946_0002355
610 Ga0373946_0073746
611 Ga0373946_0294132
612 Ga0373955_0060772
613 Ga0373955_0125442
614 Ga0373942_0000165
615 Ga0373962_0004350
616 Ga0373924_0020390
617 Ga0373935_0010347
618 Ga0373935_0011868
619 Ga0373935_0269799
620 Ga0373935_0436361
621 Ga0373927_0001934
622 Ga0373927_0454536
623 Ga0373933_0005089
624 Ga0373947_0000952
625 Ga0373947_0394994
626 Ga0373937_0035271
627 Ga0373937_0142431
628 Ga0373937_0159771
629 Ga0372808_006301
630 Ga0373925_0011397
631 Ga0373925_0063320
632 Ga0373925_0091159
633 Ga0373925_0122286
634 Ga0373925_0134189
635 Ga0373925_0213533
636 Ga0373925_0327006
637 Ga0373925_0499538
638 Ga0373925_0593170
639 Ga0436364_1113755
640 Ga0451851_1253244
641 Ga0451853_0390109
642 Ga0466969_0028966
643 Ga0466969_0057438
644 Ga0466969_0058537
645 Ga0466969_0278703
646 Ga0466972_0016371
647 Ga0466972_0176440
648 Ga0466966_0001650
649 Ga0466966_0026200
650 Ga0466966_0031267
651 Ga0466966_0187505
652 Ga0466966_0237401
653 Ga0466961_0004033
654 Ga0466961_0004276
655 Ga0466961_0022184
656 Ga0466961_0041146
657 Ga0466961_0081521
658 Ga0466961_0136107
659 Ga0466961_0209259
660 Ga0466961_0385203
661 Ga0466963_0014374
662 Ga0466963_0026988
663 Ga0466963_0131025
664 Ga0466963_0141253
665 Ga0466963_0559551
666 Ga0466964_0029158
667 Ga0466964_0068735
668 Ga0466964_0117299
669 Ga0466971_0051465
670 Ga0466971_0184604
671 Ga0466971_0261762
672 Ga0466970_0005415
673 Ga0466970_0026454
674 Ga0466970_0067756
675 Ga0466970_0152957
676 Ga0466970_0282915
677 Ga0466970_0439789
678 Ga0466957_0034901
679 Ga0466957_0087130
680 Ga0466957_0137273
681 Ga0466957_0232437
682 Ga0466960_0011462
683 Ga0466960_0110079
684 Ga0466959_0010676
685 Ga0466959_0011146
686 Ga0466959_0014151
687 Ga0466959_0020506
688 Ga0466959_0045663
689 Ga0466959_0434669
690 Ga0466958_0015531
691 Ga0466958_0021062
692 Ga0466958_0032904
693 Ga0466958_0038351
694 Ga0466967_0005273
695 Ga0466967_0028282
696 Ga0466967_0041708
697 Ga0466967_0051496
698 Ga0466967_0063773
699 Ga0466967_0066441
700 Ga0466967_0644924
701 Ga0466967_0676595
702 Ga0495592_0000831
703 Ga0495592_0012576
704 Ga0495629_0026174
705 Ga0495641_0040633
706 Ga0495641_0111772
707 Ga0495651_0013378
708 Ga0495651_0023908
709 Ga0495653_0007038
710 Ga0495653_0007844
711 Ga0495653_0074865
712 Ga0495653_0197737
713 Ga0495653_0528906
714 Ga0495653_0534540
715 Ga0495580_0307516
716 Ga0495639_0035868
717 Ga0495662_0018315
718 Ga0495664_0000220
719 Ga0495664_0011588
720 Ga0495664_0237742
721 Ga0495664_0332184
722 Ga0495608_0006046
723 Ga0495608_0039732
724 Ga0495608_0247361
725 Ga0495608_0590993
726 Ga0495618_0029618
727 Ga0495618_0048267
728 Ga0495618_0322492
729 Ga0495628_0017031
730 Ga0495628_0088443
731 Ga0495628_0088529
732 Ga0495628_0542930
733 Ga0495630_0013951
734 Ga0495630_0037988
735 Ga0495632_0402031
736 Ga0495652_0016513
737 Ga0495652_0060987
738 Ga0495652_0119261
739 Ga0495652_0196360
740 Ga0495665_0017714
741 Ga0495665_0274775
742 Ga0495586_0299090
743 Ga0495587_0000447
744 Ga0495587_0010978
745 Ga0495645_0016849
746 Ga0495645_0255790
747 Ga0495645_0381911
748 Ga0495645_0482594
749 Ga0495667_0016695
750 Ga0495667_0025994
751 Ga0495667_0112476
752 Ga0495667_0214838
753 Ga0495634_0024606
754 Ga0495634_0068544
755 Ga0495635_0002796
756 Ga0495635_0050976
757 Ga0495635_0104837
758 Ga0495657_0017210
759 Ga0495657_0020546
760 Ga0495657_0027808
761 Ga0495599_0003339
762 Ga0495599_0077020
763 Ga0495599_0172601
764 Ga0495599_0269869
765 Ga0495623_0045361
766 Ga0495623_0367397
767 Ga0495646_0006144
768 Ga0495646_0057066
769 Ga0495646_0090674
770 Ga0495646_0160834
771 Ga0495646_0206478
772 Ga0495624_0015798
773 Ga0495600_0003949
774 Ga0495600_0321840
775 Ga0495581_0034086
776 Ga0495604_0025669
777 Ga0495604_0141485
778 Ga0495674_0003143
779 Ga0495674_0027159
780 Ga0495674_0036929
781 Ga0495676_0017043
782 Ga0495680_0016778
783 Ga0495680_0063623
784 Ga0495680_0093809
785 Ga0495684_0010271
786 Ga0495684_0029680
787 Ga0495684_0079329
788 Ga0495684_0346809
789 Ga0495593_0269227
790 Ga0495602_0025288
791 Ga0495602_0096004
792 Ga0495602_0534172
793 Ga0495602_0633759
794 Ga0496102_0000721
795 Ga0496103_0018149
796 Ga0496104_0029437
797 Ga0496105_0082271
798 Ga0496108_0000041
799 Ga0496108_0053815
800 Ga0496112_0120885
801 Ga0501031_0005462
802 Ga0501031_0061234
803 Ga0501032_0003445
804 Ga0501033_0029835
805 Ga0501033_0072692
806 Ga0501033_0153390
807 Ga0501034_0006559
808 Ga0501036_0194115
809 Ga0501038_0000163
810 Ga0501038_0169722
811 Ga0501043_0027114
812 Ga0501047_0005021
813 Ga0501047_0444660
814 Ga0501048_0000286
815 Ga0501070_0007934
816 Ga0501073_0244055
817 Ga0501035_0070848
818 Ga0501035_0197282
819 Ga0501044_0025587
820 Ga0501044_0037255
821 nmdc:mga05p37_712127_c1
822 nmdc:mga0qj67_191096_c1
823 nmdc:mga06r32_1287_c1
824 nmdc:mga0n895_702050_c1
825 Ga0495601_0012087
826 Ga0495612_0053101
827 Ga0495612_0084474
828 Ga0495595_0047705
829 Ga0495619_0432927
830 Ga0500644_0070644
831 Ga0500583_0065727
832 Ga0500641_0143153
833 Ga0500600_0068113
834 Ga0500616_0000060
835 Ga0466962_0006925
836 2515494410
837 2515719682
838 2515756639
839 2516084999
840 2516088970
841 2559431304
842 2583149664
843 2753265783
844 2866557210
845 2866618467
846 2899372303

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

43

188

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l82-assembly1.cif.gz_B structure of a putative oxidoreductase from rickettsia felis 0.9589 18 158
2ed4-assembly1.cif.gz_B crystal structure of flavin reductase hpac complexed with fad and nad 0.9361 18 161
4f07-assembly1.cif.gz_A structure of the styrene monooxygenase flavin reductase (smob) from pseudomonas putida s12 0.9133 18 161
4f07-assembly1.cif.gz_D structure of the styrene monooxygenase flavin reductase (smob) from pseudomonas putida s12 0.9125 18 161
4f07-assembly4.cif.gz_G structure of the styrene monooxygenase flavin reductase (smob) from pseudomonas putida s12 0.9102 18 161
ID Description Score Start End Superfamily
4l82C00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9596 18 158 2.30.110.10
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9314 19 147 2.30.110.10
2ed4A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9279 18 161 2.30.110.10
3zoeB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9059 19 162 2.30.110.10
2d38A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8985 18 157 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A2A5BE49-F1-model_v4 FMN reductase 0.9681 18 158 GO:0010181
GO:0042602
AF-A0A6G9CPG2-F1-model_v4 Flavin-dependent monooxygenase, reductase subunit HsaB 0.9681 50 159 GO:0004497
GO:0010181
GO:0042602
AF-A0A1X2B8X2-F1-model_v4 deleted 0.9658 18 159
AF-A0A1E5Q0F5-F1-model_v4 Flavin reductase like domain-containing protein 0.9657 18 158 GO:0006208
GO:0010181
GO:0042602
AF-A0A388RVN4-F1-model_v4 deleted 0.9647 42 161

Map