F440329

General Info

Members Datasets Scaffolds Average Seq Length
422 236 844 120

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0446296|Ga0395901_0446296_57_473
Length 138
Sequence MSPRFVPATVHELARVGLLSELPGQTLTKLATRMRRDEVGAGAGVILEGEEGDRFYVILNGLFAVSNQGALGPRRVLRPGDYFGEVALAMDVPRTASVTALTPSTVASCDRATFEELVRPLFADDLEPSRRSSGPPEP

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
49 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
108 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
109 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
143 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
144 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
232 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
233 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.9
Nodule 0
Rhizoplane 9
Rhizosphere 88.63
Stem 0
Stem Tuber 0
Unclassified 20.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0446296 3300038443 Unclassified 1324
2 JGI25407J50210_10001322 3300003373 Bacteria 5569
3 JGI25405J52794_10056377 3300003911 Bacteria 846
4 Ga0070658_10037301 3300005327 Bacteria 3917
5 Ga0070683_100410505 3300005329 Bacteria 1291
6 Ga0070683_100908238 3300005329 Bacteria 845
7 Ga0070683_100912110 3300005329 Bacteria 843
8 Ga0068869_100336110 3300005334 Unclassified 1228
9 Ga0070680_100470968 3300005336 Bacteria 1073
10 Ga0070682_100031310 3300005337 Bacteria 3216
11 Ga0070682_100117100 3300005337 Unclassified 1783
12 Ga0068868_100354095 3300005338 Bacteria 1258
13 Ga0070660_100028642 3300005339 Bacteria 4169
14 Ga0070660_100223811 3300005339 Bacteria 1530
15 Ga0070661_100029392 3300005344 Bacteria 3966
16 Ga0070661_100075684 3300005344 Unclassified 2481
17 Ga0070692_10304249 3300005345 Bacteria 974
18 Ga0070692_10716248 3300005345 Bacteria 675
19 Ga0070668_100490583 3300005347 Unclassified 1062
20 Ga0070675_100185361 3300005354 Unclassified 1801
21 Ga0070675_100641167 3300005354 Unclassified 965
22 Ga0070675_100688411 3300005354 Bacteria 931
23 Ga0070673_100392021 3300005364 Unclassified 1240
24 Ga0070659_100063059 3300005366 Bacteria 2932
25 Ga0070659_100099472 3300005366 Bacteria 2340
26 Ga0070659_100379386 3300005366 Bacteria 1190
27 Ga0070659_100415561 3300005366 Bacteria 1137
28 Ga0070659_101130557 3300005366 Bacteria 691
29 Ga0070714_100022366 3300005435 Bacteria 5184
30 Ga0070713_101806889 3300005436 Unclassified 593
31 Ga0070705_101067846 3300005440 Unclassified 659
32 Ga0070700_100022325 3300005441 Bacteria 3688
33 Ga0070694_100241059 3300005444 Unclassified 1364
34 Ga0070663_101184503 3300005455 Unclassified 671
35 Ga0070678_100841287 3300005456 Unclassified 836
36 Ga0070681_10051502 3300005458 Bacteria 4107
37 Ga0070681_10349554 3300005458 Bacteria 1389
38 Ga0070681_10761637 3300005458 Bacteria 885
39 Ga0070706_101858308 3300005467 Bacteria 547
40 Ga0070707_101058523 3300005468 Bacteria 777
41 Ga0070698_101657218 3300005471 Bacteria 592
42 Ga0070699_100782659 3300005518 Bacteria 873
43 Ga0070679_100090150 3300005530 Bacteria 3054
44 Ga0070679_100138183 3300005530 Bacteria 2417
45 Ga0070679_100213136 3300005530 Bacteria 1894
46 Ga0070679_101539327 3300005530 Unclassified 612
47 Ga0070684_100062090 3300005535 Bacteria 3272
48 Ga0070684_100074156 3300005535 Bacteria 2999
49 Ga0070684_100261826 3300005535 Bacteria 1582
50 Ga0070684_101206325 3300005535 Bacteria 712
51 Ga0070697_100795440 3300005536 Unclassified 837
52 Ga0070697_100907343 3300005536 Bacteria 782
53 Ga0070696_100333136 3300005546 Bacteria 1171
54 Ga0070693_101125808 3300005547 Unclassified 600
55 Ga0068855_100030686 3300005563 Bacteria 6426
56 Ga0068855_100070976 3300005563 Bacteria 4051
57 Ga0068857_100536844 3300005577 Unclassified 1101
58 Ga0068857_101068471 3300005577 Bacteria 779
59 Ga0068854_100337322 3300005578 Bacteria 1230
60 Ga0068856_100117662 3300005614 Bacteria 2658
61 Ga0068856_102119963 3300005614 Unclassified 572
62 Ga0070702_100903753 3300005615 Bacteria 691
63 Ga0068864_101094393 3300005618 Bacteria 793
64 Ga0068861_100350024 3300005719 Bacteria 1296
65 Ga0068863_101847426 3300005841 Bacteria 614
66 Ga0081455_10010770 3300005937 Bacteria 9240
67 Ga0081455_10043683 3300005937 Bacteria 3917
68 Ga0081455_10067448 3300005937 Bacteria 2981
69 Ga0081455_10075685 3300005937 Bacteria 2776
70 Ga0081455_10327802 3300005937 Bacteria 1088
71 Ga0081455_10385962 3300005937 Unclassified 977
72 Ga0081538_10000194 3300005981 Bacteria 67012
73 Ga0081538_10000535 3300005981 Bacteria 41946
74 Ga0081538_10003830 3300005981 Bacteria 14050
75 Ga0081538_10351068 3300005981 Bacteria 534
76 Ga0081539_10001284 3300005985 Bacteria 44182
77 Ga0070717_10439757 3300006028 Bacteria 1174
78 Ga0075365_10513429 3300006038 Unclassified 847
79 Ga0075365_10644935 3300006038 Unclassified 748
80 Ga0075364_10089496 3300006051 Bacteria 2041
81 Ga0075432_10009974 3300006058 Bacteria 3226
82 Ga0075432_10044826 3300006058 Bacteria 1551
83 Ga0075367_10189347 3300006178 Bacteria 1284
84 Ga0075428_100078642 3300006844 Bacteria 3600
85 Ga0075433_10523147 3300006852 Bacteria 1043
86 Ga0075434_101376249 3300006871 Bacteria 716
87 Ga0075429_100107996 3300006880 Bacteria 2432
88 Ga0075429_100686790 3300006880 Unclassified 897
89 Ga0075436_100851342 3300006914 Bacteria 681
90 Ga0075435_101497446 3300007076 Unclassified 592
91 Ga0105240_10249197 3300009093 Bacteria 2055
92 Ga0111539_10232056 3300009094 Bacteria 2149
93 Ga0111539_10958885 3300009094 Bacteria 995
94 Ga0105245_10045491 3300009098 Bacteria 3920
95 Ga0105245_10496264 3300009098 Bacteria 1236
96 Ga0105245_10767587 3300009098 Unclassified 1001
97 Ga0114129_10622091 3300009147 Bacteria 1396
98 Ga0114129_10799985 3300009147 Bacteria 1203
99 Ga0114129_12037178 3300009147 Bacteria 693
100 Ga0114129_12893864 3300009147 Bacteria 568
101 Ga0105243_11248320 3300009148 Unclassified 758
102 Ga0105243_12295857 3300009148 Bacteria 577
103 Ga0105242_10358208 3300009176 Bacteria 1349
104 Ga0105242_10709256 3300009176 Unclassified 985
105 Ga0105248_12419366 3300009177 Bacteria 598
106 Ga0105238_10187888 3300009551 Bacteria 2042
107 Ga0105249_10513348 3300009553 Bacteria 1245
108 Ga0105239_10147453 3300010375 Bacteria 2625
109 Ga0105239_10537259 3300010375 Bacteria 1331
110 Ga0157337_1009679 3300012483 Unclassified 731
111 Ga0157373_10510635 3300013100 Bacteria 869
112 Ga0157371_10164807 3300013102 Bacteria 1583
113 Ga0157369_10003021 3300013105 Bacteria 20101
114 Ga0157369_10242897 3300013105 Bacteria 1881
115 Ga0157369_10428248 3300013105 Bacteria 1371
116 Ga0157375_11976213 3300013308 Bacteria 693
117 Ga0157377_10060066 3300014745 Bacteria 2169
118 Ga0157377_11282079 3300014745 Bacteria 572
119 Ga0206354_11493990 3300020081 Bacteria 1216
120 Ga0206353_11007153 3300020082 Unclassified 676
121 Ga0224712_10037070 3300022467 Bacteria 1812
122 Ga0207688_10053569 3300025901 Bacteria 2262
123 Ga0207699_10115311 3300025906 Bacteria 1728
124 Ga0207699_11241565 3300025906 Bacteria 552
125 Ga0207645_10100712 3300025907 Bacteria 1863
126 Ga0207643_10451076 3300025908 Unclassified 818
127 Ga0207705_10014803 3300025909 Bacteria 5608
128 Ga0207707_10054949 3300025912 Bacteria 3465
129 Ga0207707_10474907 3300025912 Bacteria 1068
130 Ga0207695_10390603 3300025913 Bacteria 1276
131 Ga0207693_10127651 3300025915 Bacteria 1999
132 Ga0207660_10428191 3300025917 Bacteria 1068
133 Ga0207657_10001226 3300025919 Bacteria 27377
134 Ga0207657_10002370 3300025919 Bacteria 20383
135 Ga0207649_10034257 3300025920 Bacteria 3041
136 Ga0207649_10387614 3300025920 Bacteria 1043
137 Ga0207652_10124692 3300025921 Bacteria 2294
138 Ga0207652_10562147 3300025921 Bacteria 1024
139 Ga0207646_10181184 3300025922 Bacteria 1903
140 Ga0207650_10544988 3300025925 Bacteria 972
141 Ga0207687_11540269 3300025927 Unclassified 571
142 Ga0207700_10577688 3300025928 Bacteria 999
143 Ga0207700_11301318 3300025928 Unclassified 648
144 Ga0207664_10004379 3300025929 Bacteria 9569
145 Ga0207664_10057211 3300025929 Bacteria 3099
146 Ga0207690_10035173 3300025932 Unclassified 3233
147 Ga0207690_10094039 3300025932 Bacteria 2125
148 Ga0207690_10386944 3300025932 Bacteria 1113
149 Ga0207706_10921013 3300025933 Bacteria 737
150 Ga0207686_10998542 3300025934 Bacteria 679
151 Ga0207661_10241611 3300025944 Bacteria 1603
152 Ga0207661_10537540 3300025944 Bacteria 1070
153 Ga0207661_10790832 3300025944 Bacteria 873
154 Ga0207679_10239917 3300025945 Bacteria 1535
155 Ga0207679_11241615 3300025945 Bacteria 684
156 Ga0207667_10286737 3300025949 Bacteria 1682
157 Ga0207667_10773449 3300025949 Unclassified 958
158 Ga0207712_10311845 3300025961 Bacteria 1295
159 Ga0207712_11986294 3300025961 Bacteria 521
160 Ga0207677_10191422 3300026023 Bacteria 1618
161 Ga0207703_11414099 3300026035 Unclassified 669
162 Ga0207639_11173771 3300026041 Bacteria 720
163 Ga0207708_10041555 3300026075 Bacteria 3505
164 Ga0207708_10896643 3300026075 Bacteria 767
165 Ga0207674_10510164 3300026116 Bacteria 1162
166 Ga0207698_10433938 3300026142 Bacteria 1264
167 Ga0207428_10001591 3300027907 Bacteria 23651
168 Ga0207428_10035197 3300027907 Bacteria 4095
169 Ga0265337_1129007 3300028556 Unclassified 686
170 Ga0265326_10201858 3300028558 Unclassified 571
171 Ga0265319_1203510 3300028563 Bacteria 607
172 Ga0265334_10069863 3300028573 Bacteria 1310
173 Ga0265318_10007208 3300028577 Bacteria 5049
174 Ga0265322_10166548 3300028654 Unclassified 630
175 Ga0265336_10007733 3300028666 Bacteria 3811
176 Ga0265336_10071676 3300028666 Bacteria 1036
177 Ga0265338_10013644 3300028800 Bacteria 9148
178 Ga0265338_10027092 3300028800 Bacteria 5759
179 Ga0265338_10033211 3300028800 Bacteria 5012
180 Ga0265330_10396637 3300031235 Unclassified 584
181 Ga0265332_10013364 3300031238 Bacteria 3639
182 Ga0265320_10365301 3300031240 Unclassified 637
183 Ga0265325_10083013 3300031241 Bacteria 1590
184 Ga0265325_10121671 3300031241 Bacteria 1257
185 Ga0265340_10056022 3300031247 Bacteria 1897
186 Ga0265339_10001458 3300031249 Bacteria 17517
187 Ga0265327_10168493 3300031251 Bacteria 1007
188 Ga0265327_10178776 3300031251 Bacteria 971
189 Ga0265316_10026478 3300031344 Bacteria 4822
190 Ga0265316_10247936 3300031344 Bacteria 1308
191 Ga0265314_10018137 3300031711 Bacteria 5497
192 Ga0265314_10061971 3300031711 Bacteria 2545
193 Ga0265342_10037614 3300031712 Bacteria 2950
194 Ga0265342_10079698 3300031712 Bacteria 1893
195 Ga0265342_10459505 3300031712 Unclassified 653
196 Ga0307409_101242450 3300031995 Bacteria 769
197 Ga0307416_103310543 3300032002 Bacteria 539
198 Ga0373939_0484539 3300035114 Unclassified 526
199 Ga0373941_0041468 3300035115 Bacteria 1425
200 Ga0373954_0179334 3300035118 Bacteria 1038
201 Ga0373956_0341302 3300035119 Bacteria 714
202 Ga0373955_0130613 3300035172 Bacteria 1466
203 Ga0373935_1236552 3300035692 Bacteria 557
204 Ga0373933_0049262 3300035724 Bacteria 2511
205 Ga0373937_0462134 3300036401 Bacteria 1205
206 Ga0373937_1621858 3300036401 Unclassified 594
207 Ga0395899_0026786 3300037312 Bacteria 4349
208 Ga0395899_0163833 3300037312 Bacteria 1569
209 Ga0395899_0224823 3300037312 Bacteria 1299
210 Ga0395899_0546112 3300037312 Bacteria 745
211 Ga0395900_0064784 3300037418 Bacteria 3754
212 Ga0395900_0077358 3300037418 Bacteria 3418
213 Ga0395900_0085678 3300037418 Bacteria 3238
214 Ga0395900_0250303 3300037418 Bacteria 1773
215 Ga0395900_0258427 3300037418 Unclassified 1740
216 Ga0395900_0408482 3300037418 Unclassified 1321
217 Ga0395900_0417466 3300037418 Unclassified 1303
218 Ga0395900_1003233 3300037418 Bacteria 755
219 Ga0395898_0036772 3300037466 Bacteria 4860
220 Ga0395898_0067504 3300037466 Bacteria 3462
221 Ga0395898_0158397 3300037466 Bacteria 2165
222 Ga0395898_0167150 3300037466 Bacteria 2103
223 Ga0395898_0269603 3300037466 Bacteria 1623
224 Ga0395898_1022766 3300037466 Bacteria 761
225 Ga0395898_1339190 3300037466 Bacteria 645
226 Ga0395905_0038289 3300037471 Bacteria 4499
227 Ga0395905_0090548 3300037471 Bacteria 2868
228 Ga0395905_0093395 3300037471 Bacteria 2822
229 Ga0395905_0096327 3300037471 Bacteria 2778
230 Ga0395905_0674973 3300037471 Bacteria 935
231 Ga0395905_1210371 3300037471 Bacteria 659
232 Ga0395901_0003855 3300038443 Bacteria 15100
233 Ga0395901_0016177 3300038443 Bacteria 7598
234 Ga0395901_0041759 3300038443 Bacteria 4754
235 Ga0395901_0160751 3300038443 Unclassified 2359
236 Ga0395901_0191673 3300038443 Bacteria 2143
237 Ga0395901_0327302 3300038443 Bacteria 1585
238 Ga0395901_0560384 3300038443 Bacteria 1157
239 Ga0395901_0758018 3300038443 Bacteria 963
240 Ga0395901_0866207 3300038443 Bacteria 887
241 Ga0395901_1388375 3300038443 Bacteria 661
242 Ga0439438_051607 3300041405 Unclassified 1044
243 Ga0439438_129055 3300041405 Unclassified 607
244 Ga0439439_0095443 3300041406 Bacteria 816
245 Ga0439461_0004213 3300041410 Bacteria 2392
246 Ga0439461_0006581 3300041410 Bacteria 2030
247 Ga0439465_0083346 3300041413 Unclassified 1087
248 Ga0451789_0237799 3300041443 Bacteria 733
249 Ga0451839_0028074 3300041496 Bacteria 562
250 Ga0451839_0235133 3300041496 Unclassified 845
251 Ga0450920_008700 3300042122 Bacteria 1860
252 Ga0439446_0233761 3300042156 Unclassified 629
253 Ga0439458_0144369 3300042157 Unclassified 635
254 Ga0439458_0178714 3300042157 Bacteria 576
255 Ga0439434_0161193 3300042435 Unclassified 745
256 Ga0466963_1073144 3300044694 Bacteria 567
257 Ga0451576_0256674 3300045051 Unclassified 1827
258 Ga0451576_1740200 3300045051 Unclassified 645
259 Ga0466967_0122272 3300045976 Unclassified 2407
260 Ga0466967_0161932 3300045976 Bacteria 2101
261 Ga0495592_0031699 3300046454 Bacteria 3993
262 Ga0495592_0225989 3300046454 Bacteria 1249
263 Ga0495651_0156119 3300046462 Bacteria 1640
264 Ga0495651_0179206 3300046462 Bacteria 1501
265 Ga0495653_0139115 3300046463 Bacteria 1710
266 Ga0495653_0192709 3300046463 Bacteria 1389
267 Ga0495585_0429413 3300046492 Unclassified 634
268 Ga0495608_0324501 3300046511 Unclassified 951
269 Ga0495618_0037470 3300046514 Bacteria 3045
270 Ga0495618_0140540 3300046514 Bacteria 1545
271 Ga0495628_0055104 3300046516 Bacteria 3132
272 Ga0495628_0322378 3300046516 Bacteria 1140
273 Ga0495628_0500295 3300046516 Bacteria 878
274 Ga0495628_0614311 3300046516 Bacteria 775
275 Ga0495630_0502081 3300046517 Bacteria 930
276 Ga0495652_0161916 3300046529 Bacteria 1736
277 Ga0495652_0298535 3300046529 Bacteria 1172
278 Ga0495652_0366592 3300046529 Bacteria 1028
279 Ga0495587_0136918 3300046536 Bacteria 1399
280 Ga0495645_0151982 3300046543 Bacteria 1607
281 Ga0495645_0712615 3300046543 Bacteria 608
282 Ga0495667_0011349 3300046559 Bacteria 6033
283 Ga0495667_0202588 3300046559 Bacteria 1270
284 Ga0495634_0015789 3300046642 Bacteria 5415
285 Ga0495635_0018280 3300046663 Bacteria 4893
286 Ga0495635_0322304 3300046663 Bacteria 1034
287 Ga0495659_0272717 3300046664 Unclassified 709
288 Ga0495659_0399517 3300046664 Unclassified 593
289 Ga0495657_0009299 3300046675 Bacteria 7458
290 Ga0495657_0160196 3300046675 Bacteria 1393
291 Ga0495646_0419490 3300046680 Bacteria 694
292 Ga0495600_0129097 3300046809 Bacteria 1643
293 Ga0495600_0410627 3300046809 Bacteria 841
294 Ga0495600_0720467 3300046809 Bacteria 599
295 Ga0495600_0762270 3300046809 Bacteria 579
296 Ga0495604_0139813 3300047317 Bacteria 1731
297 Ga0495636_0692311 3300047318 Unclassified 503
298 Ga0495674_0261118 3300047319 Bacteria 1423
299 Ga0495680_0018472 3300047322 Bacteria 5918
300 Ga0495680_0507931 3300047322 Bacteria 817
301 Ga0495680_0894648 3300047322 Unclassified 574
302 Ga0495675_0325385 3300047444 Bacteria 909
303 Ga0495684_0017843 3300047471 Bacteria 5467
304 Ga0495684_0172274 3300047471 Bacteria 1609
305 Ga0495602_0824054 3300048088 Archaea 622
306 Ga0496100_1077142 3300048903 Unclassified 633
307 Ga0496101_0771096 3300048904 Bacteria 759
308 Ga0496101_1044808 3300048904 Unclassified 642
309 Ga0496102_1966307 3300048905 Unclassified 501
310 Ga0496105_0071906 3300048908 Bacteria 2859
311 Ga0496106_0572810 3300048909 Unclassified 905
312 Ga0496106_1403626 3300048909 Bacteria 540
313 Ga0496107_0753846 3300048910 Bacteria 714
314 Ga0496108_0007732 3300048911 Bacteria 8705
315 Ga0496108_0170542 3300048911 Bacteria 1883
316 Ga0496108_1493982 3300048911 Unclassified 562
317 Ga0496109_0013710 3300048912 Bacteria 7041
318 Ga0496109_0231767 3300048912 Bacteria 1737
319 Ga0496109_0360857 3300048912 Bacteria 1373
320 Ga0496109_1211090 3300048912 Unclassified 692
321 Ga0496109_1215335 3300048912 Unclassified 690
322 Ga0496109_1315620 3300048912 Bacteria 659
323 Ga0496110_0095101 3300048913 Bacteria 2668
324 Ga0496110_0101333 3300048913 Bacteria 2581
325 Ga0496110_0237669 3300048913 Bacteria 1658
326 Ga0496111_0016904 3300048914 Bacteria 5036
327 Ga0496111_0164058 3300048914 Bacteria 1650
328 Ga0496111_0597668 3300048914 Bacteria 808
329 Ga0496111_0757792 3300048914 Unclassified 704
330 Ga0496112_0012682 3300048915 Bacteria 7751
331 Ga0496112_0064574 3300048915 Bacteria 3612
332 Ga0496112_0136189 3300048915 Bacteria 2426
333 Ga0496112_0221345 3300048915 Bacteria 1849
334 Ga0496112_0361176 3300048915 Bacteria 1394
335 Ga0496112_0762954 3300048915 Bacteria 893
336 Ga0496112_0819614 3300048915 Bacteria 855
337 Ga0496113_0151176 3300048916 Bacteria 1832
338 Ga0496113_1506278 3300048916 Unclassified 519
339 Ga0496113_1589306 3300048916 Unclassified 503
340 Ga0496114_0861094 3300048917 Bacteria 787
341 Ga0496114_0950658 3300048917 Bacteria 742
342 Ga0496115_0440919 3300048918 Unclassified 1053
343 Ga0501031_0576951 3300049568 Bacteria 724
344 Ga0501032_0507974 3300049569 Unclassified 770
345 Ga0501033_0414978 3300049570 Bacteria 938
346 Ga0501036_0304349 3300049572 Bacteria 1333
347 Ga0501037_0181456 3300049573 Bacteria 1493
348 Ga0501038_0462412 3300049574 Unclassified 974
349 Ga0501039_0311008 3300049575 Bacteria 1238
350 Ga0501040_0043267 3300049576 Bacteria 3069
351 Ga0501041_0435248 3300049577 Unclassified 832
352 Ga0501042_0008111 3300049578 Bacteria 6915
353 Ga0501042_0144047 3300049578 Unclassified 1718
354 Ga0501043_0613433 3300049579 Unclassified 802
355 Ga0501046_0051729 3300049580 Bacteria 3240
356 Ga0501047_0536689 3300049581 Archaea 995
357 Ga0501048_0150469 3300049582 Bacteria 1646
358 Ga0501067_0006195 3300049583 Bacteria 6632
359 Ga0501067_0019896 3300049583 Bacteria 3715
360 Ga0501068_0017406 3300049584 Bacteria 4156
361 Ga0501068_0020538 3300049584 Bacteria 3849
362 Ga0501068_0059866 3300049584 Bacteria 2312
363 Ga0501069_0107457 3300049585 Bacteria 1587
364 Ga0501069_0272159 3300049585 Bacteria 990
365 Ga0501070_0711945 3300049586 Bacteria 793
366 Ga0501071_0028926 3300049587 Bacteria 3907
367 Ga0501071_0354717 3300049587 Bacteria 1116
368 Ga0501072_0004666 3300049588 Bacteria 10432
369 Ga0501072_0064706 3300049588 Bacteria 2883
370 Ga0501072_0257204 3300049588 Bacteria 1390
371 Ga0501074_0150316 3300049590 Bacteria 1665
372 Ga0501074_0810672 3300049590 Bacteria 659
373 Ga0501075_0013650 3300049591 Bacteria 5802
374 Ga0501075_0050132 3300049591 Bacteria 3138
375 Ga0501075_0426828 3300049591 Bacteria 1011
376 Ga0501076_0010882 3300049592 Bacteria 6767
377 Ga0501076_0166752 3300049592 Bacteria 1795
378 Ga0501077_0004973 3300049593 Bacteria 8062
379 Ga0501079_0007249 3300049741 Bacteria 8371
380 Ga0501079_0424493 3300049741 Bacteria 1044
381 Ga0501080_0082965 3300049742 Bacteria 2978
382 Ga0501080_0305846 3300049742 Bacteria 1441
383 Ga0501080_0714773 3300049742 Unclassified 883
384 Ga0501081_0079451 3300049743 Bacteria 2294
385 Ga0501081_1524639 3300049743 Unclassified 508
386 Ga0501083_0038664 3300049744 Bacteria 3243
387 Ga0501083_0668878 3300049744 Bacteria 675
388 Ga0501035_0088261 3300049822 Bacteria 2733
389 Ga0501045_0535066 3300049824 Unclassified 869
390 Ga0501045_0591138 3300049824 Bacteria 822
391 nmdc:mga00v17_138019_c1 3300050491 Bacteria 1562
392 nmdc:mga0yw44_430139_c1 3300050492 Unclassified 894
393 nmdc:mga0yw44_6478_c1 3300050492 Bacteria 5665
394 nmdc:mga06z11_32733_c1 3300050494 Bacteria 2537
395 nmdc:mga05p37_214173_c1 3300050507 Bacteria 2327
396 nmdc:mga05p37_533309_c1 3300050507 Bacteria 1340
397 nmdc:mga05p37_647335_c1 3300050507 Bacteria 1184
398 nmdc:mga06r32_254944_c1 3300050510 Bacteria 1742
399 nmdc:mga08y16_616019_c1 3300050511 Bacteria 1093
400 nmdc:mga0n895_328234_c1 3300050512 Bacteria 1550
401 nmdc:mga0rr50_1141845_c1 3300050513 Unclassified 662
402 nmdc:mga08x19_1133141_c1 3300050514 Bacteria 555
403 nmdc:mga08x19_597426_c1 3300050514 Bacteria 782
404 nmdc:mga0a205_77484_c1 3300050515 Bacteria 1044
405 Ga0495601_0231648 3300053077 Bacteria 1206
406 Ga0495601_0514234 3300053077 Bacteria 772
407 Ga0495612_0109130 3300053078 Bacteria 1183
408 Ga0495612_0151266 3300053078 Bacteria 1010
409 Ga0495595_0025587 3300053084 Bacteria 2617
410 Ga0495595_0267900 3300053084 Bacteria 856
411 Ga0495595_0717988 3300053084 Unclassified 512
412 Ga0495619_0099344 3300053085 Bacteria 1979
413 Ga0495619_0300186 3300053085 Bacteria 1112
414 Ga0495619_0570096 3300053085 Bacteria 776
415 Ga0501084_0262130 3300054114 Unclassified 1459
416 Ga0501084_0282996 3300054114 Bacteria 1400
417 Ga0501082_0235271 3300060353 Bacteria 1594
418 Ga0530510_0016054 3300061734 Bacteria 5293
419 Ga0530510_0048323 3300061734 Bacteria 3075
420 Ga0530510_0158998 3300061734 Unclassified 1671
421 Ga0530510_0204255 3300061734 Unclassified 1468
422 Ga0530510_0591030 3300061734 Bacteria 844
423 Ga0395901_0446296
424 JGI25407J50210_10001322
425 JGI25405J52794_10056377
426 Ga0070658_10037301
427 Ga0070683_100410505
428 Ga0070683_100908238
429 Ga0070683_100912110
430 Ga0068869_100336110
431 Ga0070680_100470968
432 Ga0070682_100031310
433 Ga0070682_100117100
434 Ga0068868_100354095
435 Ga0070660_100028642
436 Ga0070660_100223811
437 Ga0070661_100029392
438 Ga0070661_100075684
439 Ga0070692_10304249
440 Ga0070692_10716248
441 Ga0070668_100490583
442 Ga0070675_100185361
443 Ga0070675_100641167
444 Ga0070675_100688411
445 Ga0070673_100392021
446 Ga0070659_100063059
447 Ga0070659_100099472
448 Ga0070659_100379386
449 Ga0070659_100415561
450 Ga0070659_101130557
451 Ga0070714_100022366
452 Ga0070713_101806889
453 Ga0070705_101067846
454 Ga0070700_100022325
455 Ga0070694_100241059
456 Ga0070663_101184503
457 Ga0070678_100841287
458 Ga0070681_10051502
459 Ga0070681_10349554
460 Ga0070681_10761637
461 Ga0070706_101858308
462 Ga0070707_101058523
463 Ga0070698_101657218
464 Ga0070699_100782659
465 Ga0070679_100090150
466 Ga0070679_100138183
467 Ga0070679_100213136
468 Ga0070679_101539327
469 Ga0070684_100062090
470 Ga0070684_100074156
471 Ga0070684_100261826
472 Ga0070684_101206325
473 Ga0070697_100795440
474 Ga0070697_100907343
475 Ga0070696_100333136
476 Ga0070693_101125808
477 Ga0068855_100030686
478 Ga0068855_100070976
479 Ga0068857_100536844
480 Ga0068857_101068471
481 Ga0068854_100337322
482 Ga0068856_100117662
483 Ga0068856_102119963
484 Ga0070702_100903753
485 Ga0068864_101094393
486 Ga0068861_100350024
487 Ga0068863_101847426
488 Ga0081455_10010770
489 Ga0081455_10043683
490 Ga0081455_10067448
491 Ga0081455_10075685
492 Ga0081455_10327802
493 Ga0081455_10385962
494 Ga0081538_10000194
495 Ga0081538_10000535
496 Ga0081538_10003830
497 Ga0081538_10351068
498 Ga0081539_10001284
499 Ga0070717_10439757
500 Ga0075365_10513429
501 Ga0075365_10644935
502 Ga0075364_10089496
503 Ga0075432_10009974
504 Ga0075432_10044826
505 Ga0075367_10189347
506 Ga0075428_100078642
507 Ga0075433_10523147
508 Ga0075434_101376249
509 Ga0075429_100107996
510 Ga0075429_100686790
511 Ga0075436_100851342
512 Ga0075435_101497446
513 Ga0105240_10249197
514 Ga0111539_10232056
515 Ga0111539_10958885
516 Ga0105245_10045491
517 Ga0105245_10496264
518 Ga0105245_10767587
519 Ga0114129_10622091
520 Ga0114129_10799985
521 Ga0114129_12037178
522 Ga0114129_12893864
523 Ga0105243_11248320
524 Ga0105243_12295857
525 Ga0105242_10358208
526 Ga0105242_10709256
527 Ga0105248_12419366
528 Ga0105238_10187888
529 Ga0105249_10513348
530 Ga0105239_10147453
531 Ga0105239_10537259
532 Ga0157337_1009679
533 Ga0157373_10510635
534 Ga0157371_10164807
535 Ga0157369_10003021
536 Ga0157369_10242897
537 Ga0157369_10428248
538 Ga0157375_11976213
539 Ga0157377_10060066
540 Ga0157377_11282079
541 Ga0206354_11493990
542 Ga0206353_11007153
543 Ga0224712_10037070
544 Ga0207688_10053569
545 Ga0207699_10115311
546 Ga0207699_11241565
547 Ga0207645_10100712
548 Ga0207643_10451076
549 Ga0207705_10014803
550 Ga0207707_10054949
551 Ga0207707_10474907
552 Ga0207695_10390603
553 Ga0207693_10127651
554 Ga0207660_10428191
555 Ga0207657_10001226
556 Ga0207657_10002370
557 Ga0207649_10034257
558 Ga0207649_10387614
559 Ga0207652_10124692
560 Ga0207652_10562147
561 Ga0207646_10181184
562 Ga0207650_10544988
563 Ga0207687_11540269
564 Ga0207700_10577688
565 Ga0207700_11301318
566 Ga0207664_10004379
567 Ga0207664_10057211
568 Ga0207690_10035173
569 Ga0207690_10094039
570 Ga0207690_10386944
571 Ga0207706_10921013
572 Ga0207686_10998542
573 Ga0207661_10241611
574 Ga0207661_10537540
575 Ga0207661_10790832
576 Ga0207679_10239917
577 Ga0207679_11241615
578 Ga0207667_10286737
579 Ga0207667_10773449
580 Ga0207712_10311845
581 Ga0207712_11986294
582 Ga0207677_10191422
583 Ga0207703_11414099
584 Ga0207639_11173771
585 Ga0207708_10041555
586 Ga0207708_10896643
587 Ga0207674_10510164
588 Ga0207698_10433938
589 Ga0207428_10001591
590 Ga0207428_10035197
591 Ga0265337_1129007
592 Ga0265326_10201858
593 Ga0265319_1203510
594 Ga0265334_10069863
595 Ga0265318_10007208
596 Ga0265322_10166548
597 Ga0265336_10007733
598 Ga0265336_10071676
599 Ga0265338_10013644
600 Ga0265338_10027092
601 Ga0265338_10033211
602 Ga0265330_10396637
603 Ga0265332_10013364
604 Ga0265320_10365301
605 Ga0265325_10083013
606 Ga0265325_10121671
607 Ga0265340_10056022
608 Ga0265339_10001458
609 Ga0265327_10168493
610 Ga0265327_10178776
611 Ga0265316_10026478
612 Ga0265316_10247936
613 Ga0265314_10018137
614 Ga0265314_10061971
615 Ga0265342_10037614
616 Ga0265342_10079698
617 Ga0265342_10459505
618 Ga0307409_101242450
619 Ga0307416_103310543
620 Ga0373939_0484539
621 Ga0373941_0041468
622 Ga0373954_0179334
623 Ga0373956_0341302
624 Ga0373955_0130613
625 Ga0373935_1236552
626 Ga0373933_0049262
627 Ga0373937_0462134
628 Ga0373937_1621858
629 Ga0395899_0026786
630 Ga0395899_0163833
631 Ga0395899_0224823
632 Ga0395899_0546112
633 Ga0395900_0064784
634 Ga0395900_0077358
635 Ga0395900_0085678
636 Ga0395900_0250303
637 Ga0395900_0258427
638 Ga0395900_0408482
639 Ga0395900_0417466
640 Ga0395900_1003233
641 Ga0395898_0036772
642 Ga0395898_0067504
643 Ga0395898_0158397
644 Ga0395898_0167150
645 Ga0395898_0269603
646 Ga0395898_1022766
647 Ga0395898_1339190
648 Ga0395905_0038289
649 Ga0395905_0090548
650 Ga0395905_0093395
651 Ga0395905_0096327
652 Ga0395905_0674973
653 Ga0395905_1210371
654 Ga0395901_0003855
655 Ga0395901_0016177
656 Ga0395901_0041759
657 Ga0395901_0160751
658 Ga0395901_0191673
659 Ga0395901_0327302
660 Ga0395901_0560384
661 Ga0395901_0758018
662 Ga0395901_0866207
663 Ga0395901_1388375
664 Ga0439438_051607
665 Ga0439438_129055
666 Ga0439439_0095443
667 Ga0439461_0004213
668 Ga0439461_0006581
669 Ga0439465_0083346
670 Ga0451789_0237799
671 Ga0451839_0028074
672 Ga0451839_0235133
673 Ga0450920_008700
674 Ga0439446_0233761
675 Ga0439458_0144369
676 Ga0439458_0178714
677 Ga0439434_0161193
678 Ga0466963_1073144
679 Ga0451576_0256674
680 Ga0451576_1740200
681 Ga0466967_0122272
682 Ga0466967_0161932
683 Ga0495592_0031699
684 Ga0495592_0225989
685 Ga0495651_0156119
686 Ga0495651_0179206
687 Ga0495653_0139115
688 Ga0495653_0192709
689 Ga0495585_0429413
690 Ga0495608_0324501
691 Ga0495618_0037470
692 Ga0495618_0140540
693 Ga0495628_0055104
694 Ga0495628_0322378
695 Ga0495628_0500295
696 Ga0495628_0614311
697 Ga0495630_0502081
698 Ga0495652_0161916
699 Ga0495652_0298535
700 Ga0495652_0366592
701 Ga0495587_0136918
702 Ga0495645_0151982
703 Ga0495645_0712615
704 Ga0495667_0011349
705 Ga0495667_0202588
706 Ga0495634_0015789
707 Ga0495635_0018280
708 Ga0495635_0322304
709 Ga0495659_0272717
710 Ga0495659_0399517
711 Ga0495657_0009299
712 Ga0495657_0160196
713 Ga0495646_0419490
714 Ga0495600_0129097
715 Ga0495600_0410627
716 Ga0495600_0720467
717 Ga0495600_0762270
718 Ga0495604_0139813
719 Ga0495636_0692311
720 Ga0495674_0261118
721 Ga0495680_0018472
722 Ga0495680_0507931
723 Ga0495680_0894648
724 Ga0495675_0325385
725 Ga0495684_0017843
726 Ga0495684_0172274
727 Ga0495602_0824054
728 Ga0496100_1077142
729 Ga0496101_0771096
730 Ga0496101_1044808
731 Ga0496102_1966307
732 Ga0496105_0071906
733 Ga0496106_0572810
734 Ga0496106_1403626
735 Ga0496107_0753846
736 Ga0496108_0007732
737 Ga0496108_0170542
738 Ga0496108_1493982
739 Ga0496109_0013710
740 Ga0496109_0231767
741 Ga0496109_0360857
742 Ga0496109_1211090
743 Ga0496109_1215335
744 Ga0496109_1315620
745 Ga0496110_0095101
746 Ga0496110_0101333
747 Ga0496110_0237669
748 Ga0496111_0016904
749 Ga0496111_0164058
750 Ga0496111_0597668
751 Ga0496111_0757792
752 Ga0496112_0012682
753 Ga0496112_0064574
754 Ga0496112_0136189
755 Ga0496112_0221345
756 Ga0496112_0361176
757 Ga0496112_0762954
758 Ga0496112_0819614
759 Ga0496113_0151176
760 Ga0496113_1506278
761 Ga0496113_1589306
762 Ga0496114_0861094
763 Ga0496114_0950658
764 Ga0496115_0440919
765 Ga0501031_0576951
766 Ga0501032_0507974
767 Ga0501033_0414978
768 Ga0501036_0304349
769 Ga0501037_0181456
770 Ga0501038_0462412
771 Ga0501039_0311008
772 Ga0501040_0043267
773 Ga0501041_0435248
774 Ga0501042_0008111
775 Ga0501042_0144047
776 Ga0501043_0613433
777 Ga0501046_0051729
778 Ga0501047_0536689
779 Ga0501048_0150469
780 Ga0501067_0006195
781 Ga0501067_0019896
782 Ga0501068_0017406
783 Ga0501068_0020538
784 Ga0501068_0059866
785 Ga0501069_0107457
786 Ga0501069_0272159
787 Ga0501070_0711945
788 Ga0501071_0028926
789 Ga0501071_0354717
790 Ga0501072_0004666
791 Ga0501072_0064706
792 Ga0501072_0257204
793 Ga0501074_0150316
794 Ga0501074_0810672
795 Ga0501075_0013650
796 Ga0501075_0050132
797 Ga0501075_0426828
798 Ga0501076_0010882
799 Ga0501076_0166752
800 Ga0501077_0004973
801 Ga0501079_0007249
802 Ga0501079_0424493
803 Ga0501080_0082965
804 Ga0501080_0305846
805 Ga0501080_0714773
806 Ga0501081_0079451
807 Ga0501081_1524639
808 Ga0501083_0038664
809 Ga0501083_0668878
810 Ga0501035_0088261
811 Ga0501045_0535066
812 Ga0501045_0591138
813 nmdc:mga00v17_138019_c1
814 nmdc:mga0yw44_430139_c1
815 nmdc:mga0yw44_6478_c1
816 nmdc:mga06z11_32733_c1
817 nmdc:mga05p37_214173_c1
818 nmdc:mga05p37_533309_c1
819 nmdc:mga05p37_647335_c1
820 nmdc:mga06r32_254944_c1
821 nmdc:mga08y16_616019_c1
822 nmdc:mga0n895_328234_c1
823 nmdc:mga0rr50_1141845_c1
824 nmdc:mga08x19_1133141_c1
825 nmdc:mga08x19_597426_c1
826 nmdc:mga0a205_77484_c1
827 Ga0495601_0231648
828 Ga0495601_0514234
829 Ga0495612_0109130
830 Ga0495612_0151266
831 Ga0495595_0025587
832 Ga0495595_0267900
833 Ga0495595_0717988
834 Ga0495619_0099344
835 Ga0495619_0300186
836 Ga0495619_0570096
837 Ga0501084_0262130
838 Ga0501084_0282996
839 Ga0501082_0235271
840 Ga0530510_0016054
841 Ga0530510_0048323
842 Ga0530510_0158998
843 Ga0530510_0204255
844 Ga0530510_0591030

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

36

120

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.9627 9 116
5kbf-assembly2.cif.gz_B camp bound pfpka-r (141-441) 0.947 9 123
6h7e-assembly1.cif.gz_A gef regulatory domain 0.9276 9 116
1cx4-assembly1.cif.gz_A crystal structure of a deletion mutant of the type ii beta regulatory subunit of camp-dependent protein kinase 0.9273 10 123
6bq8-assembly1.cif.gz_A joint x-ray/neutron structure of pkg ii cnb-b domain in complex with 8-pcpt-cgmp 0.9257 9 123
ID Description Score Start End Superfamily
3of1A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9501 10 116 2.60.120.10
5k8sB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9433 9 123 2.60.120.10
3cf6E02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9419 35 116 2.60.120.10
af_P9WIY7_12_147_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9365 9 123 2.60.120.10
af_A0A286Y9K1_280_425_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9265 9 122 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7V9SUS0-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9899 3 120 GO:0005829
AF-A0A538EVD5-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9845 1 121
AF-A0A538JXP0-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9811 2 124 GO:0004862
GO:0005829
GO:0005952
GO:0030552
GO:0034236
AF-A0A538MLI1-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9804 2 122 GO:0004862
GO:0005829
GO:0005952
GO:0030552
GO:0034236
AF-A0A538HWA3-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9801 2 121

Map