F440298

General Info

Members Datasets Scaffolds Average Seq Length
422 250 844 282

Family's Representative Sequence

Representative Sequence 3300025961|Ga0207712_10157252|Ga0207712_101572522
Length 322
Sequence VSDAPGASTAMRSGRRPVALDSQCPKSIAAKARARGPTGHYPHRVPVTWTPAGDYSDIRFELSGDGIAKITINRPEVRNAFRPQTLFQLSEAFDHARDDPEVGVIILTGEGPHAFCSGGDQRIRGDDGYLGDDTVAKRGIGRLNVLDLQVQIRRTPKPVVAMVAGYAIGGGHVLHVVCDLTIAADNARFGQTGPKVGSFDGGYGSGLLARQIGQKRAREVWFLCRQYDAETALSWGLVNAVVPLERLEEETVAWCREMLALSPLALRMLKASMNAADDGLAGIQQLAGDATLLFYMSDEAQEGRNAYQEKRPPDFSKFPKRP

Samples

Sample ID Description Type Environment
1 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
131 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
135 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
169 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
246 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
247 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
248 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
249 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
250 2891562705 Microbispora tritici MT50 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.24
Isolates 0.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0
Rhizoplane 8.29
Rhizosphere 86.97
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207712_10157252 3300025961 Bacteria 1762
2 JGI24745J21846_1006853 3300002073 Bacteria 1272
3 JGI25407J50210_10052764 3300003373 Bacteria 1029
4 Ga0070683_100038542 3300005329 Bacteria 4382
5 Ga0070690_100127063 3300005330 Bacteria 1718
6 Ga0070682_100015813 3300005337 Bacteria 4380
7 Ga0070682_100039777 3300005337 Bacteria 2891
8 Ga0070682_100127969 3300005337 Bacteria 1715
9 Ga0068868_100064988 3300005338 Bacteria 2897
10 Ga0068868_100096687 3300005338 Bacteria 2386
11 Ga0070689_100019578 3300005340 Bacteria 5007
12 Ga0070689_100114884 3300005340 Bacteria 2145
13 Ga0070687_100007923 3300005343 Bacteria 4470
14 Ga0070687_100156880 3300005343 Bacteria 1342
15 Ga0070661_100405157 3300005344 Bacteria 1079
16 Ga0070692_10094963 3300005345 Bacteria 1626
17 Ga0070668_100089828 3300005347 Bacteria 2420
18 Ga0070675_100207129 3300005354 Bacteria 1704
19 Ga0070674_100008893 3300005356 Bacteria 5997
20 Ga0070673_100139426 3300005364 Bacteria 2044
21 Ga0070688_100038057 3300005365 Bacteria 2935
22 Ga0070713_100035162 3300005436 Bacteria 4031
23 Ga0070713_100060202 3300005436 Bacteria 3174
24 Ga0070710_10105445 3300005437 Bacteria 1685
25 Ga0070701_10151630 3300005438 Bacteria 1335
26 Ga0070711_100027576 3300005439 Bacteria 3730
27 Ga0070705_100072935 3300005440 Bacteria 2081
28 Ga0070700_100026356 3300005441 Bacteria 3432
29 Ga0070700_100191433 3300005441 Bacteria 1430
30 Ga0070708_100035737 3300005445 Bacteria 4330
31 Ga0070708_100064886 3300005445 Bacteria 3273
32 Ga0070708_100605888 3300005445 Bacteria 1033
33 Ga0070663_100220591 3300005455 Bacteria 1488
34 Ga0070678_100159379 3300005456 Bacteria 1826
35 Ga0070662_100028535 3300005457 Bacteria 3884
36 Ga0070706_100000096 3300005467 Bacteria 106439
37 Ga0070706_100001261 3300005467 Bacteria 27056
38 Ga0070706_100009644 3300005467 Bacteria 8976
39 Ga0070706_100018179 3300005467 Bacteria 6484
40 Ga0070706_100039439 3300005467 Bacteria 4361
41 Ga0070706_100058040 3300005467 Bacteria 3572
42 Ga0070707_100000195 3300005468 Bacteria 60549
43 Ga0070707_100007416 3300005468 Bacteria 10187
44 Ga0070707_100087517 3300005468 Bacteria 3013
45 Ga0070707_100152455 3300005468 Bacteria 2250
46 Ga0070707_100167260 3300005468 Bacteria 2143
47 Ga0070698_100003414 3300005471 Bacteria 17470
48 Ga0070698_100004003 3300005471 Bacteria 16216
49 Ga0070698_100005336 3300005471 Bacteria 14070
50 Ga0070698_100006357 3300005471 Bacteria 12830
51 Ga0070698_100012429 3300005471 Bacteria 9011
52 Ga0070698_100013326 3300005471 Bacteria 8702
53 Ga0070698_100102142 3300005471 Bacteria 2838
54 Ga0068853_100079959 3300005539 Bacteria 2859
55 Ga0070686_100030176 3300005544 Bacteria 3305
56 Ga0070695_100384009 3300005545 Bacteria 1060
57 Ga0070693_100070797 3300005547 Bacteria 2053
58 Ga0070704_100094784 3300005549 Bacteria 2234
59 Ga0070704_100165796 3300005549 Bacteria 1751
60 Ga0068854_100188358 3300005578 Bacteria 1615
61 Ga0068856_100617871 3300005614 Bacteria 1105
62 Ga0068859_100250550 3300005617 Bacteria 1861
63 Ga0068864_100145804 3300005618 Bacteria 2140
64 Ga0068861_100041506 3300005719 Bacteria 3446
65 Ga0068861_100369236 3300005719 Bacteria 1264
66 Ga0068851_10082649 3300005834 Bacteria 1679
67 Ga0068851_10213712 3300005834 Bacteria 1081
68 Ga0068870_10023919 3300005840 Bacteria 3018
69 Ga0068858_100138433 3300005842 Bacteria 2285
70 Ga0068858_100217973 3300005842 Bacteria 1807
71 Ga0068860_100012697 3300005843 Bacteria 8287
72 Ga0081455_10010712 3300005937 Bacteria 9273
73 Ga0081455_10032116 3300005937 Bacteria 4737
74 Ga0081538_10001060 3300005981 Bacteria 29322
75 Ga0081538_10004688 3300005981 Bacteria 12525
76 Ga0081538_10015475 3300005981 Bacteria 5899
77 Ga0081540_1002210 3300005983 Bacteria 16066
78 Ga0081539_10019303 3300005985 Bacteria 4673
79 Ga0081539_10033031 3300005985 Bacteria 3158
80 Ga0070717_10124491 3300006028 Bacteria 2212
81 Ga0075365_10001307 3300006038 Bacteria 11114
82 Ga0075365_10063351 3300006038 Bacteria 2475
83 Ga0075364_10106243 3300006051 Bacteria 1870
84 Ga0070712_100073063 3300006175 Bacteria 2459
85 Ga0070712_100164850 3300006175 Bacteria 1714
86 Ga0075428_100049821 3300006844 Bacteria 4595
87 Ga0075428_100067799 3300006844 Bacteria 3904
88 Ga0075428_100098132 3300006844 Bacteria 3194
89 Ga0075431_100001038 3300006847 Bacteria 24774
90 Ga0075431_100449155 3300006847 Bacteria 1285
91 Ga0075433_10056839 3300006852 Bacteria 3419
92 Ga0075433_10123318 3300006852 Bacteria 2302
93 Ga0075433_10379068 3300006852 Bacteria 1249
94 Ga0075434_100007409 3300006871 Bacteria 10161
95 Ga0075434_100022819 3300006871 Bacteria 6093
96 Ga0075434_100145981 3300006871 Bacteria 2386
97 Ga0075429_100042639 3300006880 Bacteria 3948
98 Ga0068865_100088689 3300006881 Bacteria 2238
99 Ga0075436_100313538 3300006914 Bacteria 1126
100 Ga0097620_100250555 3300006931 Bacteria 1861
101 Ga0075435_100025751 3300007076 Bacteria 4582
102 Ga0111539_10005086 3300009094 Bacteria 17075
103 Ga0111539_10212914 3300009094 Bacteria 2251
104 Ga0111539_10287348 3300009094 Bacteria 1914
105 Ga0111539_10327914 3300009094 Bacteria 1782
106 Ga0111539_10357906 3300009094 Bacteria 1699
107 Ga0105245_10000789 3300009098 Bacteria 28722
108 Ga0105245_10012464 3300009098 Bacteria 7397
109 Ga0105245_10049836 3300009098 Bacteria 3751
110 Ga0105245_10120568 3300009098 Bacteria 2449
111 Ga0105247_10003016 3300009101 Bacteria 11153
112 Ga0105247_10064828 3300009101 Bacteria 2271
113 Ga0105247_10140233 3300009101 Bacteria 1583
114 Ga0114129_10001342 3300009147 Bacteria 32972
115 Ga0114129_10005133 3300009147 Bacteria 18430
116 Ga0114129_10102072 3300009147 Bacteria 3967
117 Ga0114129_10261357 3300009147 Bacteria 2320
118 Ga0114129_10416596 3300009147 Bacteria 1768
119 Ga0105243_10020721 3300009148 Bacteria 4988
120 Ga0105243_10309082 3300009148 Bacteria 1436
121 Ga0105241_10195242 3300009174 Bacteria 1687
122 Ga0105242_10057807 3300009176 Bacteria 3178
123 Ga0105242_10136019 3300009176 Bacteria 2127
124 Ga0105242_10249001 3300009176 Bacteria 1600
125 Ga0105248_10389708 3300009177 Bacteria 1569
126 Ga0105249_10027727 3300009553 Bacteria 5111
127 Ga0105239_10474283 3300010375 Bacteria 1421
128 Ga0157374_10473383 3300013296 Bacteria 1255
129 Ga0157374_10487133 3300013296 Bacteria 1237
130 Ga0157378_10289613 3300013297 Bacteria 1581
131 Ga0163162_10610573 3300013306 Bacteria 1216
132 Ga0163162_10659606 3300013306 Bacteria 1169
133 Ga0157375_10216747 3300013308 Bacteria 2072
134 Ga0157375_10381357 3300013308 Bacteria 1576
135 Ga0163163_10231692 3300014325 Bacteria 1896
136 Ga0182008_10062200 3300014497 Bacteria 1840
137 Ga0157377_10186611 3300014745 Bacteria 1308
138 Ga0157379_10154797 3300014968 Bacteria 2068
139 Ga0197907_10171605 3300020069 Bacteria 2238
140 Ga0213876_10006474 3300021384 Bacteria 6383
141 Ga0224572_1000612 3300024225 Bacteria 4434
142 Ga0207656_10012260 3300025321 Bacteria 3256
143 Ga0207710_10002775 3300025900 Bacteria 8002
144 Ga0207688_10020227 3300025901 Bacteria 3634
145 Ga0207688_10064008 3300025901 Bacteria 2075
146 Ga0207688_10156496 3300025901 Bacteria 1349
147 Ga0207645_10105561 3300025907 Bacteria 1820
148 Ga0207643_10049411 3300025908 Bacteria 2383
149 Ga0207684_10000054 3300025910 Bacteria 220915
150 Ga0207684_10002478 3300025910 Bacteria 18590
151 Ga0207684_10005755 3300025910 Bacteria 11376
152 Ga0207684_10024056 3300025910 Bacteria 5197
153 Ga0207684_10037995 3300025910 Bacteria 4086
154 Ga0207684_10064580 3300025910 Bacteria 3108
155 Ga0207684_10093399 3300025910 Bacteria 2565
156 Ga0207684_10161192 3300025910 Bacteria 1932
157 Ga0207684_10177581 3300025910 Bacteria 1836
158 Ga0207671_10120271 3300025914 Bacteria 2007
159 Ga0207693_10056313 3300025915 Bacteria 3083
160 Ga0207693_10313631 3300025915 Bacteria 1228
161 Ga0207693_10340678 3300025915 Bacteria 1173
162 Ga0207660_10164297 3300025917 Bacteria 1715
163 Ga0207662_10021885 3300025918 Bacteria 3659
164 Ga0207662_10066637 3300025918 Bacteria 2170
165 Ga0207657_10106147 3300025919 Bacteria 2324
166 Ga0207646_10000928 3300025922 Bacteria 37746
167 Ga0207646_10002090 3300025922 Bacteria 23959
168 Ga0207646_10043805 3300025922 Bacteria 4018
169 Ga0207646_10207789 3300025922 Bacteria 1768
170 Ga0207646_10297979 3300025922 Bacteria 1457
171 Ga0207681_10087124 3300025923 Bacteria 2221
172 Ga0207687_10032710 3300025927 Bacteria 3524
173 Ga0207687_10079658 3300025927 Bacteria 2362
174 Ga0207700_10034598 3300025928 Bacteria 3629
175 Ga0207664_10041750 3300025929 Bacteria 3575
176 Ga0207664_10058549 3300025929 Bacteria 3065
177 Ga0207706_10063860 3300025933 Bacteria 3241
178 Ga0207709_10158985 3300025935 Bacteria 1574
179 Ga0207669_10003852 3300025937 Bacteria 6539
180 Ga0207704_10125508 3300025938 Bacteria 1766
181 Ga0207665_10102607 3300025939 Bacteria 1999
182 Ga0207691_10088665 3300025940 Bacteria 2774
183 Ga0207691_10563048 3300025940 Bacteria 966
184 Ga0207689_10104590 3300025942 Bacteria 2326
185 Ga0207661_10092669 3300025944 Bacteria 2519
186 Ga0207661_10099699 3300025944 Bacteria 2437
187 Ga0207661_10478944 3300025944 Bacteria 1136
188 Ga0207668_10018737 3300025972 Bacteria 4364
189 Ga0207677_10053915 3300026023 Bacteria 2740
190 Ga0207703_10122815 3300026035 Bacteria 2231
191 Ga0207703_10285129 3300026035 Bacteria 1501
192 Ga0207678_10092449 3300026067 Bacteria 2586
193 Ga0207678_10207854 3300026067 Bacteria 1674
194 Ga0207708_10040717 3300026075 Bacteria 3543
195 Ga0207708_10090408 3300026075 Bacteria 2360
196 Ga0207648_10103884 3300026089 Bacteria 2492
197 Ga0207676_10241424 3300026095 Bacteria 1621
198 Ga0207676_10358037 3300026095 Bacteria 1351
199 Ga0207675_100025111 3300026118 Bacteria 5546
200 Ga0207675_100141449 3300026118 Bacteria 2286
201 Ga0207683_10031409 3300026121 Bacteria 4609
202 Ga0207683_10239252 3300026121 Bacteria 1656
203 Ga0207698_10064572 3300026142 Bacteria 2870
204 Ga0207428_10040350 3300027907 Bacteria 3787
205 Ga0207428_10085871 3300027907 Bacteria 2450
206 Ga0207428_10167068 3300027907 Bacteria 1668
207 Ga0268266_10201066 3300028379 Bacteria 1824
208 Ga0268265_10103930 3300028380 Bacteria 2301
209 Ga0268264_10012181 3300028381 Bacteria 7077
210 Ga0265336_10008662 3300028666 Bacteria 3553
211 Ga0265338_10002685 3300028800 Bacteria 26141
212 Ga0265327_10000231 3300031251 Bacteria 113114
213 Ga0265327_10001557 3300031251 Bacteria 28167
214 Ga0316576_10005116 3300031727 Bacteria 7962
215 Ga0307405_10001982 3300031731 Bacteria 8851
216 Ga0307406_10386101 3300031901 Bacteria 1105
217 Ga0307409_100081361 3300031995 Bacteria 2618
218 Ga0307416_100046639 3300032002 Bacteria 3422
219 Ga0307416_100230378 3300032002 Bacteria 1785
220 Ga0307411_10014613 3300032005 Bacteria 4376
221 Ga0307415_100040136 3300032126 Bacteria 3099
222 Ga0373926_0007700 3300035083 Bacteria 3588
223 Ga0373926_0013625 3300035083 Bacteria 2759
224 Ga0373934_0000301 3300035086 Bacteria 17402
225 Ga0373944_0063655 3300035089 Bacteria 1188
226 Ga0373936_0032035 3300035113 Bacteria 2078
227 Ga0373953_0000559 3300035117 Bacteria 10324
228 Ga0373954_0005275 3300035118 Bacteria 5585
229 Ga0373956_0000259 3300035119 Bacteria 21148
230 Ga0373957_0000408 3300035120 Bacteria 10897
231 Ga0373946_0121593 3300035171 Bacteria 1192
232 Ga0373955_0000042 3300035172 Bacteria 50503
233 Ga0373935_0000443 3300035692 Bacteria 21444
234 Ga0373935_0185153 3300035692 Bacteria 1431
235 Ga0373935_0344136 3300035692 Bacteria 1062
236 Ga0373927_0001461 3300035695 Bacteria 17821
237 Ga0373927_0188134 3300035695 Bacteria 1354
238 Ga0373933_0000024 3300035724 Bacteria 93753
239 Ga0373947_0000032 3300035725 Bacteria 72445
240 Ga0373937_0000029 3300036401 Bacteria 123547
241 Ga0316582_0276231 3300036647 Bacteria 1153
242 Ga0373925_0005228 3300037068 Bacteria 9703
243 Ga0373925_0018079 3300037068 Bacteria 5119
244 Ga0395899_0168924 3300037312 Bacteria 1541
245 Ga0395900_0025721 3300037418 Bacteria 6026
246 Ga0395900_0119563 3300037418 Bacteria 2704
247 Ga0395900_0230089 3300037418 Bacteria 1865
248 Ga0395898_0080881 3300037466 Bacteria 3133
249 Ga0395898_0114429 3300037466 Bacteria 2585
250 Ga0395905_0261746 3300037471 Bacteria 1615
251 Ga0395901_0078951 3300038443 Bacteria 3436
252 Ga0395901_0151835 3300038443 Bacteria 2434
253 Ga0395901_0159169 3300038443 Bacteria 2371
254 Ga0395901_0520055 3300038443 Bacteria 1209
255 Ga0436365_0733727 3300039437 Bacteria 7222
256 Ga0436365_1658263 3300039437 Bacteria 1971
257 Ga0436365_1692328 3300039437 Bacteria 1343
258 Ga0451853_0830163 3300041512 Bacteria 2359
259 Ga0466965_0218627 3300044683 Bacteria 1015
260 Ga0466967_0222529 3300045976 Bacteria 1794
261 Ga0495592_0000040 3300046454 Bacteria 123599
262 Ga0495592_0089986 3300046454 Bacteria 2203
263 Ga0495603_0030087 3300046455 Bacteria 3272
264 Ga0495629_0006441 3300046459 Bacteria 8701
265 Ga0495641_0014720 3300046461 Bacteria 4220
266 Ga0495651_0000017 3300046462 Bacteria 124010
267 Ga0495653_0040535 3300046463 Bacteria 3639
268 Ga0495653_0089476 3300046463 Bacteria 2255
269 Ga0495653_0127842 3300046463 Bacteria 1802
270 Ga0495653_0148383 3300046463 Bacteria 1641
271 Ga0495580_0158750 3300046472 Bacteria 1565
272 Ga0495582_0057256 3300046473 Bacteria 2149
273 Ga0495582_0092229 3300046473 Bacteria 1689
274 Ga0495639_0062253 3300046475 Bacteria 1712
275 Ga0495662_0057257 3300046476 Bacteria 1882
276 Ga0495664_0183944 3300046477 Bacteria 1267
277 Ga0495664_0212965 3300046477 Bacteria 1170
278 Ga0495585_0151058 3300046492 Bacteria 1211
279 Ga0495608_0000053 3300046511 Bacteria 93787
280 Ga0495618_0179314 3300046514 Bacteria 1346
281 Ga0495628_0001800 3300046516 Bacteria 19452
282 Ga0495628_0021167 3300046516 Bacteria 5354
283 Ga0495628_0178565 3300046516 Bacteria 1607
284 Ga0495630_0093166 3300046517 Bacteria 2277
285 Ga0495630_0099224 3300046517 Bacteria 2203
286 Ga0495630_0220930 3300046517 Bacteria 1446
287 Ga0495652_0002805 3300046529 Bacteria 17562
288 Ga0495665_0013146 3300046531 Bacteria 4480
289 Ga0495640_0099926 3300046533 Bacteria 1906
290 Ga0495640_0102012 3300046533 Bacteria 1883
291 Ga0495587_0001135 3300046536 Bacteria 17425
292 Ga0495645_0170799 3300046543 Bacteria 1497
293 Ga0495667_0000063 3300046559 Bacteria 93832
294 Ga0495634_0027565 3300046642 Bacteria 3951
295 Ga0495635_0038964 3300046663 Bacteria 3290
296 Ga0495657_0000032 3300046675 Bacteria 123599
297 Ga0495599_0000047 3300046678 Bacteria 85391
298 Ga0495623_0001042 3300046679 Bacteria 18723
299 Ga0495647_0049835 3300046681 Bacteria 1623
300 Ga0495658_0004706 3300046683 Bacteria 6707
301 Ga0495658_0013430 3300046683 Bacteria 4169
302 Ga0495613_0005888 3300046689 Bacteria 9177
303 Ga0495600_0156990 3300046809 Bacteria 1471
304 Ga0495581_0031745 3300047315 Bacteria 3060
305 Ga0495604_0000688 3300047317 Bacteria 28660
306 Ga0495604_0084860 3300047317 Bacteria 2364
307 Ga0495674_0193857 3300047319 Bacteria 1687
308 Ga0495672_0003750 3300047320 Bacteria 12813
309 Ga0495676_0060508 3300047321 Bacteria 2967
310 Ga0495676_0122395 3300047321 Bacteria 1890
311 Ga0495676_0210680 3300047321 Bacteria 1345
312 Ga0495680_0002825 3300047322 Bacteria 17461
313 Ga0495680_0049101 3300047322 Bacteria 3308
314 Ga0495680_0077949 3300047322 Bacteria 2509
315 Ga0495680_0108953 3300047322 Bacteria 2055
316 Ga0495675_0000946 3300047444 Bacteria 17615
317 Ga0495684_0017425 3300047471 Bacteria 5530
318 Ga0495593_0012079 3300047673 Bacteria 4948
319 Ga0495602_0001156 3300048088 Bacteria 25832
320 Ga0495602_0001525 3300048088 Bacteria 23037
321 Ga0495614_0072215 3300048089 Bacteria 1489
322 Ga0496100_0000650 3300048903 Bacteria 16486
323 Ga0496100_0031965 3300048903 Bacteria 3277
324 Ga0496100_0041708 3300048903 Bacteria 2927
325 Ga0496101_0004797 3300048904 Bacteria 8580
326 Ga0496101_0009749 3300048904 Bacteria 6322
327 Ga0496101_0017560 3300048904 Bacteria 4853
328 Ga0496102_0157997 3300048905 Bacteria 2132
329 Ga0496102_0181770 3300048905 Bacteria 1982
330 Ga0496103_0011068 3300048906 Bacteria 5341
331 Ga0496104_0006552 3300048907 Bacteria 10239
332 Ga0496104_0057898 3300048907 Bacteria 3668
333 Ga0496104_0113024 3300048907 Bacteria 2604
334 Ga0496104_0211162 3300048907 Bacteria 1852
335 Ga0496105_0003881 3300048908 Bacteria 11174
336 Ga0496105_0124252 3300048908 Bacteria 2127
337 Ga0496106_0009939 3300048909 Bacteria 7025
338 Ga0496106_0121815 3300048909 Bacteria 2039
339 Ga0496107_0068143 3300048910 Bacteria 2582
340 Ga0496107_0171495 3300048910 Bacteria 1610
341 Ga0496108_0025796 3300048911 Bacteria 4845
342 Ga0496108_0541904 3300048911 Bacteria 1015
343 Ga0496109_0037630 3300048912 Bacteria 4371
344 Ga0496109_0046066 3300048912 Bacteria 3959
345 Ga0496109_0177159 3300048912 Bacteria 2002
346 Ga0496109_0242869 3300048912 Bacteria 1695
347 Ga0496109_0406147 3300048912 Bacteria 1287
348 Ga0496110_0092670 3300048913 Bacteria 2704
349 Ga0496110_0250589 3300048913 Bacteria 1611
350 Ga0496111_0013587 3300048914 Bacteria 5544
351 Ga0496113_0100950 3300048916 Bacteria 2236
352 Ga0496113_0208368 3300048916 Bacteria 1555
353 Ga0496114_0035420 3300048917 Bacteria 4121
354 Ga0496114_0079508 3300048917 Bacteria 2768
355 Ga0496115_0026455 3300048918 Bacteria 4528
356 Ga0496115_0078636 3300048918 Bacteria 2683
357 Ga0501034_0008995 3300049571 Bacteria 10490
358 Ga0501036_0041688 3300049572 Bacteria 3884
359 Ga0501037_0258548 3300049573 Bacteria 1217
360 Ga0501039_0028464 3300049575 Bacteria 4302
361 Ga0501040_0002986 3300049576 Bacteria 10949
362 Ga0501040_0226248 3300049576 Bacteria 1331
363 Ga0501041_0118680 3300049577 Bacteria 1643
364 Ga0501042_0011847 3300049578 Bacteria 5889
365 Ga0501042_0437695 3300049578 Bacteria 948
366 Ga0501071_0021988 3300049587 Bacteria 4445
367 Ga0501071_0143409 3300049587 Bacteria 1780
368 Ga0501072_0089223 3300049588 Bacteria 2447
369 Ga0501075_0023081 3300049591 Bacteria 4552
370 Ga0501076_0232013 3300049592 Bacteria 1509
371 Ga0501076_0313657 3300049592 Bacteria 1286
372 Ga0501079_0150853 3300049741 Bacteria 1812
373 Ga0501081_0338352 3300049743 Bacteria 1108
374 Ga0501081_0361166 3300049743 Bacteria 1071
375 Ga0501045_0007911 3300049824 Bacteria 7402
376 Ga0501045_0051427 3300049824 Bacteria 3007
377 Ga0501045_0066621 3300049824 Bacteria 2644
378 nmdc:mga03n38_213003_c1 3300050490 Bacteria 1005
379 nmdc:mga00v17_138491_c1 3300050491 Bacteria 1560
380 nmdc:mga00v17_9122_c1 3300050491 Bacteria 5355
381 nmdc:mga0yw44_43009_c1 3300050492 Bacteria 2696
382 nmdc:mga0yw44_45794_c1 3300050492 Bacteria 2624
383 nmdc:mga0yw44_5061_c2 3300050492 Bacteria 1850
384 nmdc:mga0yw44_58382_c1 3300050492 Bacteria 2357
385 nmdc:mga05p37_141528_c1 3300050507 Bacteria 2947
386 nmdc:mga05p37_170442_c1 3300050507 Bacteria 2655
387 nmdc:mga05p37_262756_c1 3300050507 Bacteria 2065
388 nmdc:mga05p37_725571_c1 3300050507 Bacteria 1100
389 nmdc:mga05p37_9511_c1 3300050507 Bacteria 11509
390 nmdc:mga09592_84139_c1 3300050508 Bacteria 2712
391 nmdc:mga06r32_10846_c1 3300050510 Bacteria 8207
392 nmdc:mga08y16_344448_c1 3300050511 Bacteria 1532
393 nmdc:mga08y16_3666_c1 3300050511 Bacteria 15985
394 nmdc:mga0n895_144542_c1 3300050512 Bacteria 2408
395 nmdc:mga0n895_1628_c1 3300050512 Bacteria 16956
396 nmdc:mga0n895_438623_c1 3300050512 Bacteria 1319
397 nmdc:mga0n895_444228_c1 3300050512 Bacteria 1310
398 nmdc:mga0n895_69317_c1 3300050512 Bacteria 3494
399 nmdc:mga0rr50_1250_c1 3300050513 Bacteria 13870
400 nmdc:mga0rr50_315238_c1 3300050513 Bacteria 1310
401 nmdc:mga0rr50_57837_c1 3300050513 Bacteria 2903
402 nmdc:mga08x19_30153_c1 3300050514 Bacteria 3406
403 nmdc:mga08x19_40723_c1 3300050514 Bacteria 2958
404 nmdc:mga0a205_3821_c1 3300050515 Bacteria 13493
405 nmdc:mga0a205_56812_c1 3300050515 Bacteria 3779
406 Ga0495601_0146846 3300053077 Bacteria 1539
407 Ga0495612_0062138 3300053078 Bacteria 1548
408 Ga0495595_0001409 3300053084 Bacteria 9342
409 Ga0495619_0003989 3300053085 Bacteria 9462
410 Ga0495619_0052009 3300053085 Bacteria 2708
411 Ga0495619_0155589 3300053085 Bacteria 1577
412 Ga0495619_0197541 3300053085 Bacteria 1393
413 Ga0495619_0378264 3300053085 Bacteria 979
414 Ga0500616_0190720 3300053153 Bacteria 915
415 Ga0501084_0062129 3300054114 Bacteria 3127
416 Ga0590071_007088 3300059421 Bacteria 2653
417 Ga0501082_0167335 3300060353 Bacteria 1911
418 Ga0530510_0020796 3300061734 Bacteria 4667
419 2856745377 2856741275 Bacteria 8096094
420 2891397554 2891395885 Bacteria 9251614
421 2891561404 2891554331 Bacteria 8812224
422 2891564090 2891562705 Bacteria 8039471
423 Ga0207712_10157252
424 JGI24745J21846_1006853
425 JGI25407J50210_10052764
426 Ga0070683_100038542
427 Ga0070690_100127063
428 Ga0070682_100015813
429 Ga0070682_100039777
430 Ga0070682_100127969
431 Ga0068868_100064988
432 Ga0068868_100096687
433 Ga0070689_100019578
434 Ga0070689_100114884
435 Ga0070687_100007923
436 Ga0070687_100156880
437 Ga0070661_100405157
438 Ga0070692_10094963
439 Ga0070668_100089828
440 Ga0070675_100207129
441 Ga0070674_100008893
442 Ga0070673_100139426
443 Ga0070688_100038057
444 Ga0070713_100035162
445 Ga0070713_100060202
446 Ga0070710_10105445
447 Ga0070701_10151630
448 Ga0070711_100027576
449 Ga0070705_100072935
450 Ga0070700_100026356
451 Ga0070700_100191433
452 Ga0070708_100035737
453 Ga0070708_100064886
454 Ga0070708_100605888
455 Ga0070663_100220591
456 Ga0070678_100159379
457 Ga0070662_100028535
458 Ga0070706_100000096
459 Ga0070706_100001261
460 Ga0070706_100009644
461 Ga0070706_100018179
462 Ga0070706_100039439
463 Ga0070706_100058040
464 Ga0070707_100000195
465 Ga0070707_100007416
466 Ga0070707_100087517
467 Ga0070707_100152455
468 Ga0070707_100167260
469 Ga0070698_100003414
470 Ga0070698_100004003
471 Ga0070698_100005336
472 Ga0070698_100006357
473 Ga0070698_100012429
474 Ga0070698_100013326
475 Ga0070698_100102142
476 Ga0068853_100079959
477 Ga0070686_100030176
478 Ga0070695_100384009
479 Ga0070693_100070797
480 Ga0070704_100094784
481 Ga0070704_100165796
482 Ga0068854_100188358
483 Ga0068856_100617871
484 Ga0068859_100250550
485 Ga0068864_100145804
486 Ga0068861_100041506
487 Ga0068861_100369236
488 Ga0068851_10082649
489 Ga0068851_10213712
490 Ga0068870_10023919
491 Ga0068858_100138433
492 Ga0068858_100217973
493 Ga0068860_100012697
494 Ga0081455_10010712
495 Ga0081455_10032116
496 Ga0081538_10001060
497 Ga0081538_10004688
498 Ga0081538_10015475
499 Ga0081540_1002210
500 Ga0081539_10019303
501 Ga0081539_10033031
502 Ga0070717_10124491
503 Ga0075365_10001307
504 Ga0075365_10063351
505 Ga0075364_10106243
506 Ga0070712_100073063
507 Ga0070712_100164850
508 Ga0075428_100049821
509 Ga0075428_100067799
510 Ga0075428_100098132
511 Ga0075431_100001038
512 Ga0075431_100449155
513 Ga0075433_10056839
514 Ga0075433_10123318
515 Ga0075433_10379068
516 Ga0075434_100007409
517 Ga0075434_100022819
518 Ga0075434_100145981
519 Ga0075429_100042639
520 Ga0068865_100088689
521 Ga0075436_100313538
522 Ga0097620_100250555
523 Ga0075435_100025751
524 Ga0111539_10005086
525 Ga0111539_10212914
526 Ga0111539_10287348
527 Ga0111539_10327914
528 Ga0111539_10357906
529 Ga0105245_10000789
530 Ga0105245_10012464
531 Ga0105245_10049836
532 Ga0105245_10120568
533 Ga0105247_10003016
534 Ga0105247_10064828
535 Ga0105247_10140233
536 Ga0114129_10001342
537 Ga0114129_10005133
538 Ga0114129_10102072
539 Ga0114129_10261357
540 Ga0114129_10416596
541 Ga0105243_10020721
542 Ga0105243_10309082
543 Ga0105241_10195242
544 Ga0105242_10057807
545 Ga0105242_10136019
546 Ga0105242_10249001
547 Ga0105248_10389708
548 Ga0105249_10027727
549 Ga0105239_10474283
550 Ga0157374_10473383
551 Ga0157374_10487133
552 Ga0157378_10289613
553 Ga0163162_10610573
554 Ga0163162_10659606
555 Ga0157375_10216747
556 Ga0157375_10381357
557 Ga0163163_10231692
558 Ga0182008_10062200
559 Ga0157377_10186611
560 Ga0157379_10154797
561 Ga0197907_10171605
562 Ga0213876_10006474
563 Ga0224572_1000612
564 Ga0207656_10012260
565 Ga0207710_10002775
566 Ga0207688_10020227
567 Ga0207688_10064008
568 Ga0207688_10156496
569 Ga0207645_10105561
570 Ga0207643_10049411
571 Ga0207684_10000054
572 Ga0207684_10002478
573 Ga0207684_10005755
574 Ga0207684_10024056
575 Ga0207684_10037995
576 Ga0207684_10064580
577 Ga0207684_10093399
578 Ga0207684_10161192
579 Ga0207684_10177581
580 Ga0207671_10120271
581 Ga0207693_10056313
582 Ga0207693_10313631
583 Ga0207693_10340678
584 Ga0207660_10164297
585 Ga0207662_10021885
586 Ga0207662_10066637
587 Ga0207657_10106147
588 Ga0207646_10000928
589 Ga0207646_10002090
590 Ga0207646_10043805
591 Ga0207646_10207789
592 Ga0207646_10297979
593 Ga0207681_10087124
594 Ga0207687_10032710
595 Ga0207687_10079658
596 Ga0207700_10034598
597 Ga0207664_10041750
598 Ga0207664_10058549
599 Ga0207706_10063860
600 Ga0207709_10158985
601 Ga0207669_10003852
602 Ga0207704_10125508
603 Ga0207665_10102607
604 Ga0207691_10088665
605 Ga0207691_10563048
606 Ga0207689_10104590
607 Ga0207661_10092669
608 Ga0207661_10099699
609 Ga0207661_10478944
610 Ga0207668_10018737
611 Ga0207677_10053915
612 Ga0207703_10122815
613 Ga0207703_10285129
614 Ga0207678_10092449
615 Ga0207678_10207854
616 Ga0207708_10040717
617 Ga0207708_10090408
618 Ga0207648_10103884
619 Ga0207676_10241424
620 Ga0207676_10358037
621 Ga0207675_100025111
622 Ga0207675_100141449
623 Ga0207683_10031409
624 Ga0207683_10239252
625 Ga0207698_10064572
626 Ga0207428_10040350
627 Ga0207428_10085871
628 Ga0207428_10167068
629 Ga0268266_10201066
630 Ga0268265_10103930
631 Ga0268264_10012181
632 Ga0265336_10008662
633 Ga0265338_10002685
634 Ga0265327_10000231
635 Ga0265327_10001557
636 Ga0316576_10005116
637 Ga0307405_10001982
638 Ga0307406_10386101
639 Ga0307409_100081361
640 Ga0307416_100046639
641 Ga0307416_100230378
642 Ga0307411_10014613
643 Ga0307415_100040136
644 Ga0373926_0007700
645 Ga0373926_0013625
646 Ga0373934_0000301
647 Ga0373944_0063655
648 Ga0373936_0032035
649 Ga0373953_0000559
650 Ga0373954_0005275
651 Ga0373956_0000259
652 Ga0373957_0000408
653 Ga0373946_0121593
654 Ga0373955_0000042
655 Ga0373935_0000443
656 Ga0373935_0185153
657 Ga0373935_0344136
658 Ga0373927_0001461
659 Ga0373927_0188134
660 Ga0373933_0000024
661 Ga0373947_0000032
662 Ga0373937_0000029
663 Ga0316582_0276231
664 Ga0373925_0005228
665 Ga0373925_0018079
666 Ga0395899_0168924
667 Ga0395900_0025721
668 Ga0395900_0119563
669 Ga0395900_0230089
670 Ga0395898_0080881
671 Ga0395898_0114429
672 Ga0395905_0261746
673 Ga0395901_0078951
674 Ga0395901_0151835
675 Ga0395901_0159169
676 Ga0395901_0520055
677 Ga0436365_0733727
678 Ga0436365_1658263
679 Ga0436365_1692328
680 Ga0451853_0830163
681 Ga0466965_0218627
682 Ga0466967_0222529
683 Ga0495592_0000040
684 Ga0495592_0089986
685 Ga0495603_0030087
686 Ga0495629_0006441
687 Ga0495641_0014720
688 Ga0495651_0000017
689 Ga0495653_0040535
690 Ga0495653_0089476
691 Ga0495653_0127842
692 Ga0495653_0148383
693 Ga0495580_0158750
694 Ga0495582_0057256
695 Ga0495582_0092229
696 Ga0495639_0062253
697 Ga0495662_0057257
698 Ga0495664_0183944
699 Ga0495664_0212965
700 Ga0495585_0151058
701 Ga0495608_0000053
702 Ga0495618_0179314
703 Ga0495628_0001800
704 Ga0495628_0021167
705 Ga0495628_0178565
706 Ga0495630_0093166
707 Ga0495630_0099224
708 Ga0495630_0220930
709 Ga0495652_0002805
710 Ga0495665_0013146
711 Ga0495640_0099926
712 Ga0495640_0102012
713 Ga0495587_0001135
714 Ga0495645_0170799
715 Ga0495667_0000063
716 Ga0495634_0027565
717 Ga0495635_0038964
718 Ga0495657_0000032
719 Ga0495599_0000047
720 Ga0495623_0001042
721 Ga0495647_0049835
722 Ga0495658_0004706
723 Ga0495658_0013430
724 Ga0495613_0005888
725 Ga0495600_0156990
726 Ga0495581_0031745
727 Ga0495604_0000688
728 Ga0495604_0084860
729 Ga0495674_0193857
730 Ga0495672_0003750
731 Ga0495676_0060508
732 Ga0495676_0122395
733 Ga0495676_0210680
734 Ga0495680_0002825
735 Ga0495680_0049101
736 Ga0495680_0077949
737 Ga0495680_0108953
738 Ga0495675_0000946
739 Ga0495684_0017425
740 Ga0495593_0012079
741 Ga0495602_0001156
742 Ga0495602_0001525
743 Ga0495614_0072215
744 Ga0496100_0000650
745 Ga0496100_0031965
746 Ga0496100_0041708
747 Ga0496101_0004797
748 Ga0496101_0009749
749 Ga0496101_0017560
750 Ga0496102_0157997
751 Ga0496102_0181770
752 Ga0496103_0011068
753 Ga0496104_0006552
754 Ga0496104_0057898
755 Ga0496104_0113024
756 Ga0496104_0211162
757 Ga0496105_0003881
758 Ga0496105_0124252
759 Ga0496106_0009939
760 Ga0496106_0121815
761 Ga0496107_0068143
762 Ga0496107_0171495
763 Ga0496108_0025796
764 Ga0496108_0541904
765 Ga0496109_0037630
766 Ga0496109_0046066
767 Ga0496109_0177159
768 Ga0496109_0242869
769 Ga0496109_0406147
770 Ga0496110_0092670
771 Ga0496110_0250589
772 Ga0496111_0013587
773 Ga0496113_0100950
774 Ga0496113_0208368
775 Ga0496114_0035420
776 Ga0496114_0079508
777 Ga0496115_0026455
778 Ga0496115_0078636
779 Ga0501034_0008995
780 Ga0501036_0041688
781 Ga0501037_0258548
782 Ga0501039_0028464
783 Ga0501040_0002986
784 Ga0501040_0226248
785 Ga0501041_0118680
786 Ga0501042_0011847
787 Ga0501042_0437695
788 Ga0501071_0021988
789 Ga0501071_0143409
790 Ga0501072_0089223
791 Ga0501075_0023081
792 Ga0501076_0232013
793 Ga0501076_0313657
794 Ga0501079_0150853
795 Ga0501081_0338352
796 Ga0501081_0361166
797 Ga0501045_0007911
798 Ga0501045_0051427
799 Ga0501045_0066621
800 nmdc:mga03n38_213003_c1
801 nmdc:mga00v17_138491_c1
802 nmdc:mga00v17_9122_c1
803 nmdc:mga0yw44_43009_c1
804 nmdc:mga0yw44_45794_c1
805 nmdc:mga0yw44_5061_c2
806 nmdc:mga0yw44_58382_c1
807 nmdc:mga05p37_141528_c1
808 nmdc:mga05p37_170442_c1
809 nmdc:mga05p37_262756_c1
810 nmdc:mga05p37_725571_c1
811 nmdc:mga05p37_9511_c1
812 nmdc:mga09592_84139_c1
813 nmdc:mga06r32_10846_c1
814 nmdc:mga08y16_344448_c1
815 nmdc:mga08y16_3666_c1
816 nmdc:mga0n895_144542_c1
817 nmdc:mga0n895_1628_c1
818 nmdc:mga0n895_438623_c1
819 nmdc:mga0n895_444228_c1
820 nmdc:mga0n895_69317_c1
821 nmdc:mga0rr50_1250_c1
822 nmdc:mga0rr50_315238_c1
823 nmdc:mga0rr50_57837_c1
824 nmdc:mga08x19_30153_c1
825 nmdc:mga08x19_40723_c1
826 nmdc:mga0a205_3821_c1
827 nmdc:mga0a205_56812_c1
828 Ga0495601_0146846
829 Ga0495612_0062138
830 Ga0495595_0001409
831 Ga0495619_0003989
832 Ga0495619_0052009
833 Ga0495619_0155589
834 Ga0495619_0197541
835 Ga0495619_0378264
836 Ga0500616_0190720
837 Ga0501084_0062129
838 Ga0590071_007088
839 Ga0501082_0167335
840 Ga0530510_0020796
841 2856745377
842 2891397554
843 2891561404
844 2891564090

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

63

318

0.96

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

67

282

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4els-assembly1.cif.gz_C structure of e. coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with bicarbonate 0.9774 2 254
2iex-assembly1.cif.gz_B crystal structure of dihydroxynapthoic acid synthetase (gk2873) from geobacillus kaustophilus hta426 0.9758 4 278
3h02-assembly3.cif.gz_F 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium. 0.9752 2 253
4elx-assembly1.cif.gz_C structure of apo e.coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl 0.9734 2 253
3h02-assembly3.cif.gz_E 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium. 0.972 2 278
ID Description Score Start End Superfamily
af_Q2FZL5_3_210_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9538 2 213 3.90.226.10
3t8aA02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9468 217 258 1.10.12.10
1q52J02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9466 217 265 1.10.12.10
1q52A02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9463 217 265 1.10.12.10
1q52C02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9461 217 265 1.10.12.10
ID Description Score Start End GO Terms
AF-J2DI61-F1-model_v4 deleted 0.9697 118 278
AF-J2DI61-F1-model_v4 deleted 0.9639 118 278
AF-A0A2D6BHQ5-F1-model_v4 Multifunctional fusion protein [Includes: Putative 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (SHCHC synthase) (EC 4.2.99.20); 1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36)] 0.9508 1 278 GO:0005829
GO:0008935
GO:0009234
GO:0070205
AF-A0A7S3B998-F1-model_v4 Enoyl-CoA hydratase 0.9505 101 198 GO:0005739
GO:0006635
GO:0016836
AF-A0A1F8IZW8-F1-model_v4 1,4-dihydroxy-2-naphthoyl-CoA synthase (DHNA-CoA synthase) (EC 4.1.3.36) 0.9503 5 278 GO:0005829
GO:0008935
GO:0009234

Map