F440212

General Info

Members Datasets Scaffolds Average Seq Length
422 245 844 85

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_101111796|Ga0070684_1011117961
Length 99
Sequence MPIVVDIDVMLARRKMSVGDLADRVGITPANLAVLKNGRAKAVRFSTLAALCEELNCQPGDLLRWEAETPQSVDTPIPAHVADQRGSVPSGHAALGADG

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
70 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
139 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
140 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
141 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
144 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
145 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
146 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
152 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
153 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
160 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
224 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
225 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
234 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
235 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
236 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
237 2808606448 Streptomyces sp. 193411 Isolate Unclassified
238 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
239 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
240 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
241 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
242 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
243 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
244 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
245 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.68
Metatranscriptomes 0.24
Isolates 3.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0.47
Rhizoplane 11.14
Rhizosphere 82.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_101111796 3300005535 Bacteria 743
2 LJQas_1018759 3300000549 Bacteria 804
3 Ga0006562J51391_1088588 3300003578 Bacteria 1390
4 Ga0070658_11844402 3300005327 Bacteria 523
5 Ga0070670_100809041 3300005331 Bacteria 846
6 Ga0068869_100205302 3300005334 Bacteria 1556
7 Ga0070666_10542289 3300005335 Bacteria 846
8 Ga0070666_10783143 3300005335 Bacteria 702
9 Ga0070680_100977409 3300005336 Bacteria 731
10 Ga0070682_100139106 3300005337 Bacteria 1653
11 Ga0068868_100102576 3300005338 Bacteria 2317
12 Ga0068868_102015428 3300005338 Bacteria 548
13 Ga0070660_101030414 3300005339 Bacteria 696
14 Ga0070689_101114986 3300005340 Bacteria 706
15 Ga0070689_102171106 3300005340 Bacteria 509
16 Ga0070687_100302846 3300005343 Bacteria 1015
17 Ga0070661_100775032 3300005344 Bacteria 785
18 Ga0070668_100010687 3300005347 Bacteria 6826
19 Ga0070668_100532302 3300005347 Bacteria 1021
20 Ga0070668_101691789 3300005347 Bacteria 581
21 Ga0070659_100131426 3300005366 Bacteria 2033
22 Ga0070659_101403143 3300005366 Bacteria 621
23 Ga0070667_100001609 3300005367 Bacteria 20208
24 Ga0070667_100133450 3300005367 Bacteria 2169
25 Ga0070667_100413692 3300005367 Bacteria 1229
26 Ga0070667_100679456 3300005367 Bacteria 952
27 Ga0070667_101822549 3300005367 Bacteria 573
28 Ga0070709_11676000 3300005434 Bacteria 519
29 Ga0070709_11795512 3300005434 Bacteria 502
30 Ga0070714_101884612 3300005435 Bacteria 583
31 Ga0070713_101833673 3300005436 Bacteria 589
32 Ga0070711_100571001 3300005439 Bacteria 940
33 Ga0070700_100258042 3300005441 Bacteria 1254
34 Ga0070700_100325692 3300005441 Bacteria 1130
35 Ga0070663_100160623 3300005455 Bacteria 1729
36 Ga0070678_100748553 3300005456 Bacteria 884
37 Ga0070662_100989930 3300005457 Bacteria 719
38 Ga0070685_10124314 3300005466 Bacteria 1605
39 Ga0070685_10594071 3300005466 Bacteria 796
40 Ga0070684_100295215 3300005535 Bacteria 1486
41 Ga0070684_100311591 3300005535 Bacteria 1445
42 Ga0070684_100909178 3300005535 Bacteria 825
43 Ga0068853_100060685 3300005539 Bacteria 3268
44 Ga0068853_100107149 3300005539 Bacteria 2478
45 Ga0070686_100011100 3300005544 Bacteria 5103
46 Ga0070665_100340946 3300005548 Bacteria 1503
47 Ga0070665_100746345 3300005548 Bacteria 992
48 Ga0070665_100766897 3300005548 Bacteria 977
49 Ga0070665_101738479 3300005548 Bacteria 631
50 Ga0070664_100926195 3300005564 Bacteria 817
51 Ga0068857_101774335 3300005577 Bacteria 604
52 Ga0068854_100207780 3300005578 Bacteria 1543
53 Ga0068856_100319252 3300005614 Bacteria 1570
54 Ga0070702_100129287 3300005615 Bacteria 1593
55 Ga0070702_100462827 3300005615 Bacteria 923
56 Ga0068852_100904462 3300005616 Bacteria 900
57 Ga0068859_100355605 3300005617 Bacteria 1559
58 Ga0068859_100518015 3300005617 Bacteria 1287
59 Ga0068859_100731826 3300005617 Bacteria 1079
60 Ga0068859_102165747 3300005617 Bacteria 614
61 Ga0068864_100334060 3300005618 Bacteria 1426
62 Ga0068861_100783213 3300005719 Bacteria 893
63 Ga0068870_10669413 3300005840 Bacteria 713
64 Ga0068870_10908008 3300005840 Bacteria 623
65 Ga0068863_100901295 3300005841 Bacteria 884
66 Ga0068858_100289951 3300005842 Bacteria 1560
67 Ga0068858_102013905 3300005842 Bacteria 571
68 Ga0068858_102269075 3300005842 Bacteria 536
69 Ga0068860_100134274 3300005843 Bacteria 2376
70 Ga0068860_100241345 3300005843 Bacteria 1758
71 Ga0068860_100680711 3300005843 Bacteria 1038
72 Ga0068862_100000585 3300005844 Bacteria 37913
73 Ga0068862_100309877 3300005844 Bacteria 1455
74 Ga0081455_10010816 3300005937 Bacteria 9220
75 Ga0081538_10082886 3300005981 Bacteria 1698
76 Ga0081540_1118790 3300005983 Bacteria 1101
77 Ga0081539_10075721 3300005985 Bacteria 1786
78 Ga0070717_11123467 3300006028 Bacteria 716
79 Ga0075364_10018916 3300006051 Bacteria 4319
80 Ga0075362_10071278 3300006177 Bacteria 1587
81 Ga0075369_10427442 3300006186 Bacteria 626
82 Ga0097621_102400259 3300006237 Bacteria 505
83 Ga0075370_10274614 3300006353 Bacteria 1001
84 Ga0068871_100735942 3300006358 Bacteria 906
85 Ga0068871_101005148 3300006358 Bacteria 777
86 Ga0075430_100155466 3300006846 Bacteria 1904
87 Ga0075431_100001209 3300006847 Bacteria 23343
88 Ga0075429_100277795 3300006880 Bacteria 1467
89 Ga0075429_100430214 3300006880 Bacteria 1156
90 Ga0097620_100355598 3300006931 Bacteria 1559
91 Ga0097620_100518027 3300006931 Bacteria 1287
92 Ga0097620_100731882 3300006931 Bacteria 1079
93 Ga0097620_102165386 3300006931 Bacteria 614
94 Ga0111539_10841707 3300009094 Bacteria 1067
95 Ga0105245_10235073 3300009098 Bacteria 1774
96 Ga0105245_10257136 3300009098 Bacteria 1698
97 Ga0105245_10772799 3300009098 Bacteria 997
98 Ga0105245_13188615 3300009098 Bacteria 508
99 Ga0105247_10364837 3300009101 Bacteria 1020
100 Ga0114129_11748077 3300009147 Bacteria 758
101 Ga0105243_10642588 3300009148 Bacteria 1027
102 Ga0105243_11568043 3300009148 Bacteria 684
103 Ga0105242_10112759 3300009176 Bacteria 2321
104 Ga0105248_10177191 3300009177 Bacteria 2402
105 Ga0105249_10000392 3300009553 Bacteria 42706
106 Ga0105249_13019834 3300009553 Bacteria 540
107 Ga0105239_10151706 3300010375 Bacteria 2586
108 Ga0105239_13040919 3300010375 Bacteria 546
109 Ga0105246_10274907 3300011119 Bacteria 1348
110 Ga0105246_10287058 3300011119 Bacteria 1323
111 Ga0105246_10395323 3300011119 Bacteria 1146
112 Ga0105246_10675770 3300011119 Bacteria 902
113 Ga0157318_1004335 3300012482 Bacteria 861
114 Ga0157343_1027912 3300012488 Bacteria 553
115 Ga0157369_11729356 3300013105 Bacteria 635
116 Ga0157374_10084183 3300013296 Bacteria 3023
117 Ga0157374_11814403 3300013296 Bacteria 635
118 Ga0163162_11960007 3300013306 Bacteria 671
119 Ga0157372_10535188 3300013307 Bacteria 1366
120 Ga0157372_10764693 3300013307 Bacteria 1123
121 Ga0157375_10118397 3300013308 Bacteria 2755
122 Ga0157375_12581483 3300013308 Bacteria 607
123 Ga0163163_10081953 3300014325 Bacteria 3229
124 Ga0163163_10193434 3300014325 Bacteria 2082
125 Ga0163163_10665979 3300014325 Bacteria 1104
126 Ga0163163_10911362 3300014325 Bacteria 942
127 Ga0163163_12296343 3300014325 Bacteria 598
128 Ga0157380_12591883 3300014326 Bacteria 573
129 Ga0157380_12640623 3300014326 Bacteria 569
130 Ga0182008_10138762 3300014497 Bacteria 1215
131 Ga0157379_11756434 3300014968 Bacteria 609
132 Ga0157376_10897796 3300014969 Bacteria 904
133 Ga0157376_11000995 3300014969 Bacteria 858
134 Ga0157376_11226059 3300014969 Bacteria 779
135 Ga0207692_10249539 3300025898 Bacteria 1063
136 Ga0207692_10377438 3300025898 Bacteria 879
137 Ga0207688_10301057 3300025901 Bacteria 980
138 Ga0207688_10802894 3300025901 Bacteria 596
139 Ga0207680_10414114 3300025903 Bacteria 954
140 Ga0207699_11147015 3300025906 Bacteria 575
141 Ga0207643_10020646 3300025908 Bacteria 3616
142 Ga0207654_11396655 3300025911 Bacteria 511
143 Ga0207660_11117599 3300025917 Bacteria 642
144 Ga0207662_10150952 3300025918 Bacteria 1478
145 Ga0207649_11670434 3300025920 Bacteria 504
146 Ga0207681_10340690 3300025923 Bacteria 1198
147 Ga0207650_10316136 3300025925 Bacteria 1278
148 Ga0207650_10368875 3300025925 Bacteria 1184
149 Ga0207687_10605413 3300025927 Bacteria 924
150 Ga0207687_11145981 3300025927 Bacteria 668
151 Ga0207664_11211244 3300025929 Bacteria 673
152 Ga0207644_10219397 3300025931 Bacteria 1507
153 Ga0207644_11175608 3300025931 Bacteria 645
154 Ga0207690_10094289 3300025932 Bacteria 2123
155 Ga0207690_10893077 3300025932 Bacteria 737
156 Ga0207686_10221635 3300025934 Bacteria 1366
157 Ga0207709_10364716 3300025935 Bacteria 1095
158 Ga0207670_11774933 3300025936 Bacteria 525
159 Ga0207669_10819301 3300025937 Bacteria 773
160 Ga0207691_10952665 3300025940 Bacteria 717
161 Ga0207691_11442048 3300025940 Bacteria 564
162 Ga0207711_10223380 3300025941 Bacteria 1723
163 Ga0207661_10262312 3300025944 Bacteria 1539
164 Ga0207661_11200716 3300025944 Bacteria 698
165 Ga0207661_12106677 3300025944 Bacteria 510
166 Ga0207679_11802328 3300025945 Bacteria 559
167 Ga0207712_10002083 3300025961 Bacteria 13097
168 Ga0207668_10134235 3300025972 Bacteria 1894
169 Ga0207668_11654988 3300025972 Bacteria 578
170 Ga0207640_10305450 3300025981 Bacteria 1260
171 Ga0207658_10007388 3300025986 Bacteria 7493
172 Ga0207658_10028882 3300025986 Bacteria 3909
173 Ga0207658_10086665 3300025986 Bacteria 2416
174 Ga0207658_10106190 3300025986 Bacteria 2210
175 Ga0207658_11426564 3300025986 Bacteria 633
176 Ga0207677_10036865 3300026023 Bacteria 3191
177 Ga0207677_10315306 3300026023 Bacteria 1297
178 Ga0207677_10609940 3300026023 Bacteria 959
179 Ga0207703_10712888 3300026035 Bacteria 954
180 Ga0207639_10628984 3300026041 Bacteria 992
181 Ga0207678_10024364 3300026067 Bacteria 5285
182 Ga0207678_10839024 3300026067 Bacteria 812
183 Ga0207678_11381492 3300026067 Bacteria 623
184 Ga0207708_10026827 3300026075 Bacteria 4360
185 Ga0207708_10239528 3300026075 Bacteria 1459
186 Ga0207702_10297022 3300026078 Bacteria 1532
187 Ga0207702_10591569 3300026078 Bacteria 1088
188 Ga0207641_10819586 3300026088 Bacteria 921
189 Ga0207648_10001932 3300026089 Bacteria 22653
190 Ga0207676_10407273 3300026095 Bacteria 1272
191 Ga0207674_10062094 3300026116 Bacteria 3774
192 Ga0207674_10572837 3300026116 Bacteria 1091
193 Ga0207675_100516824 3300026118 Bacteria 1190
194 Ga0207675_100884459 3300026118 Bacteria 909
195 Ga0207683_10529727 3300026121 Bacteria 1089
196 Ga0268266_10023657 3300028379 Bacteria 5229
197 Ga0268266_11816815 3300028379 Bacteria 584
198 Ga0268265_10004635 3300028380 Bacteria 9494
199 Ga0268264_10088372 3300028381 Bacteria 2667
200 Ga0268264_10518952 3300028381 Bacteria 1164
201 Ga0307513_10016921 3300031456 Bacteria 8766
202 Ga0307408_100004783 3300031548 Bacteria 9122
203 Ga0307405_10009258 3300031731 Bacteria 5040
204 Ga0307405_11199818 3300031731 Bacteria 656
205 Ga0307413_10041313 3300031824 Bacteria 2699
206 Ga0307410_10061151 3300031852 Bacteria 2577
207 Ga0307410_10076863 3300031852 Bacteria 2331
208 Ga0307406_10119962 3300031901 Bacteria 1826
209 Ga0307407_10025833 3300031903 Bacteria 3102
210 Ga0307412_10127116 3300031911 Bacteria 1845
211 Ga0307412_10969163 3300031911 Bacteria 749
212 Ga0307409_100042098 3300031995 Bacteria 3417
213 Ga0307409_100859455 3300031995 Bacteria 918
214 Ga0307409_102519846 3300031995 Bacteria 543
215 Ga0307416_100018197 3300032002 Bacteria 4943
216 Ga0307416_100090959 3300032002 Bacteria 2619
217 Ga0307416_101195904 3300032002 Bacteria 866
218 Ga0307414_10026162 3300032004 Bacteria 3751
219 Ga0307411_10373777 3300032005 Bacteria 1170
220 Ga0307415_100077997 3300032126 Bacteria 2355
221 Ga0307415_100292976 3300032126 Bacteria 1344
222 Ga0373958_0218553 3300034819 Bacteria 506
223 Ga0373939_0487904 3300035114 Bacteria 524
224 Ga0439436_0001753 3300041404 Bacteria 6365
225 Ga0439436_0008566 3300041404 Bacteria 3145
226 Ga0439438_147807 3300041405 Bacteria 561
227 Ga0439439_0003991 3300041406 Bacteria 3292
228 Ga0439461_0007930 3300041410 Bacteria 1892
229 Ga0439466_0023782 3300041411 Bacteria 2153
230 Ga0439466_0039910 3300041411 Bacteria 1572
231 Ga0451791_1076409 3300041451 Bacteria 687
232 Ga0451839_0214569 3300041496 Bacteria 755
233 Ga0439433_0003844 3300041999 Bacteria 3231
234 Ga0439433_0006127 3300041999 Bacteria 2584
235 Ga0439433_0008119 3300041999 Bacteria 2272
236 Ga0439442_003829 3300042002 Bacteria 2980
237 Ga0439442_004566 3300042002 Bacteria 2752
238 Ga0439449_0014421 3300042007 Bacteria 2971
239 Ga0439449_0044136 3300042007 Bacteria 1653
240 Ga0439449_0083268 3300042007 Bacteria 1180
241 Ga0439457_003057 3300042014 Bacteria 4629
242 Ga0439457_021582 3300042014 Bacteria 1428
243 Ga0439462_0053256 3300042015 Bacteria 1090
244 Ga0439458_0048627 3300042157 Bacteria 1043
245 Ga0439444_0077723 3300042437 Bacteria 721
246 Ga0450918_060317 3300042531 Bacteria 700
247 Ga0466969_0172732 3300044656 Bacteria 990
248 Ga0466969_0235540 3300044656 Bacteria 831
249 Ga0466972_0001664 3300044658 Bacteria 10868
250 Ga0466972_0115822 3300044658 Bacteria 1265
251 Ga0466965_0324959 3300044683 Bacteria 838
252 Ga0466965_0549662 3300044683 Bacteria 652
253 Ga0466961_0084747 3300044693 Bacteria 2004
254 Ga0466963_0659687 3300044694 Bacteria 738
255 Ga0466963_1092250 3300044694 Bacteria 561
256 Ga0466970_0116416 3300044765 Bacteria 1462
257 Ga0466960_0012248 3300044901 Bacteria 3613
258 Ga0466960_0345690 3300044901 Bacteria 847
259 Ga0466959_0196263 3300045049 Bacteria 1407
260 Ga0466967_0056304 3300045976 Bacteria 3466
261 Ga0466967_0113715 3300045976 Bacteria 2491
262 Ga0466967_0113718 3300045976 Bacteria 2491
263 Ga0466967_1639028 3300045976 Bacteria 641
264 Ga0466967_1773692 3300045976 Bacteria 614
265 Ga0495592_0451012 3300046454 Bacteria 806
266 Ga0495592_0461123 3300046454 Bacteria 794
267 Ga0495592_0499852 3300046454 Bacteria 754
268 Ga0495651_0394733 3300046462 Bacteria 904
269 Ga0495594_0336783 3300046499 Bacteria 859
270 Ga0495618_0255547 3300046514 Bacteria 1098
271 Ga0495628_0405826 3300046516 Bacteria 995
272 Ga0495666_0040657 3300046526 Bacteria 2254
273 Ga0495652_0145048 3300046529 Bacteria 1862
274 Ga0495640_0019929 3300046533 Bacteria 4945
275 Ga0495656_0629290 3300046615 Bacteria 575
276 Ga0495634_0133151 3300046642 Bacteria 1583
277 Ga0495657_0127083 3300046675 Bacteria 1600
278 Ga0495671_0540394 3300046692 Bacteria 555
279 Ga0495604_0025916 3300047317 Bacteria 4669
280 Ga0495672_0170953 3300047320 Bacteria 1109
281 Ga0495676_0017507 3300047321 Bacteria 6334
282 Ga0495687_059643 3300047443 Bacteria 1577
283 Ga0495675_0457574 3300047444 Bacteria 737
284 Ga0496100_0075785 3300048903 Bacteria 2257
285 Ga0496100_0431323 3300048903 Bacteria 1008
286 Ga0496100_0474831 3300048903 Bacteria 961
287 Ga0496100_0561943 3300048903 Bacteria 883
288 Ga0496101_0316760 3300048904 Bacteria 1224
289 Ga0496102_0016811 3300048905 Bacteria 6399
290 Ga0496102_0083279 3300048905 Bacteria 2951
291 Ga0496102_0185477 3300048905 Bacteria 1961
292 Ga0496102_0374567 3300048905 Bacteria 1340
293 Ga0496102_1459219 3300048905 Bacteria 603
294 Ga0496103_0343498 3300048906 Bacteria 960
295 Ga0496103_0923559 3300048906 Bacteria 546
296 Ga0496104_0038311 3300048907 Bacteria 4485
297 Ga0496104_0057374 3300048907 Bacteria 3684
298 Ga0496104_0198407 3300048907 Bacteria 1919
299 Ga0496104_0211810 3300048907 Bacteria 1849
300 Ga0496105_0004605 3300048908 Bacteria 10391
301 Ga0496105_0053252 3300048908 Bacteria 3342
302 Ga0496105_0464657 3300048908 Bacteria 997
303 Ga0496107_0391872 3300048910 Bacteria 1033
304 Ga0496107_0448617 3300048910 Bacteria 958
305 Ga0496108_0002421 3300048911 Bacteria 14914
306 Ga0496108_0004172 3300048911 Bacteria 11634
307 Ga0496108_0488235 3300048911 Bacteria 1076
308 Ga0496109_0009009 3300048912 Bacteria 8499
309 Ga0496109_0066433 3300048912 Bacteria 3302
310 Ga0496109_0503715 3300048912 Bacteria 1143
311 Ga0496109_0886837 3300048912 Bacteria 830
312 Ga0496109_0926056 3300048912 Bacteria 809
313 Ga0496110_0020502 3300048913 Bacteria 5581
314 Ga0496110_0062352 3300048913 Bacteria 3293
315 Ga0496110_0299458 3300048913 Bacteria 1465
316 Ga0496110_0319632 3300048913 Bacteria 1414
317 Ga0496111_0013539 3300048914 Bacteria 5555
318 Ga0496111_0131163 3300048914 Bacteria 1854
319 Ga0496111_0728288 3300048914 Bacteria 720
320 Ga0496111_0863196 3300048914 Bacteria 653
321 Ga0496111_1167410 3300048914 Bacteria 547
322 Ga0496113_0087380 3300048916 Bacteria 2397
323 Ga0496113_0575619 3300048916 Bacteria 902
324 Ga0496113_0697867 3300048916 Bacteria 810
325 Ga0496114_0019500 3300048917 Bacteria 5495
326 Ga0496114_0039742 3300048917 Bacteria 3893
327 Ga0496114_0134810 3300048917 Bacteria 2135
328 Ga0496114_0259460 3300048917 Bacteria 1530
329 Ga0496115_1445182 3300048918 Bacteria 506
330 Ga0496121_0063859 3300048924 Bacteria 3005
331 Ga0496124_0193002 3300048927 Bacteria 1556
332 Ga0496125_0458947 3300048928 Bacteria 728
333 Ga0496126_0296072 3300048929 Bacteria 1337
334 Ga0501031_0000818 3300049568 Bacteria 18716
335 Ga0501032_0000978 3300049569 Bacteria 23112
336 Ga0501032_0004910 3300049569 Bacteria 10006
337 Ga0501032_0132111 3300049569 Bacteria 1647
338 Ga0501033_0019898 3300049570 Bacteria 5073
339 Ga0501033_0162638 3300049570 Bacteria 1606
340 Ga0501034_0845633 3300049571 Bacteria 805
341 Ga0501036_0010755 3300049572 Bacteria 7565
342 Ga0501036_0086189 3300049572 Bacteria 2655
343 Ga0501037_0039639 3300049573 Bacteria 3467
344 Ga0501037_0138726 3300049573 Bacteria 1741
345 Ga0501038_0008164 3300049574 Bacteria 9635
346 Ga0501038_0068489 3300049574 Bacteria 3016
347 Ga0501038_0151463 3300049574 Bacteria 1890
348 Ga0501039_0002254 3300049575 Bacteria 14305
349 Ga0501039_1141913 3300049575 Bacteria 603
350 Ga0501040_0115747 3300049576 Bacteria 1877
351 Ga0501042_0164885 3300049578 Bacteria 1599
352 Ga0501042_0623926 3300049578 Bacteria 784
353 Ga0501043_0005418 3300049579 Bacteria 10310
354 Ga0501043_0220815 3300049579 Bacteria 1466
355 Ga0501043_0724544 3300049579 Bacteria 725
356 Ga0501046_0131280 3300049580 Bacteria 1900
357 Ga0501046_0157130 3300049580 Bacteria 1712
358 Ga0501046_0339211 3300049580 Bacteria 1092
359 Ga0501047_0011530 3300049581 Bacteria 8366
360 Ga0501047_0399837 3300049581 Bacteria 1207
361 Ga0501048_0000474 3300049582 Bacteria 28128
362 Ga0501067_0480106 3300049583 Bacteria 695
363 Ga0501067_0806356 3300049583 Bacteria 529
364 Ga0501067_0833606 3300049583 Bacteria 520
365 Ga0501068_0314947 3300049584 Bacteria 1002
366 Ga0501069_0025458 3300049585 Bacteria 3234
367 Ga0501069_0062901 3300049585 Bacteria 2072
368 Ga0501069_0288591 3300049585 Bacteria 961
369 Ga0501069_0936737 3300049585 Bacteria 528
370 Ga0501070_0139679 3300049586 Bacteria 2000
371 Ga0501070_0332549 3300049586 Bacteria 1235
372 Ga0501071_0971513 3300049587 Bacteria 656
373 Ga0501071_1016803 3300049587 Bacteria 640
374 Ga0501071_1098329 3300049587 Bacteria 614
375 Ga0501073_0007439 3300049589 Bacteria 8140
376 Ga0501073_0113634 3300049589 Bacteria 1878
377 Ga0501074_0013944 3300049590 Bacteria 5841
378 Ga0501074_0717305 3300049590 Bacteria 705
379 Ga0501074_1267297 3300049590 Bacteria 517
380 Ga0501081_0745888 3300049743 Bacteria 736
381 Ga0501083_0003140 3300049744 Bacteria 11492
382 Ga0501083_0030343 3300049744 Bacteria 3715
383 Ga0501035_0031883 3300049822 Bacteria 4798
384 Ga0501035_0194939 3300049822 Bacteria 1740
385 Ga0501035_0573776 3300049822 Bacteria 922
386 Ga0501035_0699928 3300049822 Bacteria 817
387 Ga0501035_1165075 3300049822 Bacteria 599
388 Ga0501044_0003175 3300049823 Bacteria 18559
389 Ga0501044_0200965 3300049823 Bacteria 1951
390 Ga0501044_0376041 3300049823 Bacteria 1336
391 nmdc:mga03683_10459_c1 3300050489 Bacteria 3327
392 nmdc:mga00v17_1994_c1 3300050491 Bacteria 10531
393 nmdc:mga0yw44_1174_c1 3300050492 Bacteria 9851
394 nmdc:mga0yw44_685968_c1 3300050492 Bacteria 696
395 nmdc:mga0yw44_766029_c1 3300050492 Bacteria 655
396 nmdc:mga06z11_709128_c1 3300050494 Bacteria 613
397 nmdc:mga0qj67_148269_c1 3300050509 Bacteria 1902
398 nmdc:mga0qj67_472323_c1 3300050509 Bacteria 1009
399 nmdc:mga06r32_98061_c1 3300050510 Bacteria 2873
400 nmdc:mga08y16_355442_c1 3300050511 Bacteria 1504
401 nmdc:mga08y16_363159_c1 3300050511 Bacteria 1486
402 Ga0500635_0074288 3300053080 Bacteria 1211
403 Ga0501084_0046595 3300054114 Bacteria 3632
404 Ga0501084_0624067 3300054114 Bacteria 910
405 Ga0501084_0754656 3300054114 Bacteria 820
406 Ga0501084_1049066 3300054114 Bacteria 685
407 Ga0501082_0010154 3300060353 Bacteria 8109
408 Ga0530510_0287175 3300061734 Bacteria 1230
409 Ga0530510_0767778 3300061734 Bacteria 735
410 2537901493 2537561592 Bacteria 4348607
411 2585318204 2582581314 Bacteria 11452267
412 2784592716 2784132148 Bacteria 8627943
413 2786674145 2786546132 Bacteria 10419719
414 2809236354 2808606448 Bacteria 8656184
415 2862391785 2862382967 Bacteria 10317375
416 2877684604 2877676314 Bacteria 9512378
417 2912718184 2912715099 Bacteria 9460473
418 2954681266 2954673503 Bacteria 9685905
419 2954682892 2954682443 Bacteria 9862841
420 2990046306 2990044586 Bacteria 6603797
421 2990090545 2990088156 Bacteria 6657676
422 8008564917 8008558824 Bacteria 10610750
423 Ga0070684_101111796
424 LJQas_1018759
425 Ga0006562J51391_1088588
426 Ga0070658_11844402
427 Ga0070670_100809041
428 Ga0068869_100205302
429 Ga0070666_10542289
430 Ga0070666_10783143
431 Ga0070680_100977409
432 Ga0070682_100139106
433 Ga0068868_100102576
434 Ga0068868_102015428
435 Ga0070660_101030414
436 Ga0070689_101114986
437 Ga0070689_102171106
438 Ga0070687_100302846
439 Ga0070661_100775032
440 Ga0070668_100010687
441 Ga0070668_100532302
442 Ga0070668_101691789
443 Ga0070659_100131426
444 Ga0070659_101403143
445 Ga0070667_100001609
446 Ga0070667_100133450
447 Ga0070667_100413692
448 Ga0070667_100679456
449 Ga0070667_101822549
450 Ga0070709_11676000
451 Ga0070709_11795512
452 Ga0070714_101884612
453 Ga0070713_101833673
454 Ga0070711_100571001
455 Ga0070700_100258042
456 Ga0070700_100325692
457 Ga0070663_100160623
458 Ga0070678_100748553
459 Ga0070662_100989930
460 Ga0070685_10124314
461 Ga0070685_10594071
462 Ga0070684_100295215
463 Ga0070684_100311591
464 Ga0070684_100909178
465 Ga0068853_100060685
466 Ga0068853_100107149
467 Ga0070686_100011100
468 Ga0070665_100340946
469 Ga0070665_100746345
470 Ga0070665_100766897
471 Ga0070665_101738479
472 Ga0070664_100926195
473 Ga0068857_101774335
474 Ga0068854_100207780
475 Ga0068856_100319252
476 Ga0070702_100129287
477 Ga0070702_100462827
478 Ga0068852_100904462
479 Ga0068859_100355605
480 Ga0068859_100518015
481 Ga0068859_100731826
482 Ga0068859_102165747
483 Ga0068864_100334060
484 Ga0068861_100783213
485 Ga0068870_10669413
486 Ga0068870_10908008
487 Ga0068863_100901295
488 Ga0068858_100289951
489 Ga0068858_102013905
490 Ga0068858_102269075
491 Ga0068860_100134274
492 Ga0068860_100241345
493 Ga0068860_100680711
494 Ga0068862_100000585
495 Ga0068862_100309877
496 Ga0081455_10010816
497 Ga0081538_10082886
498 Ga0081540_1118790
499 Ga0081539_10075721
500 Ga0070717_11123467
501 Ga0075364_10018916
502 Ga0075362_10071278
503 Ga0075369_10427442
504 Ga0097621_102400259
505 Ga0075370_10274614
506 Ga0068871_100735942
507 Ga0068871_101005148
508 Ga0075430_100155466
509 Ga0075431_100001209
510 Ga0075429_100277795
511 Ga0075429_100430214
512 Ga0097620_100355598
513 Ga0097620_100518027
514 Ga0097620_100731882
515 Ga0097620_102165386
516 Ga0111539_10841707
517 Ga0105245_10235073
518 Ga0105245_10257136
519 Ga0105245_10772799
520 Ga0105245_13188615
521 Ga0105247_10364837
522 Ga0114129_11748077
523 Ga0105243_10642588
524 Ga0105243_11568043
525 Ga0105242_10112759
526 Ga0105248_10177191
527 Ga0105249_10000392
528 Ga0105249_13019834
529 Ga0105239_10151706
530 Ga0105239_13040919
531 Ga0105246_10274907
532 Ga0105246_10287058
533 Ga0105246_10395323
534 Ga0105246_10675770
535 Ga0157318_1004335
536 Ga0157343_1027912
537 Ga0157369_11729356
538 Ga0157374_10084183
539 Ga0157374_11814403
540 Ga0163162_11960007
541 Ga0157372_10535188
542 Ga0157372_10764693
543 Ga0157375_10118397
544 Ga0157375_12581483
545 Ga0163163_10081953
546 Ga0163163_10193434
547 Ga0163163_10665979
548 Ga0163163_10911362
549 Ga0163163_12296343
550 Ga0157380_12591883
551 Ga0157380_12640623
552 Ga0182008_10138762
553 Ga0157379_11756434
554 Ga0157376_10897796
555 Ga0157376_11000995
556 Ga0157376_11226059
557 Ga0207692_10249539
558 Ga0207692_10377438
559 Ga0207688_10301057
560 Ga0207688_10802894
561 Ga0207680_10414114
562 Ga0207699_11147015
563 Ga0207643_10020646
564 Ga0207654_11396655
565 Ga0207660_11117599
566 Ga0207662_10150952
567 Ga0207649_11670434
568 Ga0207681_10340690
569 Ga0207650_10316136
570 Ga0207650_10368875
571 Ga0207687_10605413
572 Ga0207687_11145981
573 Ga0207664_11211244
574 Ga0207644_10219397
575 Ga0207644_11175608
576 Ga0207690_10094289
577 Ga0207690_10893077
578 Ga0207686_10221635
579 Ga0207709_10364716
580 Ga0207670_11774933
581 Ga0207669_10819301
582 Ga0207691_10952665
583 Ga0207691_11442048
584 Ga0207711_10223380
585 Ga0207661_10262312
586 Ga0207661_11200716
587 Ga0207661_12106677
588 Ga0207679_11802328
589 Ga0207712_10002083
590 Ga0207668_10134235
591 Ga0207668_11654988
592 Ga0207640_10305450
593 Ga0207658_10007388
594 Ga0207658_10028882
595 Ga0207658_10086665
596 Ga0207658_10106190
597 Ga0207658_11426564
598 Ga0207677_10036865
599 Ga0207677_10315306
600 Ga0207677_10609940
601 Ga0207703_10712888
602 Ga0207639_10628984
603 Ga0207678_10024364
604 Ga0207678_10839024
605 Ga0207678_11381492
606 Ga0207708_10026827
607 Ga0207708_10239528
608 Ga0207702_10297022
609 Ga0207702_10591569
610 Ga0207641_10819586
611 Ga0207648_10001932
612 Ga0207676_10407273
613 Ga0207674_10062094
614 Ga0207674_10572837
615 Ga0207675_100516824
616 Ga0207675_100884459
617 Ga0207683_10529727
618 Ga0268266_10023657
619 Ga0268266_11816815
620 Ga0268265_10004635
621 Ga0268264_10088372
622 Ga0268264_10518952
623 Ga0307513_10016921
624 Ga0307408_100004783
625 Ga0307405_10009258
626 Ga0307405_11199818
627 Ga0307413_10041313
628 Ga0307410_10061151
629 Ga0307410_10076863
630 Ga0307406_10119962
631 Ga0307407_10025833
632 Ga0307412_10127116
633 Ga0307412_10969163
634 Ga0307409_100042098
635 Ga0307409_100859455
636 Ga0307409_102519846
637 Ga0307416_100018197
638 Ga0307416_100090959
639 Ga0307416_101195904
640 Ga0307414_10026162
641 Ga0307411_10373777
642 Ga0307415_100077997
643 Ga0307415_100292976
644 Ga0373958_0218553
645 Ga0373939_0487904
646 Ga0439436_0001753
647 Ga0439436_0008566
648 Ga0439438_147807
649 Ga0439439_0003991
650 Ga0439461_0007930
651 Ga0439466_0023782
652 Ga0439466_0039910
653 Ga0451791_1076409
654 Ga0451839_0214569
655 Ga0439433_0003844
656 Ga0439433_0006127
657 Ga0439433_0008119
658 Ga0439442_003829
659 Ga0439442_004566
660 Ga0439449_0014421
661 Ga0439449_0044136
662 Ga0439449_0083268
663 Ga0439457_003057
664 Ga0439457_021582
665 Ga0439462_0053256
666 Ga0439458_0048627
667 Ga0439444_0077723
668 Ga0450918_060317
669 Ga0466969_0172732
670 Ga0466969_0235540
671 Ga0466972_0001664
672 Ga0466972_0115822
673 Ga0466965_0324959
674 Ga0466965_0549662
675 Ga0466961_0084747
676 Ga0466963_0659687
677 Ga0466963_1092250
678 Ga0466970_0116416
679 Ga0466960_0012248
680 Ga0466960_0345690
681 Ga0466959_0196263
682 Ga0466967_0056304
683 Ga0466967_0113715
684 Ga0466967_0113718
685 Ga0466967_1639028
686 Ga0466967_1773692
687 Ga0495592_0451012
688 Ga0495592_0461123
689 Ga0495592_0499852
690 Ga0495651_0394733
691 Ga0495594_0336783
692 Ga0495618_0255547
693 Ga0495628_0405826
694 Ga0495666_0040657
695 Ga0495652_0145048
696 Ga0495640_0019929
697 Ga0495656_0629290
698 Ga0495634_0133151
699 Ga0495657_0127083
700 Ga0495671_0540394
701 Ga0495604_0025916
702 Ga0495672_0170953
703 Ga0495676_0017507
704 Ga0495687_059643
705 Ga0495675_0457574
706 Ga0496100_0075785
707 Ga0496100_0431323
708 Ga0496100_0474831
709 Ga0496100_0561943
710 Ga0496101_0316760
711 Ga0496102_0016811
712 Ga0496102_0083279
713 Ga0496102_0185477
714 Ga0496102_0374567
715 Ga0496102_1459219
716 Ga0496103_0343498
717 Ga0496103_0923559
718 Ga0496104_0038311
719 Ga0496104_0057374
720 Ga0496104_0198407
721 Ga0496104_0211810
722 Ga0496105_0004605
723 Ga0496105_0053252
724 Ga0496105_0464657
725 Ga0496107_0391872
726 Ga0496107_0448617
727 Ga0496108_0002421
728 Ga0496108_0004172
729 Ga0496108_0488235
730 Ga0496109_0009009
731 Ga0496109_0066433
732 Ga0496109_0503715
733 Ga0496109_0886837
734 Ga0496109_0926056
735 Ga0496110_0020502
736 Ga0496110_0062352
737 Ga0496110_0299458
738 Ga0496110_0319632
739 Ga0496111_0013539
740 Ga0496111_0131163
741 Ga0496111_0728288
742 Ga0496111_0863196
743 Ga0496111_1167410
744 Ga0496113_0087380
745 Ga0496113_0575619
746 Ga0496113_0697867
747 Ga0496114_0019500
748 Ga0496114_0039742
749 Ga0496114_0134810
750 Ga0496114_0259460
751 Ga0496115_1445182
752 Ga0496121_0063859
753 Ga0496124_0193002
754 Ga0496125_0458947
755 Ga0496126_0296072
756 Ga0501031_0000818
757 Ga0501032_0000978
758 Ga0501032_0004910
759 Ga0501032_0132111
760 Ga0501033_0019898
761 Ga0501033_0162638
762 Ga0501034_0845633
763 Ga0501036_0010755
764 Ga0501036_0086189
765 Ga0501037_0039639
766 Ga0501037_0138726
767 Ga0501038_0008164
768 Ga0501038_0068489
769 Ga0501038_0151463
770 Ga0501039_0002254
771 Ga0501039_1141913
772 Ga0501040_0115747
773 Ga0501042_0164885
774 Ga0501042_0623926
775 Ga0501043_0005418
776 Ga0501043_0220815
777 Ga0501043_0724544
778 Ga0501046_0131280
779 Ga0501046_0157130
780 Ga0501046_0339211
781 Ga0501047_0011530
782 Ga0501047_0399837
783 Ga0501048_0000474
784 Ga0501067_0480106
785 Ga0501067_0806356
786 Ga0501067_0833606
787 Ga0501068_0314947
788 Ga0501069_0025458
789 Ga0501069_0062901
790 Ga0501069_0288591
791 Ga0501069_0936737
792 Ga0501070_0139679
793 Ga0501070_0332549
794 Ga0501071_0971513
795 Ga0501071_1016803
796 Ga0501071_1098329
797 Ga0501073_0007439
798 Ga0501073_0113634
799 Ga0501074_0013944
800 Ga0501074_0717305
801 Ga0501074_1267297
802 Ga0501081_0745888
803 Ga0501083_0003140
804 Ga0501083_0030343
805 Ga0501035_0031883
806 Ga0501035_0194939
807 Ga0501035_0573776
808 Ga0501035_0699928
809 Ga0501035_1165075
810 Ga0501044_0003175
811 Ga0501044_0200965
812 Ga0501044_0376041
813 nmdc:mga03683_10459_c1
814 nmdc:mga00v17_1994_c1
815 nmdc:mga0yw44_1174_c1
816 nmdc:mga0yw44_685968_c1
817 nmdc:mga0yw44_766029_c1
818 nmdc:mga06z11_709128_c1
819 nmdc:mga0qj67_148269_c1
820 nmdc:mga0qj67_472323_c1
821 nmdc:mga06r32_98061_c1
822 nmdc:mga08y16_355442_c1
823 nmdc:mga08y16_363159_c1
824 Ga0500635_0074288
825 Ga0501084_0046595
826 Ga0501084_0624067
827 Ga0501084_0754656
828 Ga0501084_1049066
829 Ga0501082_0010154
830 Ga0530510_0287175
831 Ga0530510_0767778
832 2537901493
833 2585318204
834 2784592716
835 2786674145
836 2809236354
837 2862391785
838 2877684604
839 2912718184
840 2954681266
841 2954682892
842 2990046306
843 2990090545
844 8008564917

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.98

PF01381

HTH_3

Helix-turn-helix

9

62

0.93

Map