F440065

General Info

Members Datasets Scaffolds Average Seq Length
421 189 842 141

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0011810|Ga0466967_0011810_5785_6183
Length 132
Sequence VSERLRLWLERDRRGAGYHLRDAATGEVVTWEDPRLRVVAVAGVSFRADAVADGSFDPGARLALVREPENEHDPQAIAIWNEERTLQAGYVPREVAAELTGDELAVSLWRAGEAGLRVLLVPAGSWVGRPRR

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
48 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
49 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
76 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
79 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
80 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
90 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
101 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
102 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
103 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
104 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
109 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
116 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
125 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
184 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
185 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.65
Rhizosphere 93.35
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0011810 3300045976 Bacteria 6642
2 Ga0070658_10013277 3300005327 Bacteria 6608
3 Ga0070683_100026006 3300005329 Bacteria 5264
4 Ga0070683_100112209 3300005329 Bacteria 2573
5 Ga0070680_100141224 3300005336 Bacteria 2020
6 Ga0070682_100024250 3300005337 Bacteria 3608
7 Ga0070682_102006857 3300005337 Unclassified 509
8 Ga0068868_100725639 3300005338 Bacteria 891
9 Ga0070660_100015612 3300005339 Bacteria 5488
10 Ga0070660_100248362 3300005339 Bacteria 1450
11 Ga0070660_100503209 3300005339 Unclassified 1008
12 Ga0070691_10788688 3300005341 Bacteria 578
13 Ga0070661_100171222 3300005344 Bacteria 1649
14 Ga0070661_100504316 3300005344 Unclassified 969
15 Ga0070692_10282368 3300005345 Bacteria 1007
16 Ga0070659_100237410 3300005366 Bacteria 1507
17 Ga0070709_10834929 3300005434 Unclassified 725
18 Ga0070709_11250683 3300005434 Unclassified 598
19 Ga0070714_100009882 3300005435 Bacteria 7523
20 Ga0070714_100023074 3300005435 Bacteria 5108
21 Ga0070714_100050993 3300005435 Bacteria 3528
22 Ga0070714_100205461 3300005435 Bacteria 1803
23 Ga0070714_100347089 3300005435 Bacteria 1393
24 Ga0070714_100414859 3300005435 Bacteria 1275
25 Ga0070714_100433461 3300005435 Unclassified 1247
26 Ga0070713_100054715 3300005436 Bacteria 3312
27 Ga0070713_100202919 3300005436 Bacteria 1791
28 Ga0070713_101350855 3300005436 Archaea 691
29 Ga0070710_10001452 3300005437 Bacteria 11178
30 Ga0070711_100402305 3300005439 Bacteria 1111
31 Ga0070711_100483788 3300005439 Bacteria 1018
32 Ga0070711_100759776 3300005439 Bacteria 820
33 Ga0070708_100295438 3300005445 Unclassified 1525
34 Ga0070662_100802562 3300005457 Bacteria 800
35 Ga0070681_10047362 3300005458 Bacteria 4297
36 Ga0070681_10365293 3300005458 Bacteria 1354
37 Ga0070681_10404949 3300005458 Bacteria 1276
38 Ga0070681_10896920 3300005458 Bacteria 805
39 Ga0070681_11373862 3300005458 Unclassified 630
40 Ga0070707_100016042 3300005468 Bacteria 7027
41 Ga0070707_100398293 3300005468 Unclassified 1337
42 Ga0070707_100437732 3300005468 Bacteria 1268
43 Ga0070698_100229458 3300005471 Bacteria 1790
44 Ga0070698_100357079 3300005471 Bacteria 1393
45 Ga0070698_100695263 3300005471 Bacteria 959
46 Ga0070679_100135010 3300005530 Bacteria 2449
47 Ga0070679_100141450 3300005530 Bacteria 2385
48 Ga0070679_100418841 3300005530 Bacteria 1285
49 Ga0070679_102068136 3300005530 Unclassified 519
50 Ga0070684_100125953 3300005535 Bacteria 2307
51 Ga0070684_100342421 3300005535 Bacteria 1375
52 Ga0070684_100626296 3300005535 Bacteria 1001
53 Ga0070684_100899012 3300005535 Unclassified 829
54 Ga0070697_101086202 3300005536 Bacteria 712
55 Ga0068853_100144102 3300005539 Bacteria 2140
56 Ga0070686_100830862 3300005544 Bacteria 747
57 Ga0070695_100295807 3300005545 Bacteria 1195
58 Ga0070704_100608787 3300005549 Bacteria 961
59 Ga0068855_100188842 3300005563 Bacteria 2325
60 Ga0068855_100208505 3300005563 Bacteria 2197
61 Ga0068855_101118425 3300005563 Bacteria 823
62 Ga0068856_100047477 3300005614 Bacteria 4229
63 Ga0068856_100388082 3300005614 Bacteria 1416
64 Ga0068856_101252577 3300005614 Bacteria 757
65 Ga0068852_100157456 3300005616 Bacteria 2117
66 Ga0068851_10371852 3300005834 Bacteria 836
67 Ga0070717_10001826 3300006028 Bacteria 14870
68 Ga0070717_10033159 3300006028 Bacteria 4165
69 Ga0070717_10119692 3300006028 Bacteria 2254
70 Ga0070716_100773253 3300006173 Bacteria 741
71 Ga0070712_100898007 3300006175 Bacteria 764
72 Ga0070712_101423601 3300006175 Bacteria 605
73 Ga0105240_10054545 3300009093 Bacteria 5009
74 Ga0105240_10204816 3300009093 Bacteria 2310
75 Ga0105238_10133692 3300009551 Bacteria 2458
76 Ga0099796_10054872 3300010159 Bacteria 1394
77 Ga0105246_10131214 3300011119 Bacteria 1872
78 Ga0157373_10659795 3300013100 Bacteria 764
79 Ga0157371_10206045 3300013102 Bacteria 1411
80 Ga0157370_10417638 3300013104 Bacteria 1234
81 Ga0157370_10568220 3300013104 Unclassified 1039
82 Ga0157370_11162695 3300013104 Archaea 697
83 Ga0157370_11604277 3300013104 Unclassified 584
84 Ga0157369_10043623 3300013105 Bacteria 4887
85 Ga0157369_10170343 3300013105 Bacteria 2294
86 Ga0157374_12263145 3300013296 Bacteria 571
87 Ga0182008_10078346 3300014497 Bacteria 1626
88 Ga0182006_1038828 3300015261 Bacteria 1881
89 Ga0182007_10018329 3300015262 Bacteria 2537
90 Ga0182005_1184138 3300015265 Bacteria 621
91 Ga0206356_10948880 3300020070 Bacteria 1466
92 Ga0206356_11375599 3300020070 Bacteria 589
93 Ga0206353_10466063 3300020082 Bacteria 1558
94 Ga0207692_11098109 3300025898 Unclassified 527
95 Ga0207699_10501828 3300025906 Unclassified 876
96 Ga0207699_10631668 3300025906 Unclassified 781
97 Ga0207699_10705456 3300025906 Unclassified 739
98 Ga0207705_10091457 3300025909 Bacteria 2228
99 Ga0207705_10128114 3300025909 Bacteria 1887
100 Ga0207705_10268969 3300025909 Bacteria 1303
101 Ga0207707_10078994 3300025912 Bacteria 2873
102 Ga0207707_10142209 3300025912 Bacteria 2098
103 Ga0207707_10208354 3300025912 Bacteria 1703
104 Ga0207707_10399480 3300025912 Bacteria 1180
105 Ga0207707_10618982 3300025912 Bacteria 915
106 Ga0207707_10633566 3300025912 Bacteria 902
107 Ga0207707_10714809 3300025912 Bacteria 840
108 Ga0207695_10189770 3300025913 Bacteria 1973
109 Ga0207693_10005758 3300025915 Bacteria 10283
110 Ga0207693_10376116 3300025915 Unclassified 1111
111 Ga0207693_10453146 3300025915 Bacteria 1002
112 Ga0207660_10068908 3300025917 Bacteria 2567
113 Ga0207660_10968601 3300025917 Bacteria 694
114 Ga0207657_10008996 3300025919 Bacteria 10085
115 Ga0207657_10013576 3300025919 Bacteria 7990
116 Ga0207657_10037374 3300025919 Bacteria 4336
117 Ga0207649_10118726 3300025920 Bacteria 1780
118 Ga0207649_10382640 3300025920 Bacteria 1049
119 Ga0207649_10498930 3300025920 Bacteria 925
120 Ga0207652_10148896 3300025921 Bacteria 2095
121 Ga0207652_10225946 3300025921 Unclassified 1687
122 Ga0207652_10707795 3300025921 Bacteria 898
123 Ga0207652_10794592 3300025921 Unclassified 840
124 Ga0207646_10006636 3300025922 Bacteria 11933
125 Ga0207646_10864408 3300025922 Unclassified 803
126 Ga0207687_10936980 3300025927 Bacteria 742
127 Ga0207700_10034468 3300025928 Bacteria 3634
128 Ga0207700_11032258 3300025928 Bacteria 736
129 Ga0207664_10085061 3300025929 Bacteria 2580
130 Ga0207664_10109334 3300025929 Bacteria 2297
131 Ga0207664_10210216 3300025929 Bacteria 1683
132 Ga0207664_10369041 3300025929 Bacteria 1273
133 Ga0207664_10732791 3300025929 Bacteria 889
134 Ga0207664_10838921 3300025929 Bacteria 826
135 Ga0207664_11598430 3300025929 Unclassified 574
136 Ga0207664_11629452 3300025929 Bacteria 567
137 Ga0207690_10289793 3300025932 Bacteria 1277
138 Ga0207665_10838352 3300025939 Unclassified 727
139 Ga0207661_10054300 3300025944 Bacteria 3209
140 Ga0207661_10077804 3300025944 Bacteria 2729
141 Ga0207661_10337357 3300025944 Bacteria 1358
142 Ga0207667_11466866 3300025949 Bacteria 654
143 Ga0207667_11648048 3300025949 Bacteria 609
144 Ga0207677_11204134 3300026023 Bacteria 693
145 Ga0207639_10135378 3300026041 Bacteria 2045
146 Ga0207702_10102276 3300026078 Bacteria 2532
147 Ga0207702_10157184 3300026078 Bacteria 2073
148 Ga0207702_10980390 3300026078 Archaea 838
149 Ga0207674_10168377 3300026116 Bacteria 2145
150 Ga0207683_10297111 3300026121 Bacteria 1477
151 Ga0207698_10535646 3300026142 Bacteria 1145
152 Ga0207698_10556890 3300026142 Unclassified 1125
153 Ga0207698_10969266 3300026142 Bacteria 860
154 Ga0265337_1031919 3300028556 Bacteria 1561
155 Ga0265319_1022875 3300028563 Bacteria 2270
156 Ga0265318_10044467 3300028577 Bacteria 1680
157 Ga0265322_10130612 3300028654 Unclassified 716
158 Ga0265338_10035512 3300028800 Bacteria 4789
159 Ga0265328_10300304 3300031239 Unclassified 620
160 Ga0265329_10027711 3300031242 Bacteria 1861
161 Ga0265331_10056294 3300031250 Bacteria 1868
162 Ga0265316_10014382 3300031344 Bacteria 6969
163 Ga0265316_10323512 3300031344 Unclassified 1120
164 Ga0265342_10051361 3300031712 Bacteria 2460
165 Ga0307405_10158354 3300031731 Bacteria 1601
166 Ga0307410_10626836 3300031852 Bacteria 900
167 Ga0307406_10208403 3300031901 Bacteria 1444
168 Ga0307412_10252914 3300031911 Bacteria 1369
169 Ga0307409_100081772 3300031995 Bacteria 2612
170 Ga0307416_100070884 3300032002 Bacteria 2892
171 Ga0307411_10386084 3300032005 Bacteria 1153
172 Ga0307415_100347255 3300032126 Bacteria 1247
173 Ga0373955_0098532 3300035172 Bacteria 1675
174 Ga0373935_0438453 3300035692 Bacteria 942
175 Ga0373947_0918825 3300035725 Bacteria 597
176 Ga0373937_0001932 3300036401 Bacteria 17334
177 Ga0373937_0583906 3300036401 Bacteria 1061
178 Ga0395899_0157162 3300037312 Unclassified 1608
179 Ga0395900_0101725 3300037418 Bacteria 2951
180 Ga0395900_0188972 3300037418 Bacteria 2090
181 Ga0395900_1341608 3300037418 Bacteria 629
182 Ga0395898_0460649 3300037466 Unclassified 1210
183 Ga0395898_0475879 3300037466 Bacteria 1188
184 Ga0395898_0728504 3300037466 Bacteria 933
185 Ga0395898_1116132 3300037466 Bacteria 722
186 Ga0395898_1296546 3300037466 Unclassified 658
187 Ga0395901_0096054 3300038443 Bacteria 3106
188 Ga0395901_0303201 3300038443 Bacteria 1656
189 Ga0395901_1564383 3300038443 Unclassified 614
190 Ga0466969_0008773 3300044656 Bacteria 5360
191 Ga0466969_0221225 3300044656 Bacteria 861
192 Ga0453683_0465630 3300044673 Unclassified 818
193 Ga0466965_0074205 3300044683 Bacteria 1714
194 Ga0466966_0122308 3300044684 Unclassified 1598
195 Ga0466966_0123034 3300044684 Bacteria 1592
196 Ga0466966_0297871 3300044684 Bacteria 969
197 Ga0466961_0024550 3300044693 Bacteria 3878
198 Ga0466961_0028308 3300044693 Bacteria 3602
199 Ga0466961_0029746 3300044693 Bacteria 3509
200 Ga0466961_0073999 3300044693 Bacteria 2160
201 Ga0466961_0192081 3300044693 Bacteria 1265
202 Ga0466963_0000538 3300044694 Bacteria 17823
203 Ga0466963_0004904 3300044694 Bacteria 7803
204 Ga0466963_0008189 3300044694 Bacteria 6263
205 Ga0466963_0008395 3300044694 Bacteria 6187
206 Ga0466963_0024151 3300044694 Bacteria 3868
207 Ga0466963_0049877 3300044694 Bacteria 2769
208 Ga0466963_0057209 3300044694 Bacteria 2596
209 Ga0466963_0134445 3300044694 Bacteria 1710
210 Ga0466963_0254266 3300044694 Bacteria 1233
211 Ga0466963_0295824 3300044694 Bacteria 1138
212 Ga0466963_0305288 3300044694 Bacteria 1119
213 Ga0466963_0308159 3300044694 Unclassified 1114
214 Ga0466963_0370749 3300044694 Unclassified 1009
215 Ga0466963_0526729 3300044694 Bacteria 834
216 Ga0466963_0679774 3300044694 Bacteria 726
217 Ga0466964_0028509 3300044706 Bacteria 2200
218 Ga0466964_0186582 3300044706 Bacteria 987
219 Ga0466971_0011658 3300044719 Bacteria 3849
220 Ga0466971_0033550 3300044719 Bacteria 2300
221 Ga0466971_0083862 3300044719 Bacteria 1455
222 Ga0466971_0139200 3300044719 Bacteria 1130
223 Ga0466971_0376495 3300044719 Bacteria 690
224 Ga0466971_0526887 3300044719 Unclassified 585
225 Ga0466968_0008437 3300044735 Bacteria 3946
226 Ga0466968_0009402 3300044735 Bacteria 3758
227 Ga0466968_0058559 3300044735 Bacteria 1658
228 Ga0466968_0084045 3300044735 Bacteria 1403
229 Ga0466968_0096764 3300044735 Bacteria 1314
230 Ga0466968_0147336 3300044735 Unclassified 1080
231 Ga0466968_0313211 3300044735 Bacteria 757
232 Ga0466970_0013719 3300044765 Bacteria 4155
233 Ga0466957_0009244 3300044842 Bacteria 5623
234 Ga0466957_0016346 3300044842 Bacteria 4340
235 Ga0466957_0042799 3300044842 Bacteria 2741
236 Ga0466957_0055261 3300044842 Bacteria 2426
237 Ga0466957_0068666 3300044842 Bacteria 2188
238 Ga0466957_0164936 3300044842 Bacteria 1440
239 Ga0466957_0309961 3300044842 Bacteria 1062
240 Ga0466957_0549265 3300044842 Bacteria 805
241 Ga0466957_0582312 3300044842 Bacteria 782
242 Ga0466957_0677637 3300044842 Bacteria 726
243 Ga0466957_1059132 3300044842 Bacteria 584
244 Ga0466960_0015600 3300044901 Bacteria 3278
245 Ga0466960_0129700 3300044901 Bacteria 1329
246 Ga0466960_0448990 3300044901 Bacteria 749
247 Ga0466959_0018863 3300045049 Bacteria 5067
248 Ga0466959_0033353 3300045049 Bacteria 3807
249 Ga0466959_0208212 3300045049 Bacteria 1359
250 Ga0466959_0328696 3300045049 Bacteria 1044
251 Ga0466958_0005324 3300045836 Bacteria 6908
252 Ga0466958_0017998 3300045836 Bacteria 4095
253 Ga0466958_0062700 3300045836 Bacteria 2266
254 Ga0466958_0064188 3300045836 Bacteria 2239
255 Ga0466958_0073093 3300045836 Bacteria 2100
256 Ga0466958_0142900 3300045836 Bacteria 1507
257 Ga0466958_0705453 3300045836 Bacteria 657
258 Ga0466958_0769023 3300045836 Unclassified 628
259 Ga0466958_0932219 3300045836 Bacteria 566
260 Ga0466967_0000193 3300045976 Bacteria 25500
261 Ga0466967_0018475 3300045976 Bacteria 5573
262 Ga0466967_0019451 3300045976 Bacteria 5459
263 Ga0466967_0022550 3300045976 Bacteria 5141
264 Ga0466967_0025630 3300045976 Bacteria 4866
265 Ga0466967_0034987 3300045976 Bacteria 4270
266 Ga0466967_0037068 3300045976 Bacteria 4169
267 Ga0466967_0086236 3300045976 Bacteria 2844
268 Ga0466967_0087241 3300045976 Bacteria 2828
269 Ga0466967_0107185 3300045976 Bacteria 2562
270 Ga0466967_0121062 3300045976 Bacteria 2418
271 Ga0466967_0144206 3300045976 Bacteria 2220
272 Ga0466967_0171504 3300045976 Bacteria 2041
273 Ga0466967_0213470 3300045976 Bacteria 1831
274 Ga0466967_0232007 3300045976 Bacteria 1757
275 Ga0466967_0746765 3300045976 Unclassified 970
276 Ga0466967_0786606 3300045976 Bacteria 944
277 Ga0466967_1006003 3300045976 Bacteria 830
278 Ga0466967_1021079 3300045976 Bacteria 823
279 Ga0466967_1755059 3300045976 Bacteria 618
280 Ga0466967_2036844 3300045976 Unclassified 570
281 Ga0466967_2038719 3300045976 Unclassified 570
282 Ga0495592_0001351 3300046454 Bacteria 16986
283 Ga0495592_0045486 3300046454 Bacteria 3275
284 Ga0495592_0085827 3300046454 Bacteria 2268
285 Ga0495603_0027918 3300046455 Bacteria 3404
286 Ga0495629_0413840 3300046459 Unclassified 915
287 Ga0495629_0452853 3300046459 Unclassified 869
288 Ga0495641_0153524 3300046461 Bacteria 1029
289 Ga0495651_0081731 3300046462 Bacteria 2438
290 Ga0495653_0019973 3300046463 Bacteria 5430
291 Ga0495653_0029950 3300046463 Bacteria 4337
292 Ga0495653_0041571 3300046463 Bacteria 3588
293 Ga0495582_0620628 3300046473 Bacteria 626
294 Ga0495639_0493175 3300046475 Unclassified 625
295 Ga0495664_0287559 3300046477 Bacteria 993
296 Ga0495584_0044852 3300046491 Bacteria 2231
297 Ga0495608_0007708 3300046511 Bacteria 7586
298 Ga0495608_0089386 3300046511 Bacteria 1994
299 Ga0495608_0147136 3300046511 Bacteria 1502
300 Ga0495618_0000680 3300046514 Bacteria 23842
301 Ga0495618_0028954 3300046514 Bacteria 3454
302 Ga0495618_0246038 3300046514 Bacteria 1123
303 Ga0495618_0908604 3300046514 Bacteria 508
304 Ga0495628_0086007 3300046516 Bacteria 2438
305 Ga0495628_0142823 3300046516 Bacteria 1826
306 Ga0495630_0052272 3300046517 Bacteria 3058
307 Ga0495630_0257714 3300046517 Bacteria 1332
308 Ga0495630_0275491 3300046517 Bacteria 1285
309 Ga0495630_0303118 3300046517 Bacteria 1221
310 Ga0495644_0140753 3300046523 Bacteria 921
311 Ga0495652_0094486 3300046529 Bacteria 2438
312 Ga0495652_0122221 3300046529 Bacteria 2074
313 Ga0495652_0132150 3300046529 Bacteria 1974
314 Ga0495652_0527923 3300046529 Bacteria 815
315 Ga0495640_0273697 3300046533 Archaea 1053
316 Ga0495587_0018945 3300046536 Bacteria 4265
317 Ga0495587_0241628 3300046536 Bacteria 1016
318 Ga0495645_0000988 3300046543 Bacteria 19388
319 Ga0495645_0081507 3300046543 Bacteria 2321
320 Ga0495645_0158004 3300046543 Bacteria 1569
321 Ga0495667_0139008 3300046559 Unclassified 1565
322 Ga0495667_0455101 3300046559 Bacteria 804
323 Ga0495635_0046644 3300046663 Bacteria 2989
324 Ga0495635_0494735 3300046663 Bacteria 805
325 Ga0495659_0055950 3300046664 Bacteria 1447
326 Ga0495657_0053030 3300046675 Bacteria 2715
327 Ga0495657_0055599 3300046675 Bacteria 2639
328 Ga0495657_0243427 3300046675 Unclassified 1085
329 Ga0495657_0501114 3300046675 Bacteria 708
330 Ga0495657_0549197 3300046675 Unclassified 671
331 Ga0495599_0002425 3300046678 Bacteria 10859
332 Ga0495599_0004636 3300046678 Bacteria 8149
333 Ga0495599_0051143 3300046678 Bacteria 2589
334 Ga0495623_0003164 3300046679 Bacteria 10859
335 Ga0495646_0004927 3300046680 Bacteria 8431
336 Ga0495658_0159655 3300046683 Bacteria 1390
337 Ga0495669_0668811 3300046684 Unclassified 505
338 Ga0495613_0646549 3300046689 Bacteria 700
339 Ga0495624_0341905 3300046690 Bacteria 900
340 Ga0495624_0643425 3300046690 Bacteria 631
341 Ga0495600_0180057 3300046809 Unclassified 1362
342 Ga0495600_0926334 3300046809 Bacteria 513
343 Ga0495581_0669224 3300047315 Unclassified 599
344 Ga0495604_0004798 3300047317 Bacteria 10718
345 Ga0495604_0458519 3300047317 Unclassified 832
346 Ga0495674_0411481 3300047319 Unclassified 1091
347 Ga0495674_0977358 3300047319 Bacteria 650
348 Ga0495676_0993219 3300047321 Bacteria 536
349 Ga0495680_0018380 3300047322 Bacteria 5936
350 Ga0495675_0000809 3300047444 Bacteria 19282
351 Ga0495684_0046369 3300047471 Bacteria 3325
352 Ga0495684_0773463 3300047471 Unclassified 630
353 Ga0495593_0442142 3300047673 Unclassified 651
354 Ga0495602_0001857 3300048088 Bacteria 21151
355 Ga0495602_0138455 3300048088 Bacteria 1930
356 Ga0496100_0073104 3300048903 Bacteria 2294
357 Ga0496101_0422807 3300048904 Bacteria 1050
358 Ga0496102_0043389 3300048905 Bacteria 4078
359 Ga0496103_0231853 3300048906 Unclassified 1188
360 Ga0496104_0161196 3300048907 Bacteria 2151
361 Ga0496104_0258305 3300048907 Bacteria 1655
362 Ga0496105_0083123 3300048908 Bacteria 2644
363 Ga0496106_0008490 3300048909 Bacteria 7599
364 Ga0496106_0951863 3300048909 Bacteria 677
365 Ga0496107_0000240 3300048910 Bacteria 28673
366 Ga0496107_0212085 3300048910 Bacteria 1440
367 Ga0496107_0874298 3300048910 Bacteria 656
368 Ga0496108_0115249 3300048911 Bacteria 2301
369 Ga0496109_0036410 3300048912 Bacteria 4441
370 Ga0496109_0129687 3300048912 Bacteria 2353
371 Ga0496109_0144968 3300048912 Bacteria 2221
372 Ga0496109_0274061 3300048912 Unclassified 1590
373 Ga0496109_1218589 3300048912 Bacteria 689
374 Ga0496110_0709446 3300048913 Bacteria 908
375 Ga0496111_0120591 3300048914 Bacteria 1937
376 Ga0496112_0096171 3300048915 Bacteria 2932
377 Ga0496112_0233307 3300048915 Bacteria 1794
378 Ga0496113_0148730 3300048916 Bacteria 1846
379 Ga0496113_0329167 3300048916 Bacteria 1225
380 Ga0496114_0009104 3300048917 Bacteria 7871
381 Ga0496114_0036833 3300048917 Bacteria 4045
382 Ga0496114_0420803 3300048917 Bacteria 1183
383 Ga0496115_0142377 3300048918 Bacteria 1978
384 Ga0501034_0007731 3300049571 Bacteria 11431
385 Ga0501039_0839979 3300049575 Bacteria 716
386 Ga0501067_0445145 3300049583 Unclassified 723
387 Ga0501069_0044703 3300049585 Bacteria 2452
388 Ga0501069_0522231 3300049585 Unclassified 709
389 Ga0501070_0022215 3300049586 Bacteria 5315
390 Ga0501070_0028093 3300049586 Bacteria 4717
391 Ga0501072_0015839 3300049588 Bacteria 5779
392 Ga0501073_0019247 3300049589 Bacteria 4932
393 Ga0501074_0004351 3300049590 Bacteria 10114
394 Ga0501074_0007683 3300049590 Bacteria 7808
395 Ga0501079_0007912 3300049741 Bacteria 8059
396 Ga0501079_1140788 3300049741 Bacteria 614
397 Ga0501080_0002500 3300049742 Bacteria 16098
398 Ga0501080_0087252 3300049742 Bacteria 2898
399 Ga0501083_0000823 3300049744 Bacteria 20318
400 nmdc:mga05p37_1266087_c1 3300050507 Bacteria 755
401 Ga0495601_0002666 3300053077 Bacteria 10117
402 Ga0495601_0004456 3300053077 Bacteria 8089
403 Ga0495601_0368057 3300053077 Bacteria 933
404 Ga0495601_0425896 3300053077 Bacteria 859
405 Ga0495601_0520315 3300053077 Bacteria 767
406 Ga0495612_0019986 3300053078 Bacteria 2683
407 Ga0495612_0281134 3300053078 Bacteria 744
408 Ga0495595_0036797 3300053084 Bacteria 2223
409 Ga0495619_0009598 3300053085 Bacteria 6104
410 Ga0495619_0047239 3300053085 Bacteria 2834
411 Ga0495619_0051249 3300053085 Bacteria 2727
412 Ga0495619_0151665 3300053085 Bacteria 1599
413 Ga0501084_0668269 3300054114 Archaea 877
414 Ga0466962_0002314 3300061719 Bacteria 9019
415 Ga0466962_0003264 3300061719 Bacteria 7704
416 Ga0466962_0018461 3300061719 Bacteria 3355
417 Ga0466962_0041856 3300061719 Bacteria 2192
418 Ga0466962_0147215 3300061719 Bacteria 1142
419 Ga0466962_0149203 3300061719 Bacteria 1134
420 Ga0466962_0189662 3300061719 Bacteria 1003
421 Ga0530510_0645009 3300061734 Bacteria 806
422 Ga0466967_0011810
423 Ga0070658_10013277
424 Ga0070683_100026006
425 Ga0070683_100112209
426 Ga0070680_100141224
427 Ga0070682_100024250
428 Ga0070682_102006857
429 Ga0068868_100725639
430 Ga0070660_100015612
431 Ga0070660_100248362
432 Ga0070660_100503209
433 Ga0070691_10788688
434 Ga0070661_100171222
435 Ga0070661_100504316
436 Ga0070692_10282368
437 Ga0070659_100237410
438 Ga0070709_10834929
439 Ga0070709_11250683
440 Ga0070714_100009882
441 Ga0070714_100023074
442 Ga0070714_100050993
443 Ga0070714_100205461
444 Ga0070714_100347089
445 Ga0070714_100414859
446 Ga0070714_100433461
447 Ga0070713_100054715
448 Ga0070713_100202919
449 Ga0070713_101350855
450 Ga0070710_10001452
451 Ga0070711_100402305
452 Ga0070711_100483788
453 Ga0070711_100759776
454 Ga0070708_100295438
455 Ga0070662_100802562
456 Ga0070681_10047362
457 Ga0070681_10365293
458 Ga0070681_10404949
459 Ga0070681_10896920
460 Ga0070681_11373862
461 Ga0070707_100016042
462 Ga0070707_100398293
463 Ga0070707_100437732
464 Ga0070698_100229458
465 Ga0070698_100357079
466 Ga0070698_100695263
467 Ga0070679_100135010
468 Ga0070679_100141450
469 Ga0070679_100418841
470 Ga0070679_102068136
471 Ga0070684_100125953
472 Ga0070684_100342421
473 Ga0070684_100626296
474 Ga0070684_100899012
475 Ga0070697_101086202
476 Ga0068853_100144102
477 Ga0070686_100830862
478 Ga0070695_100295807
479 Ga0070704_100608787
480 Ga0068855_100188842
481 Ga0068855_100208505
482 Ga0068855_101118425
483 Ga0068856_100047477
484 Ga0068856_100388082
485 Ga0068856_101252577
486 Ga0068852_100157456
487 Ga0068851_10371852
488 Ga0070717_10001826
489 Ga0070717_10033159
490 Ga0070717_10119692
491 Ga0070716_100773253
492 Ga0070712_100898007
493 Ga0070712_101423601
494 Ga0105240_10054545
495 Ga0105240_10204816
496 Ga0105238_10133692
497 Ga0099796_10054872
498 Ga0105246_10131214
499 Ga0157373_10659795
500 Ga0157371_10206045
501 Ga0157370_10417638
502 Ga0157370_10568220
503 Ga0157370_11162695
504 Ga0157370_11604277
505 Ga0157369_10043623
506 Ga0157369_10170343
507 Ga0157374_12263145
508 Ga0182008_10078346
509 Ga0182006_1038828
510 Ga0182007_10018329
511 Ga0182005_1184138
512 Ga0206356_10948880
513 Ga0206356_11375599
514 Ga0206353_10466063
515 Ga0207692_11098109
516 Ga0207699_10501828
517 Ga0207699_10631668
518 Ga0207699_10705456
519 Ga0207705_10091457
520 Ga0207705_10128114
521 Ga0207705_10268969
522 Ga0207707_10078994
523 Ga0207707_10142209
524 Ga0207707_10208354
525 Ga0207707_10399480
526 Ga0207707_10618982
527 Ga0207707_10633566
528 Ga0207707_10714809
529 Ga0207695_10189770
530 Ga0207693_10005758
531 Ga0207693_10376116
532 Ga0207693_10453146
533 Ga0207660_10068908
534 Ga0207660_10968601
535 Ga0207657_10008996
536 Ga0207657_10013576
537 Ga0207657_10037374
538 Ga0207649_10118726
539 Ga0207649_10382640
540 Ga0207649_10498930
541 Ga0207652_10148896
542 Ga0207652_10225946
543 Ga0207652_10707795
544 Ga0207652_10794592
545 Ga0207646_10006636
546 Ga0207646_10864408
547 Ga0207687_10936980
548 Ga0207700_10034468
549 Ga0207700_11032258
550 Ga0207664_10085061
551 Ga0207664_10109334
552 Ga0207664_10210216
553 Ga0207664_10369041
554 Ga0207664_10732791
555 Ga0207664_10838921
556 Ga0207664_11598430
557 Ga0207664_11629452
558 Ga0207690_10289793
559 Ga0207665_10838352
560 Ga0207661_10054300
561 Ga0207661_10077804
562 Ga0207661_10337357
563 Ga0207667_11466866
564 Ga0207667_11648048
565 Ga0207677_11204134
566 Ga0207639_10135378
567 Ga0207702_10102276
568 Ga0207702_10157184
569 Ga0207702_10980390
570 Ga0207674_10168377
571 Ga0207683_10297111
572 Ga0207698_10535646
573 Ga0207698_10556890
574 Ga0207698_10969266
575 Ga0265337_1031919
576 Ga0265319_1022875
577 Ga0265318_10044467
578 Ga0265322_10130612
579 Ga0265338_10035512
580 Ga0265328_10300304
581 Ga0265329_10027711
582 Ga0265331_10056294
583 Ga0265316_10014382
584 Ga0265316_10323512
585 Ga0265342_10051361
586 Ga0307405_10158354
587 Ga0307410_10626836
588 Ga0307406_10208403
589 Ga0307412_10252914
590 Ga0307409_100081772
591 Ga0307416_100070884
592 Ga0307411_10386084
593 Ga0307415_100347255
594 Ga0373955_0098532
595 Ga0373935_0438453
596 Ga0373947_0918825
597 Ga0373937_0001932
598 Ga0373937_0583906
599 Ga0395899_0157162
600 Ga0395900_0101725
601 Ga0395900_0188972
602 Ga0395900_1341608
603 Ga0395898_0460649
604 Ga0395898_0475879
605 Ga0395898_0728504
606 Ga0395898_1116132
607 Ga0395898_1296546
608 Ga0395901_0096054
609 Ga0395901_0303201
610 Ga0395901_1564383
611 Ga0466969_0008773
612 Ga0466969_0221225
613 Ga0453683_0465630
614 Ga0466965_0074205
615 Ga0466966_0122308
616 Ga0466966_0123034
617 Ga0466966_0297871
618 Ga0466961_0024550
619 Ga0466961_0028308
620 Ga0466961_0029746
621 Ga0466961_0073999
622 Ga0466961_0192081
623 Ga0466963_0000538
624 Ga0466963_0004904
625 Ga0466963_0008189
626 Ga0466963_0008395
627 Ga0466963_0024151
628 Ga0466963_0049877
629 Ga0466963_0057209
630 Ga0466963_0134445
631 Ga0466963_0254266
632 Ga0466963_0295824
633 Ga0466963_0305288
634 Ga0466963_0308159
635 Ga0466963_0370749
636 Ga0466963_0526729
637 Ga0466963_0679774
638 Ga0466964_0028509
639 Ga0466964_0186582
640 Ga0466971_0011658
641 Ga0466971_0033550
642 Ga0466971_0083862
643 Ga0466971_0139200
644 Ga0466971_0376495
645 Ga0466971_0526887
646 Ga0466968_0008437
647 Ga0466968_0009402
648 Ga0466968_0058559
649 Ga0466968_0084045
650 Ga0466968_0096764
651 Ga0466968_0147336
652 Ga0466968_0313211
653 Ga0466970_0013719
654 Ga0466957_0009244
655 Ga0466957_0016346
656 Ga0466957_0042799
657 Ga0466957_0055261
658 Ga0466957_0068666
659 Ga0466957_0164936
660 Ga0466957_0309961
661 Ga0466957_0549265
662 Ga0466957_0582312
663 Ga0466957_0677637
664 Ga0466957_1059132
665 Ga0466960_0015600
666 Ga0466960_0129700
667 Ga0466960_0448990
668 Ga0466959_0018863
669 Ga0466959_0033353
670 Ga0466959_0208212
671 Ga0466959_0328696
672 Ga0466958_0005324
673 Ga0466958_0017998
674 Ga0466958_0062700
675 Ga0466958_0064188
676 Ga0466958_0073093
677 Ga0466958_0142900
678 Ga0466958_0705453
679 Ga0466958_0769023
680 Ga0466958_0932219
681 Ga0466967_0000193
682 Ga0466967_0018475
683 Ga0466967_0019451
684 Ga0466967_0022550
685 Ga0466967_0025630
686 Ga0466967_0034987
687 Ga0466967_0037068
688 Ga0466967_0086236
689 Ga0466967_0087241
690 Ga0466967_0107185
691 Ga0466967_0121062
692 Ga0466967_0144206
693 Ga0466967_0171504
694 Ga0466967_0213470
695 Ga0466967_0232007
696 Ga0466967_0746765
697 Ga0466967_0786606
698 Ga0466967_1006003
699 Ga0466967_1021079
700 Ga0466967_1755059
701 Ga0466967_2036844
702 Ga0466967_2038719
703 Ga0495592_0001351
704 Ga0495592_0045486
705 Ga0495592_0085827
706 Ga0495603_0027918
707 Ga0495629_0413840
708 Ga0495629_0452853
709 Ga0495641_0153524
710 Ga0495651_0081731
711 Ga0495653_0019973
712 Ga0495653_0029950
713 Ga0495653_0041571
714 Ga0495582_0620628
715 Ga0495639_0493175
716 Ga0495664_0287559
717 Ga0495584_0044852
718 Ga0495608_0007708
719 Ga0495608_0089386
720 Ga0495608_0147136
721 Ga0495618_0000680
722 Ga0495618_0028954
723 Ga0495618_0246038
724 Ga0495618_0908604
725 Ga0495628_0086007
726 Ga0495628_0142823
727 Ga0495630_0052272
728 Ga0495630_0257714
729 Ga0495630_0275491
730 Ga0495630_0303118
731 Ga0495644_0140753
732 Ga0495652_0094486
733 Ga0495652_0122221
734 Ga0495652_0132150
735 Ga0495652_0527923
736 Ga0495640_0273697
737 Ga0495587_0018945
738 Ga0495587_0241628
739 Ga0495645_0000988
740 Ga0495645_0081507
741 Ga0495645_0158004
742 Ga0495667_0139008
743 Ga0495667_0455101
744 Ga0495635_0046644
745 Ga0495635_0494735
746 Ga0495659_0055950
747 Ga0495657_0053030
748 Ga0495657_0055599
749 Ga0495657_0243427
750 Ga0495657_0501114
751 Ga0495657_0549197
752 Ga0495599_0002425
753 Ga0495599_0004636
754 Ga0495599_0051143
755 Ga0495623_0003164
756 Ga0495646_0004927
757 Ga0495658_0159655
758 Ga0495669_0668811
759 Ga0495613_0646549
760 Ga0495624_0341905
761 Ga0495624_0643425
762 Ga0495600_0180057
763 Ga0495600_0926334
764 Ga0495581_0669224
765 Ga0495604_0004798
766 Ga0495604_0458519
767 Ga0495674_0411481
768 Ga0495674_0977358
769 Ga0495676_0993219
770 Ga0495680_0018380
771 Ga0495675_0000809
772 Ga0495684_0046369
773 Ga0495684_0773463
774 Ga0495593_0442142
775 Ga0495602_0001857
776 Ga0495602_0138455
777 Ga0496100_0073104
778 Ga0496101_0422807
779 Ga0496102_0043389
780 Ga0496103_0231853
781 Ga0496104_0161196
782 Ga0496104_0258305
783 Ga0496105_0083123
784 Ga0496106_0008490
785 Ga0496106_0951863
786 Ga0496107_0000240
787 Ga0496107_0212085
788 Ga0496107_0874298
789 Ga0496108_0115249
790 Ga0496109_0036410
791 Ga0496109_0129687
792 Ga0496109_0144968
793 Ga0496109_0274061
794 Ga0496109_1218589
795 Ga0496110_0709446
796 Ga0496111_0120591
797 Ga0496112_0096171
798 Ga0496112_0233307
799 Ga0496113_0148730
800 Ga0496113_0329167
801 Ga0496114_0009104
802 Ga0496114_0036833
803 Ga0496114_0420803
804 Ga0496115_0142377
805 Ga0501034_0007731
806 Ga0501039_0839979
807 Ga0501067_0445145
808 Ga0501069_0044703
809 Ga0501069_0522231
810 Ga0501070_0022215
811 Ga0501070_0028093
812 Ga0501072_0015839
813 Ga0501073_0019247
814 Ga0501074_0004351
815 Ga0501074_0007683
816 Ga0501079_0007912
817 Ga0501079_1140788
818 Ga0501080_0002500
819 Ga0501080_0087252
820 Ga0501083_0000823
821 nmdc:mga05p37_1266087_c1
822 Ga0495601_0002666
823 Ga0495601_0004456
824 Ga0495601_0368057
825 Ga0495601_0425896
826 Ga0495601_0520315
827 Ga0495612_0019986
828 Ga0495612_0281134
829 Ga0495595_0036797
830 Ga0495619_0009598
831 Ga0495619_0047239
832 Ga0495619_0051249
833 Ga0495619_0151665
834 Ga0501084_0668269
835 Ga0466962_0002314
836 Ga0466962_0003264
837 Ga0466962_0018461
838 Ga0466962_0041856
839 Ga0466962_0147215
840 Ga0466962_0149203
841 Ga0466962_0189662
842 Ga0530510_0645009

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08797

HIRAN

HIRAN domain

36

101

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k2y-assembly1.cif.gz_A crystal structure of protein lp_0118 from lactobacillus plantarum,northeast structural genomics consortium target lpr91b 0.6493 45 132
4xzg-assembly1.cif.gz_A crystal structure of hiran domain of human hltf 0.6284 43 132
4s0n-assembly1.cif.gz_C crystal structure of hltf hiran domain bound to dna 0.6143 43 134
4h8s-assembly1.cif.gz_A crystal structure of human appl2barph domain 0.5898 69 94
3k2y-assembly1.cif.gz_A crystal structure of protein lp_0118 from lactobacillus plantarum,northeast structural genomics consortium target lpr91b 0.5693 45 132
ID Description Score Start End Superfamily
af_K7L8Y3_129_246_3.30.70.2330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6865 43 133 3.30.70.2330
4p2bA05 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.685 106 134 2.40.240.10
af_Q4E0Y0_362_474_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.6746 106 132 2.40.240.10
af_Q5XVJ4_153_259_3.30.70.2330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6444 36 132 3.30.70.2330
3k2yD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6392 45 132 3.30.70.2330
ID Description Score Start End GO Terms
AF-A0A7W0UMG8-F1-model_v4 HIRAN domain-containing protein 0.9761 12 143 GO:0003676
GO:0008270
GO:0016818
AF-A0A537ZWG4-F1-model_v4 HIRAN domain-containing protein 0.9579 44 144 GO:0003676
GO:0008270
GO:0016818
AF-A0A7J5Y7Y0-F1-model_v4 HIRAN domain-containing protein 0.9545 66 105 GO:0003676
GO:0008270
GO:0016818
AF-A0A7W0UMG8-F1-model_v4 HIRAN domain-containing protein 0.9537 12 143 GO:0003676
GO:0008270
GO:0016818
AF-A0A1Q7WI15-F1-model_v4 HIRAN domain-containing protein 0.9407 57 143 GO:0003676
GO:0008270
GO:0016818

Map