F440065
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 421 | 189 | 842 | 141 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0011810|Ga0466967_0011810_5785_6183 |
| Length | 132 |
| Sequence | VSERLRLWLERDRRGAGYHLRDAATGEVVTWEDPRLRVVAVAGVSFRADAVADGSFDPGARLALVREPENEHDPQAIAIWNEERTLQAGYVPREVAAELTGDELAVSLWRAGEAGLRVLLVPAGSWVGRPRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 39 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 46 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 47 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 76 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 77 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 78 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 79 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 81 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 82 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 83 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 84 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 85 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 86 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 87 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 88 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 89 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 90 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 91 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 92 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 93 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 94 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 95 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 101 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 102 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 103 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 104 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 105 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 106 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 107 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 108 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 109 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 110 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 111 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 112 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 113 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 114 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 115 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 156 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 158 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 159 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 160 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 161 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 162 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 163 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 166 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 167 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 168 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 169 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 170 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 171 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 189 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.71 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.65 |
| Rhizosphere | 93.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0011810 | 3300045976 | Bacteria | 6642 |
| 2 | Ga0070658_10013277 | 3300005327 | Bacteria | 6608 |
| 3 | Ga0070683_100026006 | 3300005329 | Bacteria | 5264 |
| 4 | Ga0070683_100112209 | 3300005329 | Bacteria | 2573 |
| 5 | Ga0070680_100141224 | 3300005336 | Bacteria | 2020 |
| 6 | Ga0070682_100024250 | 3300005337 | Bacteria | 3608 |
| 7 | Ga0070682_102006857 | 3300005337 | Unclassified | 509 |
| 8 | Ga0068868_100725639 | 3300005338 | Bacteria | 891 |
| 9 | Ga0070660_100015612 | 3300005339 | Bacteria | 5488 |
| 10 | Ga0070660_100248362 | 3300005339 | Bacteria | 1450 |
| 11 | Ga0070660_100503209 | 3300005339 | Unclassified | 1008 |
| 12 | Ga0070691_10788688 | 3300005341 | Bacteria | 578 |
| 13 | Ga0070661_100171222 | 3300005344 | Bacteria | 1649 |
| 14 | Ga0070661_100504316 | 3300005344 | Unclassified | 969 |
| 15 | Ga0070692_10282368 | 3300005345 | Bacteria | 1007 |
| 16 | Ga0070659_100237410 | 3300005366 | Bacteria | 1507 |
| 17 | Ga0070709_10834929 | 3300005434 | Unclassified | 725 |
| 18 | Ga0070709_11250683 | 3300005434 | Unclassified | 598 |
| 19 | Ga0070714_100009882 | 3300005435 | Bacteria | 7523 |
| 20 | Ga0070714_100023074 | 3300005435 | Bacteria | 5108 |
| 21 | Ga0070714_100050993 | 3300005435 | Bacteria | 3528 |
| 22 | Ga0070714_100205461 | 3300005435 | Bacteria | 1803 |
| 23 | Ga0070714_100347089 | 3300005435 | Bacteria | 1393 |
| 24 | Ga0070714_100414859 | 3300005435 | Bacteria | 1275 |
| 25 | Ga0070714_100433461 | 3300005435 | Unclassified | 1247 |
| 26 | Ga0070713_100054715 | 3300005436 | Bacteria | 3312 |
| 27 | Ga0070713_100202919 | 3300005436 | Bacteria | 1791 |
| 28 | Ga0070713_101350855 | 3300005436 | Archaea | 691 |
| 29 | Ga0070710_10001452 | 3300005437 | Bacteria | 11178 |
| 30 | Ga0070711_100402305 | 3300005439 | Bacteria | 1111 |
| 31 | Ga0070711_100483788 | 3300005439 | Bacteria | 1018 |
| 32 | Ga0070711_100759776 | 3300005439 | Bacteria | 820 |
| 33 | Ga0070708_100295438 | 3300005445 | Unclassified | 1525 |
| 34 | Ga0070662_100802562 | 3300005457 | Bacteria | 800 |
| 35 | Ga0070681_10047362 | 3300005458 | Bacteria | 4297 |
| 36 | Ga0070681_10365293 | 3300005458 | Bacteria | 1354 |
| 37 | Ga0070681_10404949 | 3300005458 | Bacteria | 1276 |
| 38 | Ga0070681_10896920 | 3300005458 | Bacteria | 805 |
| 39 | Ga0070681_11373862 | 3300005458 | Unclassified | 630 |
| 40 | Ga0070707_100016042 | 3300005468 | Bacteria | 7027 |
| 41 | Ga0070707_100398293 | 3300005468 | Unclassified | 1337 |
| 42 | Ga0070707_100437732 | 3300005468 | Bacteria | 1268 |
| 43 | Ga0070698_100229458 | 3300005471 | Bacteria | 1790 |
| 44 | Ga0070698_100357079 | 3300005471 | Bacteria | 1393 |
| 45 | Ga0070698_100695263 | 3300005471 | Bacteria | 959 |
| 46 | Ga0070679_100135010 | 3300005530 | Bacteria | 2449 |
| 47 | Ga0070679_100141450 | 3300005530 | Bacteria | 2385 |
| 48 | Ga0070679_100418841 | 3300005530 | Bacteria | 1285 |
| 49 | Ga0070679_102068136 | 3300005530 | Unclassified | 519 |
| 50 | Ga0070684_100125953 | 3300005535 | Bacteria | 2307 |
| 51 | Ga0070684_100342421 | 3300005535 | Bacteria | 1375 |
| 52 | Ga0070684_100626296 | 3300005535 | Bacteria | 1001 |
| 53 | Ga0070684_100899012 | 3300005535 | Unclassified | 829 |
| 54 | Ga0070697_101086202 | 3300005536 | Bacteria | 712 |
| 55 | Ga0068853_100144102 | 3300005539 | Bacteria | 2140 |
| 56 | Ga0070686_100830862 | 3300005544 | Bacteria | 747 |
| 57 | Ga0070695_100295807 | 3300005545 | Bacteria | 1195 |
| 58 | Ga0070704_100608787 | 3300005549 | Bacteria | 961 |
| 59 | Ga0068855_100188842 | 3300005563 | Bacteria | 2325 |
| 60 | Ga0068855_100208505 | 3300005563 | Bacteria | 2197 |
| 61 | Ga0068855_101118425 | 3300005563 | Bacteria | 823 |
| 62 | Ga0068856_100047477 | 3300005614 | Bacteria | 4229 |
| 63 | Ga0068856_100388082 | 3300005614 | Bacteria | 1416 |
| 64 | Ga0068856_101252577 | 3300005614 | Bacteria | 757 |
| 65 | Ga0068852_100157456 | 3300005616 | Bacteria | 2117 |
| 66 | Ga0068851_10371852 | 3300005834 | Bacteria | 836 |
| 67 | Ga0070717_10001826 | 3300006028 | Bacteria | 14870 |
| 68 | Ga0070717_10033159 | 3300006028 | Bacteria | 4165 |
| 69 | Ga0070717_10119692 | 3300006028 | Bacteria | 2254 |
| 70 | Ga0070716_100773253 | 3300006173 | Bacteria | 741 |
| 71 | Ga0070712_100898007 | 3300006175 | Bacteria | 764 |
| 72 | Ga0070712_101423601 | 3300006175 | Bacteria | 605 |
| 73 | Ga0105240_10054545 | 3300009093 | Bacteria | 5009 |
| 74 | Ga0105240_10204816 | 3300009093 | Bacteria | 2310 |
| 75 | Ga0105238_10133692 | 3300009551 | Bacteria | 2458 |
| 76 | Ga0099796_10054872 | 3300010159 | Bacteria | 1394 |
| 77 | Ga0105246_10131214 | 3300011119 | Bacteria | 1872 |
| 78 | Ga0157373_10659795 | 3300013100 | Bacteria | 764 |
| 79 | Ga0157371_10206045 | 3300013102 | Bacteria | 1411 |
| 80 | Ga0157370_10417638 | 3300013104 | Bacteria | 1234 |
| 81 | Ga0157370_10568220 | 3300013104 | Unclassified | 1039 |
| 82 | Ga0157370_11162695 | 3300013104 | Archaea | 697 |
| 83 | Ga0157370_11604277 | 3300013104 | Unclassified | 584 |
| 84 | Ga0157369_10043623 | 3300013105 | Bacteria | 4887 |
| 85 | Ga0157369_10170343 | 3300013105 | Bacteria | 2294 |
| 86 | Ga0157374_12263145 | 3300013296 | Bacteria | 571 |
| 87 | Ga0182008_10078346 | 3300014497 | Bacteria | 1626 |
| 88 | Ga0182006_1038828 | 3300015261 | Bacteria | 1881 |
| 89 | Ga0182007_10018329 | 3300015262 | Bacteria | 2537 |
| 90 | Ga0182005_1184138 | 3300015265 | Bacteria | 621 |
| 91 | Ga0206356_10948880 | 3300020070 | Bacteria | 1466 |
| 92 | Ga0206356_11375599 | 3300020070 | Bacteria | 589 |
| 93 | Ga0206353_10466063 | 3300020082 | Bacteria | 1558 |
| 94 | Ga0207692_11098109 | 3300025898 | Unclassified | 527 |
| 95 | Ga0207699_10501828 | 3300025906 | Unclassified | 876 |
| 96 | Ga0207699_10631668 | 3300025906 | Unclassified | 781 |
| 97 | Ga0207699_10705456 | 3300025906 | Unclassified | 739 |
| 98 | Ga0207705_10091457 | 3300025909 | Bacteria | 2228 |
| 99 | Ga0207705_10128114 | 3300025909 | Bacteria | 1887 |
| 100 | Ga0207705_10268969 | 3300025909 | Bacteria | 1303 |
| 101 | Ga0207707_10078994 | 3300025912 | Bacteria | 2873 |
| 102 | Ga0207707_10142209 | 3300025912 | Bacteria | 2098 |
| 103 | Ga0207707_10208354 | 3300025912 | Bacteria | 1703 |
| 104 | Ga0207707_10399480 | 3300025912 | Bacteria | 1180 |
| 105 | Ga0207707_10618982 | 3300025912 | Bacteria | 915 |
| 106 | Ga0207707_10633566 | 3300025912 | Bacteria | 902 |
| 107 | Ga0207707_10714809 | 3300025912 | Bacteria | 840 |
| 108 | Ga0207695_10189770 | 3300025913 | Bacteria | 1973 |
| 109 | Ga0207693_10005758 | 3300025915 | Bacteria | 10283 |
| 110 | Ga0207693_10376116 | 3300025915 | Unclassified | 1111 |
| 111 | Ga0207693_10453146 | 3300025915 | Bacteria | 1002 |
| 112 | Ga0207660_10068908 | 3300025917 | Bacteria | 2567 |
| 113 | Ga0207660_10968601 | 3300025917 | Bacteria | 694 |
| 114 | Ga0207657_10008996 | 3300025919 | Bacteria | 10085 |
| 115 | Ga0207657_10013576 | 3300025919 | Bacteria | 7990 |
| 116 | Ga0207657_10037374 | 3300025919 | Bacteria | 4336 |
| 117 | Ga0207649_10118726 | 3300025920 | Bacteria | 1780 |
| 118 | Ga0207649_10382640 | 3300025920 | Bacteria | 1049 |
| 119 | Ga0207649_10498930 | 3300025920 | Bacteria | 925 |
| 120 | Ga0207652_10148896 | 3300025921 | Bacteria | 2095 |
| 121 | Ga0207652_10225946 | 3300025921 | Unclassified | 1687 |
| 122 | Ga0207652_10707795 | 3300025921 | Bacteria | 898 |
| 123 | Ga0207652_10794592 | 3300025921 | Unclassified | 840 |
| 124 | Ga0207646_10006636 | 3300025922 | Bacteria | 11933 |
| 125 | Ga0207646_10864408 | 3300025922 | Unclassified | 803 |
| 126 | Ga0207687_10936980 | 3300025927 | Bacteria | 742 |
| 127 | Ga0207700_10034468 | 3300025928 | Bacteria | 3634 |
| 128 | Ga0207700_11032258 | 3300025928 | Bacteria | 736 |
| 129 | Ga0207664_10085061 | 3300025929 | Bacteria | 2580 |
| 130 | Ga0207664_10109334 | 3300025929 | Bacteria | 2297 |
| 131 | Ga0207664_10210216 | 3300025929 | Bacteria | 1683 |
| 132 | Ga0207664_10369041 | 3300025929 | Bacteria | 1273 |
| 133 | Ga0207664_10732791 | 3300025929 | Bacteria | 889 |
| 134 | Ga0207664_10838921 | 3300025929 | Bacteria | 826 |
| 135 | Ga0207664_11598430 | 3300025929 | Unclassified | 574 |
| 136 | Ga0207664_11629452 | 3300025929 | Bacteria | 567 |
| 137 | Ga0207690_10289793 | 3300025932 | Bacteria | 1277 |
| 138 | Ga0207665_10838352 | 3300025939 | Unclassified | 727 |
| 139 | Ga0207661_10054300 | 3300025944 | Bacteria | 3209 |
| 140 | Ga0207661_10077804 | 3300025944 | Bacteria | 2729 |
| 141 | Ga0207661_10337357 | 3300025944 | Bacteria | 1358 |
| 142 | Ga0207667_11466866 | 3300025949 | Bacteria | 654 |
| 143 | Ga0207667_11648048 | 3300025949 | Bacteria | 609 |
| 144 | Ga0207677_11204134 | 3300026023 | Bacteria | 693 |
| 145 | Ga0207639_10135378 | 3300026041 | Bacteria | 2045 |
| 146 | Ga0207702_10102276 | 3300026078 | Bacteria | 2532 |
| 147 | Ga0207702_10157184 | 3300026078 | Bacteria | 2073 |
| 148 | Ga0207702_10980390 | 3300026078 | Archaea | 838 |
| 149 | Ga0207674_10168377 | 3300026116 | Bacteria | 2145 |
| 150 | Ga0207683_10297111 | 3300026121 | Bacteria | 1477 |
| 151 | Ga0207698_10535646 | 3300026142 | Bacteria | 1145 |
| 152 | Ga0207698_10556890 | 3300026142 | Unclassified | 1125 |
| 153 | Ga0207698_10969266 | 3300026142 | Bacteria | 860 |
| 154 | Ga0265337_1031919 | 3300028556 | Bacteria | 1561 |
| 155 | Ga0265319_1022875 | 3300028563 | Bacteria | 2270 |
| 156 | Ga0265318_10044467 | 3300028577 | Bacteria | 1680 |
| 157 | Ga0265322_10130612 | 3300028654 | Unclassified | 716 |
| 158 | Ga0265338_10035512 | 3300028800 | Bacteria | 4789 |
| 159 | Ga0265328_10300304 | 3300031239 | Unclassified | 620 |
| 160 | Ga0265329_10027711 | 3300031242 | Bacteria | 1861 |
| 161 | Ga0265331_10056294 | 3300031250 | Bacteria | 1868 |
| 162 | Ga0265316_10014382 | 3300031344 | Bacteria | 6969 |
| 163 | Ga0265316_10323512 | 3300031344 | Unclassified | 1120 |
| 164 | Ga0265342_10051361 | 3300031712 | Bacteria | 2460 |
| 165 | Ga0307405_10158354 | 3300031731 | Bacteria | 1601 |
| 166 | Ga0307410_10626836 | 3300031852 | Bacteria | 900 |
| 167 | Ga0307406_10208403 | 3300031901 | Bacteria | 1444 |
| 168 | Ga0307412_10252914 | 3300031911 | Bacteria | 1369 |
| 169 | Ga0307409_100081772 | 3300031995 | Bacteria | 2612 |
| 170 | Ga0307416_100070884 | 3300032002 | Bacteria | 2892 |
| 171 | Ga0307411_10386084 | 3300032005 | Bacteria | 1153 |
| 172 | Ga0307415_100347255 | 3300032126 | Bacteria | 1247 |
| 173 | Ga0373955_0098532 | 3300035172 | Bacteria | 1675 |
| 174 | Ga0373935_0438453 | 3300035692 | Bacteria | 942 |
| 175 | Ga0373947_0918825 | 3300035725 | Bacteria | 597 |
| 176 | Ga0373937_0001932 | 3300036401 | Bacteria | 17334 |
| 177 | Ga0373937_0583906 | 3300036401 | Bacteria | 1061 |
| 178 | Ga0395899_0157162 | 3300037312 | Unclassified | 1608 |
| 179 | Ga0395900_0101725 | 3300037418 | Bacteria | 2951 |
| 180 | Ga0395900_0188972 | 3300037418 | Bacteria | 2090 |
| 181 | Ga0395900_1341608 | 3300037418 | Bacteria | 629 |
| 182 | Ga0395898_0460649 | 3300037466 | Unclassified | 1210 |
| 183 | Ga0395898_0475879 | 3300037466 | Bacteria | 1188 |
| 184 | Ga0395898_0728504 | 3300037466 | Bacteria | 933 |
| 185 | Ga0395898_1116132 | 3300037466 | Bacteria | 722 |
| 186 | Ga0395898_1296546 | 3300037466 | Unclassified | 658 |
| 187 | Ga0395901_0096054 | 3300038443 | Bacteria | 3106 |
| 188 | Ga0395901_0303201 | 3300038443 | Bacteria | 1656 |
| 189 | Ga0395901_1564383 | 3300038443 | Unclassified | 614 |
| 190 | Ga0466969_0008773 | 3300044656 | Bacteria | 5360 |
| 191 | Ga0466969_0221225 | 3300044656 | Bacteria | 861 |
| 192 | Ga0453683_0465630 | 3300044673 | Unclassified | 818 |
| 193 | Ga0466965_0074205 | 3300044683 | Bacteria | 1714 |
| 194 | Ga0466966_0122308 | 3300044684 | Unclassified | 1598 |
| 195 | Ga0466966_0123034 | 3300044684 | Bacteria | 1592 |
| 196 | Ga0466966_0297871 | 3300044684 | Bacteria | 969 |
| 197 | Ga0466961_0024550 | 3300044693 | Bacteria | 3878 |
| 198 | Ga0466961_0028308 | 3300044693 | Bacteria | 3602 |
| 199 | Ga0466961_0029746 | 3300044693 | Bacteria | 3509 |
| 200 | Ga0466961_0073999 | 3300044693 | Bacteria | 2160 |
| 201 | Ga0466961_0192081 | 3300044693 | Bacteria | 1265 |
| 202 | Ga0466963_0000538 | 3300044694 | Bacteria | 17823 |
| 203 | Ga0466963_0004904 | 3300044694 | Bacteria | 7803 |
| 204 | Ga0466963_0008189 | 3300044694 | Bacteria | 6263 |
| 205 | Ga0466963_0008395 | 3300044694 | Bacteria | 6187 |
| 206 | Ga0466963_0024151 | 3300044694 | Bacteria | 3868 |
| 207 | Ga0466963_0049877 | 3300044694 | Bacteria | 2769 |
| 208 | Ga0466963_0057209 | 3300044694 | Bacteria | 2596 |
| 209 | Ga0466963_0134445 | 3300044694 | Bacteria | 1710 |
| 210 | Ga0466963_0254266 | 3300044694 | Bacteria | 1233 |
| 211 | Ga0466963_0295824 | 3300044694 | Bacteria | 1138 |
| 212 | Ga0466963_0305288 | 3300044694 | Bacteria | 1119 |
| 213 | Ga0466963_0308159 | 3300044694 | Unclassified | 1114 |
| 214 | Ga0466963_0370749 | 3300044694 | Unclassified | 1009 |
| 215 | Ga0466963_0526729 | 3300044694 | Bacteria | 834 |
| 216 | Ga0466963_0679774 | 3300044694 | Bacteria | 726 |
| 217 | Ga0466964_0028509 | 3300044706 | Bacteria | 2200 |
| 218 | Ga0466964_0186582 | 3300044706 | Bacteria | 987 |
| 219 | Ga0466971_0011658 | 3300044719 | Bacteria | 3849 |
| 220 | Ga0466971_0033550 | 3300044719 | Bacteria | 2300 |
| 221 | Ga0466971_0083862 | 3300044719 | Bacteria | 1455 |
| 222 | Ga0466971_0139200 | 3300044719 | Bacteria | 1130 |
| 223 | Ga0466971_0376495 | 3300044719 | Bacteria | 690 |
| 224 | Ga0466971_0526887 | 3300044719 | Unclassified | 585 |
| 225 | Ga0466968_0008437 | 3300044735 | Bacteria | 3946 |
| 226 | Ga0466968_0009402 | 3300044735 | Bacteria | 3758 |
| 227 | Ga0466968_0058559 | 3300044735 | Bacteria | 1658 |
| 228 | Ga0466968_0084045 | 3300044735 | Bacteria | 1403 |
| 229 | Ga0466968_0096764 | 3300044735 | Bacteria | 1314 |
| 230 | Ga0466968_0147336 | 3300044735 | Unclassified | 1080 |
| 231 | Ga0466968_0313211 | 3300044735 | Bacteria | 757 |
| 232 | Ga0466970_0013719 | 3300044765 | Bacteria | 4155 |
| 233 | Ga0466957_0009244 | 3300044842 | Bacteria | 5623 |
| 234 | Ga0466957_0016346 | 3300044842 | Bacteria | 4340 |
| 235 | Ga0466957_0042799 | 3300044842 | Bacteria | 2741 |
| 236 | Ga0466957_0055261 | 3300044842 | Bacteria | 2426 |
| 237 | Ga0466957_0068666 | 3300044842 | Bacteria | 2188 |
| 238 | Ga0466957_0164936 | 3300044842 | Bacteria | 1440 |
| 239 | Ga0466957_0309961 | 3300044842 | Bacteria | 1062 |
| 240 | Ga0466957_0549265 | 3300044842 | Bacteria | 805 |
| 241 | Ga0466957_0582312 | 3300044842 | Bacteria | 782 |
| 242 | Ga0466957_0677637 | 3300044842 | Bacteria | 726 |
| 243 | Ga0466957_1059132 | 3300044842 | Bacteria | 584 |
| 244 | Ga0466960_0015600 | 3300044901 | Bacteria | 3278 |
| 245 | Ga0466960_0129700 | 3300044901 | Bacteria | 1329 |
| 246 | Ga0466960_0448990 | 3300044901 | Bacteria | 749 |
| 247 | Ga0466959_0018863 | 3300045049 | Bacteria | 5067 |
| 248 | Ga0466959_0033353 | 3300045049 | Bacteria | 3807 |
| 249 | Ga0466959_0208212 | 3300045049 | Bacteria | 1359 |
| 250 | Ga0466959_0328696 | 3300045049 | Bacteria | 1044 |
| 251 | Ga0466958_0005324 | 3300045836 | Bacteria | 6908 |
| 252 | Ga0466958_0017998 | 3300045836 | Bacteria | 4095 |
| 253 | Ga0466958_0062700 | 3300045836 | Bacteria | 2266 |
| 254 | Ga0466958_0064188 | 3300045836 | Bacteria | 2239 |
| 255 | Ga0466958_0073093 | 3300045836 | Bacteria | 2100 |
| 256 | Ga0466958_0142900 | 3300045836 | Bacteria | 1507 |
| 257 | Ga0466958_0705453 | 3300045836 | Bacteria | 657 |
| 258 | Ga0466958_0769023 | 3300045836 | Unclassified | 628 |
| 259 | Ga0466958_0932219 | 3300045836 | Bacteria | 566 |
| 260 | Ga0466967_0000193 | 3300045976 | Bacteria | 25500 |
| 261 | Ga0466967_0018475 | 3300045976 | Bacteria | 5573 |
| 262 | Ga0466967_0019451 | 3300045976 | Bacteria | 5459 |
| 263 | Ga0466967_0022550 | 3300045976 | Bacteria | 5141 |
| 264 | Ga0466967_0025630 | 3300045976 | Bacteria | 4866 |
| 265 | Ga0466967_0034987 | 3300045976 | Bacteria | 4270 |
| 266 | Ga0466967_0037068 | 3300045976 | Bacteria | 4169 |
| 267 | Ga0466967_0086236 | 3300045976 | Bacteria | 2844 |
| 268 | Ga0466967_0087241 | 3300045976 | Bacteria | 2828 |
| 269 | Ga0466967_0107185 | 3300045976 | Bacteria | 2562 |
| 270 | Ga0466967_0121062 | 3300045976 | Bacteria | 2418 |
| 271 | Ga0466967_0144206 | 3300045976 | Bacteria | 2220 |
| 272 | Ga0466967_0171504 | 3300045976 | Bacteria | 2041 |
| 273 | Ga0466967_0213470 | 3300045976 | Bacteria | 1831 |
| 274 | Ga0466967_0232007 | 3300045976 | Bacteria | 1757 |
| 275 | Ga0466967_0746765 | 3300045976 | Unclassified | 970 |
| 276 | Ga0466967_0786606 | 3300045976 | Bacteria | 944 |
| 277 | Ga0466967_1006003 | 3300045976 | Bacteria | 830 |
| 278 | Ga0466967_1021079 | 3300045976 | Bacteria | 823 |
| 279 | Ga0466967_1755059 | 3300045976 | Bacteria | 618 |
| 280 | Ga0466967_2036844 | 3300045976 | Unclassified | 570 |
| 281 | Ga0466967_2038719 | 3300045976 | Unclassified | 570 |
| 282 | Ga0495592_0001351 | 3300046454 | Bacteria | 16986 |
| 283 | Ga0495592_0045486 | 3300046454 | Bacteria | 3275 |
| 284 | Ga0495592_0085827 | 3300046454 | Bacteria | 2268 |
| 285 | Ga0495603_0027918 | 3300046455 | Bacteria | 3404 |
| 286 | Ga0495629_0413840 | 3300046459 | Unclassified | 915 |
| 287 | Ga0495629_0452853 | 3300046459 | Unclassified | 869 |
| 288 | Ga0495641_0153524 | 3300046461 | Bacteria | 1029 |
| 289 | Ga0495651_0081731 | 3300046462 | Bacteria | 2438 |
| 290 | Ga0495653_0019973 | 3300046463 | Bacteria | 5430 |
| 291 | Ga0495653_0029950 | 3300046463 | Bacteria | 4337 |
| 292 | Ga0495653_0041571 | 3300046463 | Bacteria | 3588 |
| 293 | Ga0495582_0620628 | 3300046473 | Bacteria | 626 |
| 294 | Ga0495639_0493175 | 3300046475 | Unclassified | 625 |
| 295 | Ga0495664_0287559 | 3300046477 | Bacteria | 993 |
| 296 | Ga0495584_0044852 | 3300046491 | Bacteria | 2231 |
| 297 | Ga0495608_0007708 | 3300046511 | Bacteria | 7586 |
| 298 | Ga0495608_0089386 | 3300046511 | Bacteria | 1994 |
| 299 | Ga0495608_0147136 | 3300046511 | Bacteria | 1502 |
| 300 | Ga0495618_0000680 | 3300046514 | Bacteria | 23842 |
| 301 | Ga0495618_0028954 | 3300046514 | Bacteria | 3454 |
| 302 | Ga0495618_0246038 | 3300046514 | Bacteria | 1123 |
| 303 | Ga0495618_0908604 | 3300046514 | Bacteria | 508 |
| 304 | Ga0495628_0086007 | 3300046516 | Bacteria | 2438 |
| 305 | Ga0495628_0142823 | 3300046516 | Bacteria | 1826 |
| 306 | Ga0495630_0052272 | 3300046517 | Bacteria | 3058 |
| 307 | Ga0495630_0257714 | 3300046517 | Bacteria | 1332 |
| 308 | Ga0495630_0275491 | 3300046517 | Bacteria | 1285 |
| 309 | Ga0495630_0303118 | 3300046517 | Bacteria | 1221 |
| 310 | Ga0495644_0140753 | 3300046523 | Bacteria | 921 |
| 311 | Ga0495652_0094486 | 3300046529 | Bacteria | 2438 |
| 312 | Ga0495652_0122221 | 3300046529 | Bacteria | 2074 |
| 313 | Ga0495652_0132150 | 3300046529 | Bacteria | 1974 |
| 314 | Ga0495652_0527923 | 3300046529 | Bacteria | 815 |
| 315 | Ga0495640_0273697 | 3300046533 | Archaea | 1053 |
| 316 | Ga0495587_0018945 | 3300046536 | Bacteria | 4265 |
| 317 | Ga0495587_0241628 | 3300046536 | Bacteria | 1016 |
| 318 | Ga0495645_0000988 | 3300046543 | Bacteria | 19388 |
| 319 | Ga0495645_0081507 | 3300046543 | Bacteria | 2321 |
| 320 | Ga0495645_0158004 | 3300046543 | Bacteria | 1569 |
| 321 | Ga0495667_0139008 | 3300046559 | Unclassified | 1565 |
| 322 | Ga0495667_0455101 | 3300046559 | Bacteria | 804 |
| 323 | Ga0495635_0046644 | 3300046663 | Bacteria | 2989 |
| 324 | Ga0495635_0494735 | 3300046663 | Bacteria | 805 |
| 325 | Ga0495659_0055950 | 3300046664 | Bacteria | 1447 |
| 326 | Ga0495657_0053030 | 3300046675 | Bacteria | 2715 |
| 327 | Ga0495657_0055599 | 3300046675 | Bacteria | 2639 |
| 328 | Ga0495657_0243427 | 3300046675 | Unclassified | 1085 |
| 329 | Ga0495657_0501114 | 3300046675 | Bacteria | 708 |
| 330 | Ga0495657_0549197 | 3300046675 | Unclassified | 671 |
| 331 | Ga0495599_0002425 | 3300046678 | Bacteria | 10859 |
| 332 | Ga0495599_0004636 | 3300046678 | Bacteria | 8149 |
| 333 | Ga0495599_0051143 | 3300046678 | Bacteria | 2589 |
| 334 | Ga0495623_0003164 | 3300046679 | Bacteria | 10859 |
| 335 | Ga0495646_0004927 | 3300046680 | Bacteria | 8431 |
| 336 | Ga0495658_0159655 | 3300046683 | Bacteria | 1390 |
| 337 | Ga0495669_0668811 | 3300046684 | Unclassified | 505 |
| 338 | Ga0495613_0646549 | 3300046689 | Bacteria | 700 |
| 339 | Ga0495624_0341905 | 3300046690 | Bacteria | 900 |
| 340 | Ga0495624_0643425 | 3300046690 | Bacteria | 631 |
| 341 | Ga0495600_0180057 | 3300046809 | Unclassified | 1362 |
| 342 | Ga0495600_0926334 | 3300046809 | Bacteria | 513 |
| 343 | Ga0495581_0669224 | 3300047315 | Unclassified | 599 |
| 344 | Ga0495604_0004798 | 3300047317 | Bacteria | 10718 |
| 345 | Ga0495604_0458519 | 3300047317 | Unclassified | 832 |
| 346 | Ga0495674_0411481 | 3300047319 | Unclassified | 1091 |
| 347 | Ga0495674_0977358 | 3300047319 | Bacteria | 650 |
| 348 | Ga0495676_0993219 | 3300047321 | Bacteria | 536 |
| 349 | Ga0495680_0018380 | 3300047322 | Bacteria | 5936 |
| 350 | Ga0495675_0000809 | 3300047444 | Bacteria | 19282 |
| 351 | Ga0495684_0046369 | 3300047471 | Bacteria | 3325 |
| 352 | Ga0495684_0773463 | 3300047471 | Unclassified | 630 |
| 353 | Ga0495593_0442142 | 3300047673 | Unclassified | 651 |
| 354 | Ga0495602_0001857 | 3300048088 | Bacteria | 21151 |
| 355 | Ga0495602_0138455 | 3300048088 | Bacteria | 1930 |
| 356 | Ga0496100_0073104 | 3300048903 | Bacteria | 2294 |
| 357 | Ga0496101_0422807 | 3300048904 | Bacteria | 1050 |
| 358 | Ga0496102_0043389 | 3300048905 | Bacteria | 4078 |
| 359 | Ga0496103_0231853 | 3300048906 | Unclassified | 1188 |
| 360 | Ga0496104_0161196 | 3300048907 | Bacteria | 2151 |
| 361 | Ga0496104_0258305 | 3300048907 | Bacteria | 1655 |
| 362 | Ga0496105_0083123 | 3300048908 | Bacteria | 2644 |
| 363 | Ga0496106_0008490 | 3300048909 | Bacteria | 7599 |
| 364 | Ga0496106_0951863 | 3300048909 | Bacteria | 677 |
| 365 | Ga0496107_0000240 | 3300048910 | Bacteria | 28673 |
| 366 | Ga0496107_0212085 | 3300048910 | Bacteria | 1440 |
| 367 | Ga0496107_0874298 | 3300048910 | Bacteria | 656 |
| 368 | Ga0496108_0115249 | 3300048911 | Bacteria | 2301 |
| 369 | Ga0496109_0036410 | 3300048912 | Bacteria | 4441 |
| 370 | Ga0496109_0129687 | 3300048912 | Bacteria | 2353 |
| 371 | Ga0496109_0144968 | 3300048912 | Bacteria | 2221 |
| 372 | Ga0496109_0274061 | 3300048912 | Unclassified | 1590 |
| 373 | Ga0496109_1218589 | 3300048912 | Bacteria | 689 |
| 374 | Ga0496110_0709446 | 3300048913 | Bacteria | 908 |
| 375 | Ga0496111_0120591 | 3300048914 | Bacteria | 1937 |
| 376 | Ga0496112_0096171 | 3300048915 | Bacteria | 2932 |
| 377 | Ga0496112_0233307 | 3300048915 | Bacteria | 1794 |
| 378 | Ga0496113_0148730 | 3300048916 | Bacteria | 1846 |
| 379 | Ga0496113_0329167 | 3300048916 | Bacteria | 1225 |
| 380 | Ga0496114_0009104 | 3300048917 | Bacteria | 7871 |
| 381 | Ga0496114_0036833 | 3300048917 | Bacteria | 4045 |
| 382 | Ga0496114_0420803 | 3300048917 | Bacteria | 1183 |
| 383 | Ga0496115_0142377 | 3300048918 | Bacteria | 1978 |
| 384 | Ga0501034_0007731 | 3300049571 | Bacteria | 11431 |
| 385 | Ga0501039_0839979 | 3300049575 | Bacteria | 716 |
| 386 | Ga0501067_0445145 | 3300049583 | Unclassified | 723 |
| 387 | Ga0501069_0044703 | 3300049585 | Bacteria | 2452 |
| 388 | Ga0501069_0522231 | 3300049585 | Unclassified | 709 |
| 389 | Ga0501070_0022215 | 3300049586 | Bacteria | 5315 |
| 390 | Ga0501070_0028093 | 3300049586 | Bacteria | 4717 |
| 391 | Ga0501072_0015839 | 3300049588 | Bacteria | 5779 |
| 392 | Ga0501073_0019247 | 3300049589 | Bacteria | 4932 |
| 393 | Ga0501074_0004351 | 3300049590 | Bacteria | 10114 |
| 394 | Ga0501074_0007683 | 3300049590 | Bacteria | 7808 |
| 395 | Ga0501079_0007912 | 3300049741 | Bacteria | 8059 |
| 396 | Ga0501079_1140788 | 3300049741 | Bacteria | 614 |
| 397 | Ga0501080_0002500 | 3300049742 | Bacteria | 16098 |
| 398 | Ga0501080_0087252 | 3300049742 | Bacteria | 2898 |
| 399 | Ga0501083_0000823 | 3300049744 | Bacteria | 20318 |
| 400 | nmdc:mga05p37_1266087_c1 | 3300050507 | Bacteria | 755 |
| 401 | Ga0495601_0002666 | 3300053077 | Bacteria | 10117 |
| 402 | Ga0495601_0004456 | 3300053077 | Bacteria | 8089 |
| 403 | Ga0495601_0368057 | 3300053077 | Bacteria | 933 |
| 404 | Ga0495601_0425896 | 3300053077 | Bacteria | 859 |
| 405 | Ga0495601_0520315 | 3300053077 | Bacteria | 767 |
| 406 | Ga0495612_0019986 | 3300053078 | Bacteria | 2683 |
| 407 | Ga0495612_0281134 | 3300053078 | Bacteria | 744 |
| 408 | Ga0495595_0036797 | 3300053084 | Bacteria | 2223 |
| 409 | Ga0495619_0009598 | 3300053085 | Bacteria | 6104 |
| 410 | Ga0495619_0047239 | 3300053085 | Bacteria | 2834 |
| 411 | Ga0495619_0051249 | 3300053085 | Bacteria | 2727 |
| 412 | Ga0495619_0151665 | 3300053085 | Bacteria | 1599 |
| 413 | Ga0501084_0668269 | 3300054114 | Archaea | 877 |
| 414 | Ga0466962_0002314 | 3300061719 | Bacteria | 9019 |
| 415 | Ga0466962_0003264 | 3300061719 | Bacteria | 7704 |
| 416 | Ga0466962_0018461 | 3300061719 | Bacteria | 3355 |
| 417 | Ga0466962_0041856 | 3300061719 | Bacteria | 2192 |
| 418 | Ga0466962_0147215 | 3300061719 | Bacteria | 1142 |
| 419 | Ga0466962_0149203 | 3300061719 | Bacteria | 1134 |
| 420 | Ga0466962_0189662 | 3300061719 | Bacteria | 1003 |
| 421 | Ga0530510_0645009 | 3300061734 | Bacteria | 806 |
| 422 | Ga0466967_0011810 | |||
| 423 | Ga0070658_10013277 | |||
| 424 | Ga0070683_100026006 | |||
| 425 | Ga0070683_100112209 | |||
| 426 | Ga0070680_100141224 | |||
| 427 | Ga0070682_100024250 | |||
| 428 | Ga0070682_102006857 | |||
| 429 | Ga0068868_100725639 | |||
| 430 | Ga0070660_100015612 | |||
| 431 | Ga0070660_100248362 | |||
| 432 | Ga0070660_100503209 | |||
| 433 | Ga0070691_10788688 | |||
| 434 | Ga0070661_100171222 | |||
| 435 | Ga0070661_100504316 | |||
| 436 | Ga0070692_10282368 | |||
| 437 | Ga0070659_100237410 | |||
| 438 | Ga0070709_10834929 | |||
| 439 | Ga0070709_11250683 | |||
| 440 | Ga0070714_100009882 | |||
| 441 | Ga0070714_100023074 | |||
| 442 | Ga0070714_100050993 | |||
| 443 | Ga0070714_100205461 | |||
| 444 | Ga0070714_100347089 | |||
| 445 | Ga0070714_100414859 | |||
| 446 | Ga0070714_100433461 | |||
| 447 | Ga0070713_100054715 | |||
| 448 | Ga0070713_100202919 | |||
| 449 | Ga0070713_101350855 | |||
| 450 | Ga0070710_10001452 | |||
| 451 | Ga0070711_100402305 | |||
| 452 | Ga0070711_100483788 | |||
| 453 | Ga0070711_100759776 | |||
| 454 | Ga0070708_100295438 | |||
| 455 | Ga0070662_100802562 | |||
| 456 | Ga0070681_10047362 | |||
| 457 | Ga0070681_10365293 | |||
| 458 | Ga0070681_10404949 | |||
| 459 | Ga0070681_10896920 | |||
| 460 | Ga0070681_11373862 | |||
| 461 | Ga0070707_100016042 | |||
| 462 | Ga0070707_100398293 | |||
| 463 | Ga0070707_100437732 | |||
| 464 | Ga0070698_100229458 | |||
| 465 | Ga0070698_100357079 | |||
| 466 | Ga0070698_100695263 | |||
| 467 | Ga0070679_100135010 | |||
| 468 | Ga0070679_100141450 | |||
| 469 | Ga0070679_100418841 | |||
| 470 | Ga0070679_102068136 | |||
| 471 | Ga0070684_100125953 | |||
| 472 | Ga0070684_100342421 | |||
| 473 | Ga0070684_100626296 | |||
| 474 | Ga0070684_100899012 | |||
| 475 | Ga0070697_101086202 | |||
| 476 | Ga0068853_100144102 | |||
| 477 | Ga0070686_100830862 | |||
| 478 | Ga0070695_100295807 | |||
| 479 | Ga0070704_100608787 | |||
| 480 | Ga0068855_100188842 | |||
| 481 | Ga0068855_100208505 | |||
| 482 | Ga0068855_101118425 | |||
| 483 | Ga0068856_100047477 | |||
| 484 | Ga0068856_100388082 | |||
| 485 | Ga0068856_101252577 | |||
| 486 | Ga0068852_100157456 | |||
| 487 | Ga0068851_10371852 | |||
| 488 | Ga0070717_10001826 | |||
| 489 | Ga0070717_10033159 | |||
| 490 | Ga0070717_10119692 | |||
| 491 | Ga0070716_100773253 | |||
| 492 | Ga0070712_100898007 | |||
| 493 | Ga0070712_101423601 | |||
| 494 | Ga0105240_10054545 | |||
| 495 | Ga0105240_10204816 | |||
| 496 | Ga0105238_10133692 | |||
| 497 | Ga0099796_10054872 | |||
| 498 | Ga0105246_10131214 | |||
| 499 | Ga0157373_10659795 | |||
| 500 | Ga0157371_10206045 | |||
| 501 | Ga0157370_10417638 | |||
| 502 | Ga0157370_10568220 | |||
| 503 | Ga0157370_11162695 | |||
| 504 | Ga0157370_11604277 | |||
| 505 | Ga0157369_10043623 | |||
| 506 | Ga0157369_10170343 | |||
| 507 | Ga0157374_12263145 | |||
| 508 | Ga0182008_10078346 | |||
| 509 | Ga0182006_1038828 | |||
| 510 | Ga0182007_10018329 | |||
| 511 | Ga0182005_1184138 | |||
| 512 | Ga0206356_10948880 | |||
| 513 | Ga0206356_11375599 | |||
| 514 | Ga0206353_10466063 | |||
| 515 | Ga0207692_11098109 | |||
| 516 | Ga0207699_10501828 | |||
| 517 | Ga0207699_10631668 | |||
| 518 | Ga0207699_10705456 | |||
| 519 | Ga0207705_10091457 | |||
| 520 | Ga0207705_10128114 | |||
| 521 | Ga0207705_10268969 | |||
| 522 | Ga0207707_10078994 | |||
| 523 | Ga0207707_10142209 | |||
| 524 | Ga0207707_10208354 | |||
| 525 | Ga0207707_10399480 | |||
| 526 | Ga0207707_10618982 | |||
| 527 | Ga0207707_10633566 | |||
| 528 | Ga0207707_10714809 | |||
| 529 | Ga0207695_10189770 | |||
| 530 | Ga0207693_10005758 | |||
| 531 | Ga0207693_10376116 | |||
| 532 | Ga0207693_10453146 | |||
| 533 | Ga0207660_10068908 | |||
| 534 | Ga0207660_10968601 | |||
| 535 | Ga0207657_10008996 | |||
| 536 | Ga0207657_10013576 | |||
| 537 | Ga0207657_10037374 | |||
| 538 | Ga0207649_10118726 | |||
| 539 | Ga0207649_10382640 | |||
| 540 | Ga0207649_10498930 | |||
| 541 | Ga0207652_10148896 | |||
| 542 | Ga0207652_10225946 | |||
| 543 | Ga0207652_10707795 | |||
| 544 | Ga0207652_10794592 | |||
| 545 | Ga0207646_10006636 | |||
| 546 | Ga0207646_10864408 | |||
| 547 | Ga0207687_10936980 | |||
| 548 | Ga0207700_10034468 | |||
| 549 | Ga0207700_11032258 | |||
| 550 | Ga0207664_10085061 | |||
| 551 | Ga0207664_10109334 | |||
| 552 | Ga0207664_10210216 | |||
| 553 | Ga0207664_10369041 | |||
| 554 | Ga0207664_10732791 | |||
| 555 | Ga0207664_10838921 | |||
| 556 | Ga0207664_11598430 | |||
| 557 | Ga0207664_11629452 | |||
| 558 | Ga0207690_10289793 | |||
| 559 | Ga0207665_10838352 | |||
| 560 | Ga0207661_10054300 | |||
| 561 | Ga0207661_10077804 | |||
| 562 | Ga0207661_10337357 | |||
| 563 | Ga0207667_11466866 | |||
| 564 | Ga0207667_11648048 | |||
| 565 | Ga0207677_11204134 | |||
| 566 | Ga0207639_10135378 | |||
| 567 | Ga0207702_10102276 | |||
| 568 | Ga0207702_10157184 | |||
| 569 | Ga0207702_10980390 | |||
| 570 | Ga0207674_10168377 | |||
| 571 | Ga0207683_10297111 | |||
| 572 | Ga0207698_10535646 | |||
| 573 | Ga0207698_10556890 | |||
| 574 | Ga0207698_10969266 | |||
| 575 | Ga0265337_1031919 | |||
| 576 | Ga0265319_1022875 | |||
| 577 | Ga0265318_10044467 | |||
| 578 | Ga0265322_10130612 | |||
| 579 | Ga0265338_10035512 | |||
| 580 | Ga0265328_10300304 | |||
| 581 | Ga0265329_10027711 | |||
| 582 | Ga0265331_10056294 | |||
| 583 | Ga0265316_10014382 | |||
| 584 | Ga0265316_10323512 | |||
| 585 | Ga0265342_10051361 | |||
| 586 | Ga0307405_10158354 | |||
| 587 | Ga0307410_10626836 | |||
| 588 | Ga0307406_10208403 | |||
| 589 | Ga0307412_10252914 | |||
| 590 | Ga0307409_100081772 | |||
| 591 | Ga0307416_100070884 | |||
| 592 | Ga0307411_10386084 | |||
| 593 | Ga0307415_100347255 | |||
| 594 | Ga0373955_0098532 | |||
| 595 | Ga0373935_0438453 | |||
| 596 | Ga0373947_0918825 | |||
| 597 | Ga0373937_0001932 | |||
| 598 | Ga0373937_0583906 | |||
| 599 | Ga0395899_0157162 | |||
| 600 | Ga0395900_0101725 | |||
| 601 | Ga0395900_0188972 | |||
| 602 | Ga0395900_1341608 | |||
| 603 | Ga0395898_0460649 | |||
| 604 | Ga0395898_0475879 | |||
| 605 | Ga0395898_0728504 | |||
| 606 | Ga0395898_1116132 | |||
| 607 | Ga0395898_1296546 | |||
| 608 | Ga0395901_0096054 | |||
| 609 | Ga0395901_0303201 | |||
| 610 | Ga0395901_1564383 | |||
| 611 | Ga0466969_0008773 | |||
| 612 | Ga0466969_0221225 | |||
| 613 | Ga0453683_0465630 | |||
| 614 | Ga0466965_0074205 | |||
| 615 | Ga0466966_0122308 | |||
| 616 | Ga0466966_0123034 | |||
| 617 | Ga0466966_0297871 | |||
| 618 | Ga0466961_0024550 | |||
| 619 | Ga0466961_0028308 | |||
| 620 | Ga0466961_0029746 | |||
| 621 | Ga0466961_0073999 | |||
| 622 | Ga0466961_0192081 | |||
| 623 | Ga0466963_0000538 | |||
| 624 | Ga0466963_0004904 | |||
| 625 | Ga0466963_0008189 | |||
| 626 | Ga0466963_0008395 | |||
| 627 | Ga0466963_0024151 | |||
| 628 | Ga0466963_0049877 | |||
| 629 | Ga0466963_0057209 | |||
| 630 | Ga0466963_0134445 | |||
| 631 | Ga0466963_0254266 | |||
| 632 | Ga0466963_0295824 | |||
| 633 | Ga0466963_0305288 | |||
| 634 | Ga0466963_0308159 | |||
| 635 | Ga0466963_0370749 | |||
| 636 | Ga0466963_0526729 | |||
| 637 | Ga0466963_0679774 | |||
| 638 | Ga0466964_0028509 | |||
| 639 | Ga0466964_0186582 | |||
| 640 | Ga0466971_0011658 | |||
| 641 | Ga0466971_0033550 | |||
| 642 | Ga0466971_0083862 | |||
| 643 | Ga0466971_0139200 | |||
| 644 | Ga0466971_0376495 | |||
| 645 | Ga0466971_0526887 | |||
| 646 | Ga0466968_0008437 | |||
| 647 | Ga0466968_0009402 | |||
| 648 | Ga0466968_0058559 | |||
| 649 | Ga0466968_0084045 | |||
| 650 | Ga0466968_0096764 | |||
| 651 | Ga0466968_0147336 | |||
| 652 | Ga0466968_0313211 | |||
| 653 | Ga0466970_0013719 | |||
| 654 | Ga0466957_0009244 | |||
| 655 | Ga0466957_0016346 | |||
| 656 | Ga0466957_0042799 | |||
| 657 | Ga0466957_0055261 | |||
| 658 | Ga0466957_0068666 | |||
| 659 | Ga0466957_0164936 | |||
| 660 | Ga0466957_0309961 | |||
| 661 | Ga0466957_0549265 | |||
| 662 | Ga0466957_0582312 | |||
| 663 | Ga0466957_0677637 | |||
| 664 | Ga0466957_1059132 | |||
| 665 | Ga0466960_0015600 | |||
| 666 | Ga0466960_0129700 | |||
| 667 | Ga0466960_0448990 | |||
| 668 | Ga0466959_0018863 | |||
| 669 | Ga0466959_0033353 | |||
| 670 | Ga0466959_0208212 | |||
| 671 | Ga0466959_0328696 | |||
| 672 | Ga0466958_0005324 | |||
| 673 | Ga0466958_0017998 | |||
| 674 | Ga0466958_0062700 | |||
| 675 | Ga0466958_0064188 | |||
| 676 | Ga0466958_0073093 | |||
| 677 | Ga0466958_0142900 | |||
| 678 | Ga0466958_0705453 | |||
| 679 | Ga0466958_0769023 | |||
| 680 | Ga0466958_0932219 | |||
| 681 | Ga0466967_0000193 | |||
| 682 | Ga0466967_0018475 | |||
| 683 | Ga0466967_0019451 | |||
| 684 | Ga0466967_0022550 | |||
| 685 | Ga0466967_0025630 | |||
| 686 | Ga0466967_0034987 | |||
| 687 | Ga0466967_0037068 | |||
| 688 | Ga0466967_0086236 | |||
| 689 | Ga0466967_0087241 | |||
| 690 | Ga0466967_0107185 | |||
| 691 | Ga0466967_0121062 | |||
| 692 | Ga0466967_0144206 | |||
| 693 | Ga0466967_0171504 | |||
| 694 | Ga0466967_0213470 | |||
| 695 | Ga0466967_0232007 | |||
| 696 | Ga0466967_0746765 | |||
| 697 | Ga0466967_0786606 | |||
| 698 | Ga0466967_1006003 | |||
| 699 | Ga0466967_1021079 | |||
| 700 | Ga0466967_1755059 | |||
| 701 | Ga0466967_2036844 | |||
| 702 | Ga0466967_2038719 | |||
| 703 | Ga0495592_0001351 | |||
| 704 | Ga0495592_0045486 | |||
| 705 | Ga0495592_0085827 | |||
| 706 | Ga0495603_0027918 | |||
| 707 | Ga0495629_0413840 | |||
| 708 | Ga0495629_0452853 | |||
| 709 | Ga0495641_0153524 | |||
| 710 | Ga0495651_0081731 | |||
| 711 | Ga0495653_0019973 | |||
| 712 | Ga0495653_0029950 | |||
| 713 | Ga0495653_0041571 | |||
| 714 | Ga0495582_0620628 | |||
| 715 | Ga0495639_0493175 | |||
| 716 | Ga0495664_0287559 | |||
| 717 | Ga0495584_0044852 | |||
| 718 | Ga0495608_0007708 | |||
| 719 | Ga0495608_0089386 | |||
| 720 | Ga0495608_0147136 | |||
| 721 | Ga0495618_0000680 | |||
| 722 | Ga0495618_0028954 | |||
| 723 | Ga0495618_0246038 | |||
| 724 | Ga0495618_0908604 | |||
| 725 | Ga0495628_0086007 | |||
| 726 | Ga0495628_0142823 | |||
| 727 | Ga0495630_0052272 | |||
| 728 | Ga0495630_0257714 | |||
| 729 | Ga0495630_0275491 | |||
| 730 | Ga0495630_0303118 | |||
| 731 | Ga0495644_0140753 | |||
| 732 | Ga0495652_0094486 | |||
| 733 | Ga0495652_0122221 | |||
| 734 | Ga0495652_0132150 | |||
| 735 | Ga0495652_0527923 | |||
| 736 | Ga0495640_0273697 | |||
| 737 | Ga0495587_0018945 | |||
| 738 | Ga0495587_0241628 | |||
| 739 | Ga0495645_0000988 | |||
| 740 | Ga0495645_0081507 | |||
| 741 | Ga0495645_0158004 | |||
| 742 | Ga0495667_0139008 | |||
| 743 | Ga0495667_0455101 | |||
| 744 | Ga0495635_0046644 | |||
| 745 | Ga0495635_0494735 | |||
| 746 | Ga0495659_0055950 | |||
| 747 | Ga0495657_0053030 | |||
| 748 | Ga0495657_0055599 | |||
| 749 | Ga0495657_0243427 | |||
| 750 | Ga0495657_0501114 | |||
| 751 | Ga0495657_0549197 | |||
| 752 | Ga0495599_0002425 | |||
| 753 | Ga0495599_0004636 | |||
| 754 | Ga0495599_0051143 | |||
| 755 | Ga0495623_0003164 | |||
| 756 | Ga0495646_0004927 | |||
| 757 | Ga0495658_0159655 | |||
| 758 | Ga0495669_0668811 | |||
| 759 | Ga0495613_0646549 | |||
| 760 | Ga0495624_0341905 | |||
| 761 | Ga0495624_0643425 | |||
| 762 | Ga0495600_0180057 | |||
| 763 | Ga0495600_0926334 | |||
| 764 | Ga0495581_0669224 | |||
| 765 | Ga0495604_0004798 | |||
| 766 | Ga0495604_0458519 | |||
| 767 | Ga0495674_0411481 | |||
| 768 | Ga0495674_0977358 | |||
| 769 | Ga0495676_0993219 | |||
| 770 | Ga0495680_0018380 | |||
| 771 | Ga0495675_0000809 | |||
| 772 | Ga0495684_0046369 | |||
| 773 | Ga0495684_0773463 | |||
| 774 | Ga0495593_0442142 | |||
| 775 | Ga0495602_0001857 | |||
| 776 | Ga0495602_0138455 | |||
| 777 | Ga0496100_0073104 | |||
| 778 | Ga0496101_0422807 | |||
| 779 | Ga0496102_0043389 | |||
| 780 | Ga0496103_0231853 | |||
| 781 | Ga0496104_0161196 | |||
| 782 | Ga0496104_0258305 | |||
| 783 | Ga0496105_0083123 | |||
| 784 | Ga0496106_0008490 | |||
| 785 | Ga0496106_0951863 | |||
| 786 | Ga0496107_0000240 | |||
| 787 | Ga0496107_0212085 | |||
| 788 | Ga0496107_0874298 | |||
| 789 | Ga0496108_0115249 | |||
| 790 | Ga0496109_0036410 | |||
| 791 | Ga0496109_0129687 | |||
| 792 | Ga0496109_0144968 | |||
| 793 | Ga0496109_0274061 | |||
| 794 | Ga0496109_1218589 | |||
| 795 | Ga0496110_0709446 | |||
| 796 | Ga0496111_0120591 | |||
| 797 | Ga0496112_0096171 | |||
| 798 | Ga0496112_0233307 | |||
| 799 | Ga0496113_0148730 | |||
| 800 | Ga0496113_0329167 | |||
| 801 | Ga0496114_0009104 | |||
| 802 | Ga0496114_0036833 | |||
| 803 | Ga0496114_0420803 | |||
| 804 | Ga0496115_0142377 | |||
| 805 | Ga0501034_0007731 | |||
| 806 | Ga0501039_0839979 | |||
| 807 | Ga0501067_0445145 | |||
| 808 | Ga0501069_0044703 | |||
| 809 | Ga0501069_0522231 | |||
| 810 | Ga0501070_0022215 | |||
| 811 | Ga0501070_0028093 | |||
| 812 | Ga0501072_0015839 | |||
| 813 | Ga0501073_0019247 | |||
| 814 | Ga0501074_0004351 | |||
| 815 | Ga0501074_0007683 | |||
| 816 | Ga0501079_0007912 | |||
| 817 | Ga0501079_1140788 | |||
| 818 | Ga0501080_0002500 | |||
| 819 | Ga0501080_0087252 | |||
| 820 | Ga0501083_0000823 | |||
| 821 | nmdc:mga05p37_1266087_c1 | |||
| 822 | Ga0495601_0002666 | |||
| 823 | Ga0495601_0004456 | |||
| 824 | Ga0495601_0368057 | |||
| 825 | Ga0495601_0425896 | |||
| 826 | Ga0495601_0520315 | |||
| 827 | Ga0495612_0019986 | |||
| 828 | Ga0495612_0281134 | |||
| 829 | Ga0495595_0036797 | |||
| 830 | Ga0495619_0009598 | |||
| 831 | Ga0495619_0047239 | |||
| 832 | Ga0495619_0051249 | |||
| 833 | Ga0495619_0151665 | |||
| 834 | Ga0501084_0668269 | |||
| 835 | Ga0466962_0002314 | |||
| 836 | Ga0466962_0003264 | |||
| 837 | Ga0466962_0018461 | |||
| 838 | Ga0466962_0041856 | |||
| 839 | Ga0466962_0147215 | |||
| 840 | Ga0466962_0149203 | |||
| 841 | Ga0466962_0189662 | |||
| 842 | Ga0530510_0645009 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k2y-assembly1.cif.gz_A | crystal structure of protein lp_0118 from lactobacillus plantarum,northeast structural genomics consortium target lpr91b | 0.6493 | 45 | 132 |
| 4xzg-assembly1.cif.gz_A | crystal structure of hiran domain of human hltf | 0.6284 | 43 | 132 |
| 4s0n-assembly1.cif.gz_C | crystal structure of hltf hiran domain bound to dna | 0.6143 | 43 | 134 |
| 4h8s-assembly1.cif.gz_A | crystal structure of human appl2barph domain | 0.5898 | 69 | 94 |
| 3k2y-assembly1.cif.gz_A | crystal structure of protein lp_0118 from lactobacillus plantarum,northeast structural genomics consortium target lpr91b | 0.5693 | 45 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7L8Y3_129_246_3.30.70.2330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6865 | 43 | 133 | 3.30.70.2330 |
| 4p2bA05 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.685 | 106 | 134 | 2.40.240.10 |
| af_Q4E0Y0_362_474_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.6746 | 106 | 132 | 2.40.240.10 |
| af_Q5XVJ4_153_259_3.30.70.2330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6444 | 36 | 132 | 3.30.70.2330 |
| 3k2yD00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6392 | 45 | 132 | 3.30.70.2330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0UMG8-F1-model_v4 | HIRAN domain-containing protein | 0.9761 | 12 | 143 |
GO:0003676
GO:0008270 GO:0016818 |
| AF-A0A537ZWG4-F1-model_v4 | HIRAN domain-containing protein | 0.9579 | 44 | 144 |
GO:0003676
GO:0008270 GO:0016818 |
| AF-A0A7J5Y7Y0-F1-model_v4 | HIRAN domain-containing protein | 0.9545 | 66 | 105 |
GO:0003676
GO:0008270 GO:0016818 |
| AF-A0A7W0UMG8-F1-model_v4 | HIRAN domain-containing protein | 0.9537 | 12 | 143 |
GO:0003676
GO:0008270 GO:0016818 |
| AF-A0A1Q7WI15-F1-model_v4 | HIRAN domain-containing protein | 0.9407 | 57 | 143 |
GO:0003676
GO:0008270 GO:0016818 |