F439978

General Info

Members Datasets Scaffolds Average Seq Length
421 299 367 551

Family's Representative Sequence

Representative Sequence 3300009176|Ga0105242_10007948|Ga0105242_100079486
Length 585
Sequence MHHSLSLINTIAAGLGLALLLGFIATRAKLPALVGYLLAGVMIGPFTPGFVADREMASQLAEIGVMLLMFGVGLHFSLGDLLAVRRIALPGAVVQMVVATLLGMGLATWWGXXXGGALVFGLALSVASTVVLLRALETQGILDSYTGRIAVGWLVVEDLAMVLVLVLLPPLSGWLGGSGAETPAADVWRAVGITLAQVGAFVVLMLVVGRRVFPWVLWQVARTGSRELFTLCVVAAAVSIAYGSAALFGVSFALGAFFAGMVMRESEFSHRAAQESLPLRDAFAVLFFVSVGMLFNPWVLVERPLQVLGVVAIIILGKTLAAAALVLAFRYPLNTALTVSASLAQIGEFSFILVGLGSSLGLLPPEGASLVLAGALISIALNPVLFRAIAPLQQWLRARSALARRLDQRDDPLAELPMTTDEKFLARQVVLVGYGRVGQRIAAALLAQDVPFVVAEQNRELVESLRNQGMAAVYGDAVDPAVLIQAHIARAHMLVIATPDTLNVRQIVETARILNPEIETVVRSHNDEEARLLEQEGVGKVFLGEEALAVAMTDHVVASAHQRHAGGSHAGAAATAPGGLHEHRA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2519103095 Burkholderia sp. KJ006 Isolate Nodule
3 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
4 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
5 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
6 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221609 Acidovorax sp. Root217 Isolate Unclassified
10 2643221611 Acidovorax sp. Root219 Isolate Unclassified
11 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
12 2643221645 Massilia sp. Root351 Isolate Unclassified
13 2643221652 Acidovorax sp. Root402 Isolate Unclassified
14 2643221664 Massilia sp. Root418 Isolate Unclassified
15 2643221717 Acidovorax sp. Root267 Isolate Unclassified
16 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
17 2738541300 Massilia sp. GV016 Isolate Unclassified
18 2738543012 Acidovorax sp. CF301 Isolate Unclassified
19 2738543018 Massilia sp. GV045 Isolate Unclassified
20 2738543030 Massilia sp. GV097 Isolate Unclassified
21 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
22 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
23 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
24 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
25 2816332133 Acidovorax radicis 2721A Isolate Unclassified
26 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
27 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
28 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2818991452 Burkholderia cepacia 561 Isolate Unclassified
31 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
32 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
33 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
34 2904564687 Burkholderia sp. 571 Isolate Unclassified
35 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
36 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
37 2928163908 Burkholderia sp. 567 Isolate Unclassified
38 2928170801 Burkholderia sp. 572 Isolate Unclassified
39 2928536128 Burkholderia sola 565 Isolate Unclassified
40 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
41 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
42 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
43 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
44 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
45 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
46 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
47 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
48 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
49 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
50 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
51 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
52 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
53 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
54 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
55 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
56 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
57 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
58 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
59 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
60 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
61 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
64 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
65 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
66 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
67 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
68 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
69 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
70 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
71 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
72 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
73 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
74 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
79 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
80 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
81 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
82 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
83 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
84 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
85 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
86 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
87 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
88 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
89 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
90 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
91 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
106 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
113 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
114 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
115 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
117 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
118 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
119 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
184 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
203 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
204 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
205 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
206 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
213 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
214 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
215 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
232 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
233 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
242 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
243 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
244 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
247 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
248 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
270 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
279 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
280 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
281 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
282 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
283 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 639633007 Azoarcus olearius BH72 Isolate Unclassified
290 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
291 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
292 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
293 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
294 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
295 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
296 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
297 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
298 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
299 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.17
Metatranscriptomes 0
Isolates 12.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.33
Nodule 0.71
Rhizoplane 2.38
Rhizosphere 59.86
Stem 0
Stem Tuber 0
Unclassified 14.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000008 3300002704 Bacteria 236146
2 JGI25156J39149_1000002 3300002705 Bacteria 343501
3 JGI25154J39366_1000010 3300002738 Bacteria 297985
4 JGI25157J39369_1000001 3300002741 Bacteria 363277
5 JGI25159J45721_1001361 3300002987 Bacteria 10210
6 rootH2_10050623 3300003320 Bacteria 4155
7 rootL2_10032903 3300003322 Bacteria 12059
8 JGI25160J50197_1000156 3300003354 Bacteria 60358
9 JGI25161J50226_1000043 3300003374 Bacteria 120741
10 Ga0055532_1000797 3300003758 Bacteria 10905
11 Ga0055532_1001574 3300003758 Bacteria 6085
12 Ga0055532_1001993 3300003758 Bacteria 4745
13 Ga0055527_1000782 3300003760 Bacteria 8677
14 Ga0055535_1000093 3300003761 Bacteria 97771
15 Ga0055535_1000100 3300003761 Bacteria 93240
16 Ga0055542_1000106 3300003762 Bacteria 112713
17 Ga0055542_1006081 3300003762 Bacteria 2627
18 Ga0055529_1000124 3300003763 Bacteria 112731
19 Ga0055526_1000251 3300003771 Bacteria 45724
20 Ga0055537_1000031 3300003773 Bacteria 99208
21 Ga0055537_1002011 3300003773 Bacteria 7223
22 Ga0055524_1000166 3300003775 Bacteria 75509
23 Ga0055536_1000085 3300003781 Bacteria 80741
24 Ga0055534_1000375 3300003784 Bacteria 27985
25 Ga0055534_1000801 3300003784 Bacteria 14607
26 Ga0055528_1000592 3300003790 Bacteria 27293
27 Ga0055528_1000844 3300003790 Bacteria 20835
28 Ga0055528_1001256 3300003790 Bacteria 16084
29 Ga0055530_10000254 3300003791 Bacteria 48098
30 Ga0055540_1000079 3300003792 Bacteria 112817
31 Ga0055531_10000623 3300003794 Bacteria 30616
32 Ga0055543_1000160 3300004625 Bacteria 56093
33 Ga0065714_10003467 3300005288 Bacteria 9081
34 Ga0070658_10130542 3300005327 Bacteria 2094
35 Ga0068869_100056189 3300005334 Bacteria 2870
36 Ga0070666_10065248 3300005335 Bacteria 2470
37 Ga0070680_100071576 3300005336 Bacteria 2849
38 Ga0068868_100037508 3300005338 Bacteria 3758
39 Ga0070660_100000002 3300005339 Bacteria 177777
40 Ga0070660_100004366 3300005339 Bacteria 9764
41 Ga0070668_100000226 3300005347 Bacteria 36448
42 Ga0070669_100002510 3300005353 Bacteria 13280
43 Ga0070669_100021888 3300005353 Bacteria 4572
44 Ga0070675_100035821 3300005354 Bacteria 4035
45 Ga0070674_100047009 3300005356 Bacteria 2955
46 Ga0070674_100049437 3300005356 Bacteria 2891
47 Ga0070673_100172983 3300005364 Bacteria 1844
48 Ga0070688_100027720 3300005365 Bacteria 3374
49 Ga0070659_100017713 3300005366 Bacteria 5365
50 Ga0070667_100000243 3300005367 Bacteria 61793
51 Ga0070667_100022578 3300005367 Bacteria 5217
52 Ga0070667_100079711 3300005367 Bacteria 2800
53 Ga0070667_100109160 3300005367 Bacteria 2397
54 Ga0070667_100153269 3300005367 Bacteria 2026
55 Ga0070708_100033862 3300005445 Bacteria 4440
56 Ga0070663_100000141 3300005455 Bacteria 34917
57 Ga0070663_100002294 3300005455 Bacteria 10732
58 Ga0070663_100054443 3300005455 Bacteria 2860
59 Ga0070678_100041958 3300005456 Bacteria 3248
60 Ga0070681_10048704 3300005458 Bacteria 4234
61 Ga0068867_100053351 3300005459 Bacteria 2986
62 Ga0068867_100064033 3300005459 Bacteria 2733
63 Ga0070706_100036580 3300005467 Bacteria 4534
64 Ga0070707_100055045 3300005468 Bacteria 3813
65 Ga0068853_100059147 3300005539 Bacteria 3310
66 Ga0070672_100085099 3300005543 Bacteria 2541
67 Ga0070665_100000028 3300005548 Bacteria 351357
68 Ga0068855_100030340 3300005563 Bacteria 6467
69 Ga0068852_100005330 3300005616 Bacteria 9183
70 Ga0068852_100012406 3300005616 Bacteria 6470
71 Ga0068859_100069161 3300005617 Bacteria 3565
72 Ga0068864_100055700 3300005618 Bacteria 3415
73 Ga0068863_100049913 3300005841 Bacteria 3968
74 Ga0068858_100001271 3300005842 Bacteria 26105
75 Ga0068858_100124606 3300005842 Bacteria 2411
76 Ga0068858_100138892 3300005842 Bacteria 2281
77 Ga0075365_10105910 3300006038 Bacteria 1929
78 Ga0075368_10002306 3300006042 Bacteria 6196
79 Ga0075363_100018214 3300006048 Bacteria 3494
80 Ga0075363_100019073 3300006048 Bacteria 3425
81 Ga0075364_10002654 3300006051 Bacteria 10040
82 Ga0075362_10013817 3300006177 Bacteria 3242
83 Ga0075367_10004443 3300006178 Bacteria 6851
84 Ga0075366_10066160 3300006195 Bacteria 2150
85 Ga0097621_100024512 3300006237 Bacteria 4712
86 Ga0097621_100031193 3300006237 Bacteria 4227
87 Ga0097621_100095376 3300006237 Bacteria 2495
88 Ga0075370_10011655 3300006353 Bacteria 4626
89 Ga0075370_10024103 3300006353 Bacteria 3358
90 Ga0075370_10027303 3300006353 Bacteria 3166
91 Ga0068871_100046570 3300006358 Bacteria 3493
92 Ga0068871_100094227 3300006358 Bacteria 2499
93 Ga0075428_100061286 3300006844 Bacteria 4120
94 Ga0075430_100037628 3300006846 Bacteria 4101
95 Ga0097620_100069157 3300006931 Bacteria 3565
96 Ga0099826_10001304 3300006948 Bacteria 14708
97 Ga0105240_10000600 3300009093 Bacteria 66883
98 Ga0105240_10003249 3300009093 Bacteria 25440
99 Ga0105240_10063202 3300009093 Bacteria 4605
100 Ga0105240_10103542 3300009093 Bacteria 3458
101 Ga0111539_10020549 3300009094 Bacteria 8133
102 Ga0114129_10039584 3300009147 Bacteria 6647
103 Ga0105243_10047881 3300009148 Bacteria 3368
104 Ga0105242_10007948 3300009176 Bacteria 8170
105 Ga0105248_10000367 3300009177 Bacteria 52570
106 Ga0105248_10010183 3300009177 Bacteria 10354
107 Ga0105248_10059245 3300009177 Bacteria 4300
108 Ga0105237_10001152 3300009545 Bacteria 35466
109 Ga0105237_10039172 3300009545 Bacteria 4785
110 Ga0105237_10046755 3300009545 Bacteria 4353
111 Ga0105238_10083192 3300009551 Bacteria 3190
112 Ga0105249_10000346 3300009553 Bacteria 46733
113 Ga0105249_10050320 3300009553 Bacteria 3799
114 Ga0105249_10167993 3300009553 Bacteria 2125
115 Ga0105239_10000248 3300010375 Bacteria 80738
116 Ga0105239_10009057 3300010375 Bacteria 11263
117 Ga0105239_10032158 3300010375 Bacteria 5766
118 Ga0157374_10013244 3300013296 Bacteria 7195
119 Ga0157374_10047660 3300013296 Bacteria 3974
120 Ga0157374_10113974 3300013296 Bacteria 2602
121 Ga0163162_10011446 3300013306 Bacteria 8650
122 Ga0163162_10064599 3300013306 Bacteria 3705
123 Ga0163162_10098024 3300013306 Bacteria 3020
124 Ga0157375_10099112 3300013308 Bacteria 2992
125 Ga0157380_10028186 3300014326 Bacteria 4279
126 Ga0157379_10067294 3300014968 Bacteria 3202
127 Ga0163161_10011770 3300017792 Bacteria 6066
128 Ga0163161_10022825 3300017792 Bacteria 4408
129 Ga0163161_10121837 3300017792 Bacteria 1960
130 Ga0209435_100001 3300025206 Bacteria 1424171
131 Ga0209566_100962 3300025225 Bacteria 12849
132 Ga0209672_100015 3300025228 Bacteria 529352
133 Ga0209672_100031 3300025228 Bacteria 332889
134 Ga0209147_100016 3300025229 Bacteria 527606
135 Ga0209147_100034 3300025229 Bacteria 346646
136 Ga0209147_100040 3300025229 Bacteria 307612
137 Ga0209258_100026 3300025242 Bacteria 527606
138 Ga0209258_100061 3300025242 Bacteria 313501
139 Ga0207425_1001152 3300025245 Bacteria 11850
140 Ga0209646_1000001 3300025246 Bacteria 3092932
141 Ga0209646_1000042 3300025246 Bacteria 343923
142 Ga0209026_1000001 3300025250 Bacteria 1228671
143 Ga0209148_1000070 3300025254 Bacteria 332889
144 Ga0209148_1000798 3300025254 Bacteria 23182
145 Ga0209759_1000001 3300025256 Bacteria 2799452
146 Ga0209759_1009801 3300025256 Bacteria 2866
147 Ga0209565_1000087 3300025263 Bacteria 152027
148 Ga0209565_1000096 3300025263 Bacteria 134434
149 Ga0209565_1000423 3300025263 Bacteria 34316
150 Ga0209455_1000069 3300025272 Bacteria 308247
151 Ga0209455_1000260 3300025272 Bacteria 60857
152 Ga0209673_1000026 3300025273 Bacteria 373739
153 Ga0209673_1000145 3300025273 Bacteria 152027
154 Ga0209673_1000232 3300025273 Bacteria 108581
155 Ga0209130_1000041 3300025284 Bacteria 261078
156 Ga0209130_1000286 3300025284 Bacteria 61920
157 Ga0209675_1000085 3300025291 Bacteria 152027
158 Ga0209675_1000195 3300025291 Bacteria 66252
159 Ga0209675_1002450 3300025291 Bacteria 9532
160 Ga0209676_1000054 3300025292 Bacteria 365890
161 Ga0209025_1011469 3300025294 Bacteria 5832
162 Ga0209025_1026971 3300025294 Bacteria 2864
163 Ga0209564_1000010 3300025295 Bacteria 885399
164 Ga0209564_1000463 3300025295 Bacteria 68043
165 Ga0209564_1000534 3300025295 Bacteria 61747
166 Ga0209564_1002932 3300025295 Bacteria 12394
167 Ga0209050_1000066 3300025298 Bacteria 305458
168 Ga0209050_1004870 3300025298 Bacteria 8800
169 Ga0209256_1000003 3300025299 Bacteria 1661127
170 Ga0207426_1000061 3300025302 Bacteria 362507
171 Ga0209051_1000044 3300025303 Bacteria 305458
172 Ga0209257_1000082 3300025304 Bacteria 305458
173 Ga0209257_1009713 3300025304 Bacteria 5064
174 Ga0207697_10011904 3300025315 Bacteria 3665
175 Ga0207682_10003843 3300025893 Bacteria 6448
176 Ga0207645_10001677 3300025907 Bacteria 18013
177 Ga0207695_10003274 3300025913 Bacteria 23026
178 Ga0207695_10184094 3300025913 Bacteria 2009
179 Ga0207671_10000618 3300025914 Bacteria 46890
180 Ga0207671_10010652 3300025914 Bacteria 7564
181 Ga0207657_10000012 3300025919 Bacteria 185417
182 Ga0207657_10007018 3300025919 Bacteria 11587
183 Ga0207649_10004952 3300025920 Bacteria 7200
184 Ga0207694_10006964 3300025924 Bacteria 8585
185 Ga0207650_10057280 3300025925 Bacteria 2898
186 Ga0207659_10053743 3300025926 Bacteria 2873
187 Ga0207659_10063210 3300025926 Bacteria 2675
188 Ga0207690_10000008 3300025932 Bacteria 366090
189 Ga0207686_10002130 3300025934 Bacteria 10904
190 Ga0207691_10095518 3300025940 Bacteria 2659
191 Ga0207691_10153439 3300025940 Bacteria 2024
192 Ga0207711_10001227 3300025941 Bacteria 24290
193 Ga0207711_10097233 3300025941 Bacteria 2600
194 Ga0207689_10002943 3300025942 Bacteria 15736
195 Ga0207689_10018472 3300025942 Bacteria 5884
196 Ga0207679_10011614 3300025945 Bacteria 5715
197 Ga0207667_10265854 3300025949 Bacteria 1754
198 Ga0207712_10000297 3300025961 Bacteria 46752
199 Ga0207712_10026068 3300025961 Bacteria 3891
200 Ga0207658_10000203 3300025986 Bacteria 61802
201 Ga0207677_10048346 3300026023 Bacteria 2864
202 Ga0207703_10046989 3300026035 Bacteria 3479
203 Ga0207703_10112493 3300026035 Bacteria 2326
204 Ga0207703_10119819 3300026035 Bacteria 2258
205 Ga0207678_10003856 3300026067 Bacteria 13479
206 Ga0207678_10049967 3300026067 Bacteria 3613
207 Ga0207641_10042255 3300026088 Bacteria 3824
208 Ga0207648_10006048 3300026089 Bacteria 12070
209 Ga0207648_10056489 3300026089 Bacteria 3425
210 Ga0207648_10056608 3300026089 Bacteria 3421
211 Ga0207683_10000063 3300026121 Bacteria 80638
212 Ga0209973_1000506 3300027252 Bacteria 2984
213 Ga0209371_1000177 3300027312 Bacteria 94023
214 Ga0209282_1000473 3300027666 Bacteria 19597
215 Ga0209974_10003326 3300027876 Bacteria 5808
216 Ga0209974_10005907 3300027876 Bacteria 4292
217 Ga0268266_10000017 3300028379 Bacteria 607272
218 Ga0268264_10134647 3300028381 Bacteria 2195
219 Ga0307515_10000067 3300028794 Bacteria 242978
220 Ga0307515_10001082 3300028794 Bacteria 62350
221 Ga0307515_10009443 3300028794 Bacteria 18857
222 Ga0307515_10018380 3300028794 Bacteria 12659
223 Ga0268256_1000799 3300030500 Bacteria 22634
224 Ga0307511_10001587 3300030521 Bacteria 24125
225 Ga0265331_10007563 3300031250 Bacteria 6271
226 Ga0265327_10001075 3300031251 Bacteria 38065
227 Ga0307513_10000021 3300031456 Bacteria 228078
228 Ga0307509_10053655 3300031507 Bacteria 4296
229 Ga0307408_100000076 3300031548 Bacteria 110987
230 Ga0307408_100000284 3300031548 Bacteria 50374
231 Ga0307408_100003415 3300031548 Bacteria 10896
232 Ga0307408_100007271 3300031548 Bacteria 7324
233 Ga0307508_10000050 3300031616 Bacteria 135222
234 Ga0307508_10002026 3300031616 Bacteria 21974
235 Ga0307514_10001748 3300031649 Bacteria 24813
236 Ga0307516_10004583 3300031730 Bacteria 16974
237 Ga0307405_10042543 3300031731 Bacteria 2766
238 Ga0307406_10000151 3300031901 Bacteria 41040
239 Ga0307507_10023843 3300033179 Bacteria 6693
240 Ga0373930_0003315 3300034816 Bacteria 2545
241 Ga0373931_0027306 3300035691 Bacteria 2913
242 Ga0395899_0033481 3300037312 Bacteria 3859
243 Ga0395900_0152565 3300037418 Bacteria 2360
244 Ga0395905_0000443 3300037471 Bacteria 58027
245 Ga0395905_0032813 3300037471 Bacteria 4881
246 Ga0395905_0071033 3300037471 Bacteria 3264
247 Ga0395905_0074657 3300037471 Bacteria 3178
248 Ga0451802_0323986 3300041460 Bacteria 4168
249 Ga0439442_002394 3300042002 Bacteria 3682
250 Ga0450920_008993 3300042122 Bacteria 1836
251 Ga0439434_0007318 3300042435 Bacteria 3235
252 Ga0439434_0007836 3300042435 Bacteria 3131
253 Ga0450918_002183 3300042531 Bacteria 3733
254 Ga0451577_0016253 3300042876 Bacteria 6896
255 Ga0466961_0024338 3300044693 Bacteria 3895
256 Ga0453684_0256092 3300044712 Bacteria 2007
257 Ga0466970_0026491 3300044765 Bacteria 3038
258 Ga0466959_0042772 3300045049 Bacteria 3341
259 Ga0495617_000025 3300046452 Bacteria 164547
260 Ga0495590_0023256 3300046457 Bacteria 2189
261 Ga0495638_0008443 3300046460 Bacteria 7305
262 Ga0495650_0000141 3300046471 Bacteria 168676
263 Ga0495580_0065226 3300046472 Bacteria 2551
264 Ga0495585_0000578 3300046492 Bacteria 34546
265 Ga0495631_0024636 3300046518 Bacteria 2779
266 Ga0495632_0044614 3300046519 Bacteria 2212
267 Ga0495644_0002372 3300046523 Bacteria 7509
268 Ga0495648_0006619 3300046524 Bacteria 9396
269 Ga0495597_0029948 3300046542 Bacteria 2482
270 Ga0495633_0001894 3300046558 Bacteria 15254
271 Ga0495668_0000232 3300046616 Bacteria 79391
272 Ga0495668_0001360 3300046616 Bacteria 23981
273 Ga0495625_0000012 3300046660 Bacteria 363006
274 Ga0495625_0005845 3300046660 Bacteria 11093
275 Ga0495625_0096022 3300046660 Bacteria 2042
276 Ga0495661_0042738 3300046665 Bacteria 2791
277 Ga0495671_0000064 3300046692 Bacteria 106374
278 Ga0495649_0006708 3300046694 Bacteria 7141
279 Ga0495672_0010425 3300047320 Bacteria 6619
280 Ga0495680_0096592 3300047322 Bacteria 2206
281 Ga0495687_000523 3300047443 Bacteria 46029
282 Ga0495687_000918 3300047443 Bacteria 30658
283 Ga0495687_009245 3300047443 Bacteria 5533
284 Ga0495687_013680 3300047443 Bacteria 4217
285 Ga0495685_000008 3300047447 Bacteria 95629
286 Ga0495673_0000008 3300047469 Bacteria 752462
287 Ga0495673_0000009 3300047469 Bacteria 731993
288 Ga0495686_0002356 3300047472 Bacteria 18020
289 Ga0495686_0007722 3300047472 Bacteria 8025
290 Ga0495686_0036894 3300047472 Bacteria 3135
291 Ga0496102_0005091 3300048905 Bacteria 11137
292 Ga0496106_0003452 3300048909 Bacteria 11776
293 Ga0496109_0014086 3300048912 Bacteria 6952
294 Ga0496110_0006945 3300048913 Bacteria 9005
295 Ga0496114_0091521 3300048917 Bacteria 2583
296 Ga0496116_0007511 3300048919 Bacteria 9649
297 Ga0496118_0000673 3300048921 Bacteria 55557
298 Ga0496121_0012533 3300048924 Bacteria 9228
299 Ga0496122_0000142 3300048925 Bacteria 168391
300 Ga0496123_0000148 3300048926 Bacteria 143265
301 Ga0496125_0007259 3300048928 Bacteria 11805
302 Ga0496125_0072390 3300048928 Bacteria 2685
303 Ga0495678_004573 3300049459 Bacteria 7959
304 Ga0495682_0000064 3300049460 Bacteria 98866
305 Ga0495682_0000267 3300049460 Bacteria 41267
306 Ga0501032_0058559 3300049569 Bacteria 2586
307 Ga0501032_0073583 3300049569 Bacteria 2276
308 Ga0501033_0001474 3300049570 Bacteria 20818
309 Ga0501034_0106453 3300049571 Bacteria 2797
310 Ga0501034_0144917 3300049571 Bacteria 2353
311 Ga0501036_0141547 3300049572 Bacteria 2030
312 Ga0501038_0006326 3300049574 Bacteria 10955
313 Ga0501038_0008658 3300049574 Bacteria 9346
314 Ga0501038_0024974 3300049574 Bacteria 5328
315 Ga0501038_0030050 3300049574 Bacteria 4810
316 Ga0501038_0125538 3300049574 Bacteria 2112
317 Ga0501039_0004711 3300049575 Bacteria 10326
318 Ga0501040_0015777 3300049576 Bacteria 4994
319 Ga0501043_0010736 3300049579 Bacteria 7172
320 Ga0501046_0000433 3300049580 Bacteria 41959
321 Ga0501046_0003850 3300049580 Bacteria 13733
322 Ga0501047_0014218 3300049581 Bacteria 7564
323 Ga0501047_0052281 3300049581 Bacteria 3949
324 Ga0501047_0147526 3300049581 Bacteria 2229
325 Ga0501048_0005195 3300049582 Bacteria 9919
326 Ga0501067_0010146 3300049583 Bacteria 5210
327 Ga0501070_0021689 3300049586 Bacteria 5385
328 Ga0501070_0048575 3300049586 Bacteria 3524
329 Ga0501071_0050008 3300049587 Bacteria 3010
330 Ga0501074_0026620 3300049590 Bacteria 4193
331 Ga0501075_0106009 3300049591 Bacteria 2136
332 Ga0501077_0000951 3300049593 Bacteria 17462
333 Ga0501080_0005552 3300049742 Bacteria 11263
334 Ga0501080_0058478 3300049742 Bacteria 3588
335 Ga0501080_0118980 3300049742 Bacteria 2449
336 Ga0501035_0067227 3300049822 Bacteria 3181
337 Ga0501035_0094883 3300049822 Bacteria 2623
338 Ga0501044_0008771 3300049823 Bacteria 11060
339 Ga0501044_0100942 3300049823 Bacteria 2903
340 Ga0501045_0015983 3300049824 Bacteria 5324
341 nmdc:mga0k408_3596_c1 3300050493 Bacteria 8195
342 nmdc:mga0k408_70357_c1 3300050493 Bacteria 2042
343 nmdc:mga07m45_29054_c1 3300050496 Bacteria 3054
344 nmdc:mga05p37_72081_c1 3300050507 Bacteria 4250
345 nmdc:mga0qj67_19349_c1 3300050509 Bacteria 5200
346 nmdc:mga08y16_50893_c1 3300050511 Bacteria 4335
347 Ga0500610_0000707 3300053079 Bacteria 10383
348 Ga0500643_000522 3300053087 Bacteria 27015
349 Ga0500583_0016365 3300053092 Bacteria 2958
350 Ga0500651_0000662 3300053093 Bacteria 17150
351 Ga0500651_0000786 3300053093 Bacteria 15478
352 Ga0500597_000099 3300053120 Bacteria 17806
353 Ga0500607_004230 3300053121 Bacteria 10000
354 Ga0500564_004313 3300053138 Bacteria 5678
355 Ga0500586_000878 3300053145 Bacteria 6205
356 Ga0500622_0000019 3300053156 Bacteria 275028
357 Ga0500636_0000423 3300053177 Bacteria 23230
358 Ga0500637_0012578 3300053178 Bacteria 4415
359 Ga0500645_000229 3300053730 Bacteria 42795
360 Ga0500645_001897 3300053730 Bacteria 9957
361 Ga0500645_003240 3300053730 Bacteria 6728
362 Ga0501084_0015596 3300054114 Bacteria 6302
363 Ga0501084_0018495 3300054114 Bacteria 5800
364 Ga0500661_001107 3300055283 Bacteria 5060
365 Ga0501082_0000075 3300060353 Bacteria 73206
366 Ga0501082_0039685 3300060353 Bacteria 4061
367 Ga0501082_0097748 3300060353 Bacteria 2538

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049590 Ga0501074_0026620 Ga0501074_0026620_2868_4175 421
2 3300046460 Ga0495638_0008443 Ga0495638_0008443_10_1488 470
3 3300005367 Ga0070667_100109160 Ga0070667_1001091602 473
4 3300005548 Ga0070665_100000028 Ga0070665_100000028267 478
5 3300028379 Ga0268266_10000017 Ga0268266_10000017410 478
6 3300048917 Ga0496114_0091521 Ga0496114_0091521_31_1680 480
7 3300049574 Ga0501038_0024974 Ga0501038_0024974_80_1630 486
8 3300053093 Ga0500651_0000786 Ga0500651_0000786_1223_2929 490
9 3300005455 Ga0070663_100054443 Ga0070663_1000544432 492
10 3300031250 Ga0265331_10007563 Ga0265331_100075631 493
11 3300034816 Ga0373930_0003315 Ga0373930_0003315_319_2034 494
12 3300035691 Ga0373931_0027306 Ga0373931_0027306_871_2586 494
13 3300048921 Ga0496118_0000673 Ga0496118_0000673_37018_38712 494
14 3300046524 Ga0495648_0006619 Ga0495648_0006619_4783_6504 497
15 3300046692 Ga0495671_0000064 Ga0495671_0000064_15864_17585 497
16 3300046665 Ga0495661_0042738 Ga0495661_0042738_70_1785 498
17 3300047469 Ga0495673_0000009 Ga0495673_0000009_199064_200779 498
18 3300006237 Ga0097621_100031193 Ga0097621_1000311934 500
19 3300049581 Ga0501047_0147526 Ga0501047_0147526_416_2110 500
20 3300049742 Ga0501080_0058478 Ga0501080_0058478_706_2400 500
21 3300041460 Ga0451802_0323986 Ga0451802_0323986_2083_3810 503
22 3300050507 nmdc:mga05p37_72081_c1 nmdc:mga05p37_72081_c1_1256_2908 504
23 3300031548 Ga0307408_100003415 Ga0307408_1000034156 507
24 3300047472 Ga0495686_0002356 Ga0495686_0002356_12462_14192 507
25 3300031548 Ga0307408_100000076 Ga0307408_10000007648 509
26 3300049571 Ga0501034_0144917 Ga0501034_0144917_432_2159 509
27 3300028794 Ga0307515_10009443 Ga0307515_1000944311 510
28 3300031730 Ga0307516_10004583 Ga0307516_100045833 510
29 3300046519 Ga0495632_0044614 Ga0495632_0044614_181_1887 510
30 3300046660 Ga0495625_0005845 Ga0495625_0005845_5052_6758 510
31 3300047472 Ga0495686_0036894 Ga0495686_0036894_719_2425 510
32 3300053730 Ga0500645_001897 Ga0500645_001897_3872_5587 510
33 3300048909 Ga0496106_0003452 Ga0496106_0003452_3830_5545 511
34 3300046452 Ga0495617_000025 Ga0495617_000025_98231_99946 512
35 3300046471 Ga0495650_0000141 Ga0495650_0000141_117447_119162 512
36 3300046492 Ga0495585_0000578 Ga0495585_0000578_12008_13723 512
37 3300046616 Ga0495668_0000232 Ga0495668_0000232_65279_66994 512
38 3300053145 Ga0500586_000878 Ga0500586_000878_4252_5967 512
39 3300028794 Ga0307515_10018380 Ga0307515_1001838022 515
40 3300031616 Ga0307508_10000050 Ga0307508_10000050120 515
41 3300033179 Ga0307507_10023843 Ga0307507_100238432 515
42 3300053087 Ga0500643_000522 Ga0500643_000522_17833_19545 515
43 3300053120 Ga0500597_000099 Ga0500597_000099_15006_16718 515
44 3300005339 Ga0070660_100004366 Ga0070660_1000043662 516
45 3300005366 Ga0070659_100017713 Ga0070659_1000177131 516
46 3300017792 Ga0163161_10022825 Ga0163161_100228253 516
47 3300025294 Ga0209025_1026971 Ga0209025_10269712 516
48 3300025919 Ga0207657_10007018 Ga0207657_100070186 516
49 3300025920 Ga0207649_10004952 Ga0207649_100049524 516
50 3300025945 Ga0207679_10011614 Ga0207679_100116142 516
51 3300028794 Ga0307515_10001082 Ga0307515_1000108222 516
52 3300042435 Ga0439434_0007836 Ga0439434_0007836_563_2248 516
53 3300049822 Ga0501035_0094883 Ga0501035_0094883_694_2445 517
54 3300046518 Ga0495631_0024636 Ga0495631_0024636_546_2267 518
55 3300046660 Ga0495625_0000012 Ga0495625_0000012_239133_240836 518
56 3300046694 Ga0495649_0006708 Ga0495649_0006708_3817_5538 518
57 3300049572 Ga0501036_0141547 Ga0501036_0141547_101_1795 518
58 3300003773 Ga0055537_1000031 Ga0055537_10000312 519
59 3300003784 Ga0055534_1000375 Ga0055534_100037523 519
60 3300003790 Ga0055528_1000592 Ga0055528_100059222 519
61 3300006844 Ga0075428_100061286 Ga0075428_1000612865 519
62 3300006846 Ga0075430_100037628 Ga0075430_1000376282 519
63 3300006948 Ga0099826_10001304 Ga0099826_100013045 519
64 3300009094 Ga0111539_10020549 Ga0111539_100205497 519
65 3300025246 Ga0209646_1000042 Ga0209646_100004275 519
66 3300025263 Ga0209565_1000087 Ga0209565_100008750 519
67 3300025273 Ga0209673_1000145 Ga0209673_100014550 519
68 3300025291 Ga0209675_1000085 Ga0209675_100008550 519
69 3300027666 Ga0209282_1000473 Ga0209282_100047314 519
70 3300049574 Ga0501038_0030050 Ga0501038_0030050_494_2188 519
71 3300049576 Ga0501040_0015777 Ga0501040_0015777_2681_4375 519
72 3300049580 Ga0501046_0003850 Ga0501046_0003850_8631_10280 519
73 3300049582 Ga0501048_0005195 Ga0501048_0005195_2433_4127 519
74 3300049587 Ga0501071_0050008 Ga0501071_0050008_600_2294 519
75 3300050509 nmdc:mga0qj67_19349_c1 nmdc:mga0qj67_19349_c1_701_2407 519
76 3300050511 nmdc:mga08y16_50893_c1 nmdc:mga08y16_50893_c1_1553_3259 519
77 3300054114 Ga0501084_0015596 Ga0501084_0015596_2644_4338 519
78 3300006042 Ga0075368_10002306 Ga0075368_100023064 520
79 3300031649 Ga0307514_10001748 Ga0307514_1000174820 520
80 3300049824 Ga0501045_0015983 Ga0501045_0015983_314_2008 520
81 3300053079 Ga0500610_0000707 Ga0500610_0000707_5280_6983 520
82 3300060353 Ga0501082_0039685 Ga0501082_0039685_1921_3615 520
83 3300037471 Ga0395905_0071033 Ga0395905_0071033_246_1943 521
84 3300037471 Ga0395905_0000443 Ga0395905_0000443_16066_17754 522
85 3300005367 Ga0070667_100000243 Ga0070667_10000024316 523
86 3300013306 Ga0163162_10011446 Ga0163162_100114467 523
87 3300025941 Ga0207711_10001227 Ga0207711_1000122724 523
88 3300025986 Ga0207658_10000203 Ga0207658_1000020316 523
89 3300047443 Ga0495687_013680 Ga0495687_013680_2106_3824 523
90 3300049571 Ga0501034_0106453 Ga0501034_0106453_96_1802 523
91 3300049742 Ga0501080_0118980 Ga0501080_0118980_456_2147 523
92 3300049823 Ga0501044_0100942 Ga0501044_0100942_161_1852 523
93 3300005455 Ga0070663_100000141 Ga0070663_10000014126 525
94 3300009177 Ga0105248_10000367 Ga0105248_100003674 525
95 3300025913 Ga0207695_10184094 Ga0207695_101840942 525
96 3300025914 Ga0207671_10000618 Ga0207671_1000061829 525
97 3300026067 Ga0207678_10003856 Ga0207678_100038564 525
98 3300031251 Ga0265327_10001075 Ga0265327_1000107519 525
99 3300047472 Ga0495686_0007722 Ga0495686_0007722_212_1924 525
100 3300048925 Ga0496122_0000142 Ga0496122_0000142_97656_99368 525
101 3300048926 Ga0496123_0000148 Ga0496123_0000148_87739_89451 525
102 3300049570 Ga0501033_0001474 Ga0501033_0001474_11630_13321 525
103 3300049574 Ga0501038_0006326 Ga0501038_0006326_7773_9464 525
104 3300049575 Ga0501039_0004711 Ga0501039_0004711_7095_8786 525
105 3300049579 Ga0501043_0010736 Ga0501043_0010736_2253_3944 525
106 3300049580 Ga0501046_0000433 Ga0501046_0000433_6758_8449 525
107 3300049581 Ga0501047_0014218 Ga0501047_0014218_48_1739 525
108 3300049586 Ga0501070_0021689 Ga0501070_0021689_3366_5057 525
109 3300049742 Ga0501080_0005552 Ga0501080_0005552_2253_3944 525
110 3300049822 Ga0501035_0067227 Ga0501035_0067227_1341_3038 525
111 3300049823 Ga0501044_0008771 Ga0501044_0008771_7498_9189 525
112 3300054114 Ga0501084_0018495 Ga0501084_0018495_418_2115 525
113 3300060353 Ga0501082_0000075 Ga0501082_0000075_8684_10381 525
114 3300060353 Ga0501082_0097748 Ga0501082_0097748_409_2100 525
115 3300009553 Ga0105249_10000346 Ga0105249_1000034623 526
116 3300025961 Ga0207712_10000297 Ga0207712_1000029723 526
117 3300030521 Ga0307511_10001587 Ga0307511_1000158721 526
118 3300053092 Ga0500583_0016365 Ga0500583_0016365_542_2452 526
119 3300053156 Ga0500622_0000019 Ga0500622_0000019_110491_112197 526
120 3300003322 rootL2_10032903 rootL2_100329037 528
121 3300025934 Ga0207686_10002130 Ga0207686_1000213012 528
122 3300049583 Ga0501067_0010146 Ga0501067_0010146_2435_4108 528
123 3300031616 Ga0307508_10002026 Ga0307508_1000202621 530
124 3300042876 Ga0451577_0016253 Ga0451577_0016253_672_2345 530
125 3300053093 Ga0500651_0000662 Ga0500651_0000662_5789_7528 530
126 3300005367 Ga0070667_100153269 Ga0070667_1001532691 531
127 3300005841 Ga0068863_100049913 Ga0068863_1000499134 531
128 3300005842 Ga0068858_100124606 Ga0068858_1001246062 531
129 3300006237 Ga0097621_100095376 Ga0097621_1000953761 531
130 3300006358 Ga0068871_100094227 Ga0068871_1000942271 531
131 3300013296 Ga0157374_10113974 Ga0157374_101139742 531
132 3300013306 Ga0163162_10098024 Ga0163162_100980242 531
133 3300013308 Ga0157375_10099112 Ga0157375_100991122 531
134 3300014968 Ga0157379_10067294 Ga0157379_100672942 531
135 3300025926 Ga0207659_10063210 Ga0207659_100632102 531
136 3300025942 Ga0207689_10002943 Ga0207689_1000294310 531
137 3300026035 Ga0207703_10046989 Ga0207703_100469893 531
138 3300026088 Ga0207641_10042255 Ga0207641_100422553 531
139 3300049586 Ga0501070_0048575 Ga0501070_0048575_134_1774 531
140 3300006353 Ga0075370_10027303 Ga0075370_100273032 533
141 3300046616 Ga0495668_0001360 Ga0495668_0001360_9819_11546 533
142 3300050496 nmdc:mga07m45_29054_c1 nmdc:mga07m45_29054_c1_495_2225 533
143 3300005367 Ga0070667_100079711 Ga0070667_1000797113 534
144 3300006177 Ga0075362_10013817 Ga0075362_100138173 534
145 3300009545 Ga0105237_10039172 Ga0105237_100391724 534
146 3300014326 Ga0157380_10028186 Ga0157380_100281863 534
147 3300031507 Ga0307509_10053655 Ga0307509_100536554 534
148 3300031731 Ga0307405_10042543 Ga0307405_100425432 534
149 3300005356 Ga0070674_100049437 Ga0070674_1000494372 535
150 3300044693 Ga0466961_0024338 Ga0466961_0024338_838_2526 535
151 3300044765 Ga0466970_0026491 Ga0466970_0026491_1111_2799 535
152 3300045049 Ga0466959_0042772 Ga0466959_0042772_986_2674 535
153 3300047443 Ga0495687_009245 Ga0495687_009245_1688_3421 535
154 3300005468 Ga0070707_100055045 Ga0070707_1000550452 536
155 3300048905 Ga0496102_0005091 Ga0496102_0005091_6903_8591 536
156 3300005445 Ga0070708_100033862 Ga0070708_1000338623 537
157 3300006038 Ga0075365_10105910 Ga0075365_101059101 537
158 3300006048 Ga0075363_100018214 Ga0075363_1000182142 537
159 3300006051 Ga0075364_10002654 Ga0075364_100026548 537
160 3300048912 Ga0496109_0014086 Ga0496109_0014086_2642_4357 537
161 3300049591 Ga0501075_0106009 Ga0501075_0106009_312_2057 537
162 3300049593 Ga0501077_0000951 Ga0501077_0000951_2917_4662 537
163 3300050493 nmdc:mga0k408_3596_c1 nmdc:mga0k408_3596_c1_688_2394 537
164 3300005288 Ga0065714_10003467 Ga0065714_100034676 538
165 3300005467 Ga0070706_100036580 Ga0070706_1000365803 538
166 3300042002 Ga0439442_002394 Ga0439442_002394_1320_3023 538
167 3300042122 Ga0450920_008993 Ga0450920_008993_68_1771 538
168 3300042435 Ga0439434_0007318 Ga0439434_0007318_143_1846 538
169 3300042531 Ga0450918_002183 Ga0450918_002183_1572_3275 538
170 3300005539 Ga0068853_100059147 Ga0068853_1000591473 539
171 3300005616 Ga0068852_100012406 Ga0068852_1000124065 539
172 3300006048 Ga0075363_100019073 Ga0075363_1000190732 539
173 3300006178 Ga0075367_10004443 Ga0075367_100044431 539
174 3300006195 Ga0075366_10066160 Ga0075366_100661602 539
175 3300006353 Ga0075370_10011655 Ga0075370_100116553 539
176 3300006353 Ga0075370_10024103 Ga0075370_100241032 539
177 3300009093 Ga0105240_10063202 Ga0105240_100632023 539
178 3300009148 Ga0105243_10047881 Ga0105243_100478813 539
179 3300009177 Ga0105248_10010183 Ga0105248_100101832 539
180 3300010375 Ga0105239_10009057 Ga0105239_1000905712 539
181 3300025925 Ga0207650_10057280 Ga0207650_100572802 539
182 3300026067 Ga0207678_10049967 Ga0207678_100499673 539
183 3300026089 Ga0207648_10056489 Ga0207648_100564892 539
184 3300027876 Ga0209974_10003326 Ga0209974_100033266 539
185 3300050493 nmdc:mga0k408_70357_c1 nmdc:mga0k408_70357_c1_70_1788 539
186 3300009093 Ga0105240_10003249 Ga0105240_1000324914 541
187 3300009545 Ga0105237_10001152 Ga0105237_1000115229 541
188 3300010375 Ga0105239_10000248 Ga0105239_1000024829 541
189 3300013296 Ga0157374_10013244 Ga0157374_100132446 541
190 3300046472 Ga0495580_0065226 Ga0495580_0065226_796_2505 543
191 3300048913 Ga0496110_0006945 Ga0496110_0006945_6513_8228 543
192 3300049574 Ga0501038_0008658 Ga0501038_0008658_3335_5044 543
193 3300048919 Ga0496116_0007511 Ga0496116_0007511_2801_4540 544
194 3300005336 Ga0070680_100071576 Ga0070680_1000715761 545
195 3300046558 Ga0495633_0001894 Ga0495633_0001894_13220_14941 548
196 3300049460 Ga0495682_0000267 Ga0495682_0000267_1986_3707 548
197 3300031548 Ga0307408_100000284 Ga0307408_10000028441 549
198 3300031901 Ga0307406_10000151 Ga0307406_100001515 549
199 3300037418 Ga0395900_0152565 Ga0395900_0152565_491_2176 549
200 3300037471 Ga0395905_0032813 Ga0395905_0032813_1461_3146 549
201 3300047469 Ga0495673_0000008 Ga0495673_0000008_224960_226678 549
202 3300005334 Ga0068869_100056189 Ga0068869_1000561892 550
203 3300005335 Ga0070666_10065248 Ga0070666_100652482 550
204 3300005338 Ga0068868_100037508 Ga0068868_1000375083 550
205 3300005347 Ga0070668_100000226 Ga0070668_1000002261 550
206 3300005353 Ga0070669_100002510 Ga0070669_1000025104 550
207 3300005354 Ga0070675_100035821 Ga0070675_1000358214 550
208 3300005365 Ga0070688_100027720 Ga0070688_1000277201 550
209 3300005367 Ga0070667_100022578 Ga0070667_1000225784 550
210 3300005456 Ga0070678_100041958 Ga0070678_1000419583 550
211 3300005459 Ga0068867_100064033 Ga0068867_1000640332 550
212 3300005617 Ga0068859_100069161 Ga0068859_1000691612 550
213 3300005618 Ga0068864_100055700 Ga0068864_1000557002 550
214 3300005842 Ga0068858_100001271 Ga0068858_10000127114 550
215 3300006237 Ga0097621_100024512 Ga0097621_1000245123 550
216 3300006358 Ga0068871_100046570 Ga0068871_1000465702 550
217 3300006931 Ga0097620_100069157 Ga0097620_1000691572 550
218 3300009553 Ga0105249_10167993 Ga0105249_101679931 550
219 3300013296 Ga0157374_10047660 Ga0157374_100476603 550
220 3300025315 Ga0207697_10011904 Ga0207697_100119042 550
221 3300025907 Ga0207645_10001677 Ga0207645_100016772 550
222 3300025926 Ga0207659_10053743 Ga0207659_100537432 550
223 3300025942 Ga0207689_10018472 Ga0207689_100184725 550
224 3300026023 Ga0207677_10048346 Ga0207677_100483462 550
225 3300026035 Ga0207703_10119819 Ga0207703_101198192 550
226 3300026089 Ga0207648_10006048 Ga0207648_100060487 550
227 3300026121 Ga0207683_10000063 Ga0207683_1000006377 550
228 3300028381 Ga0268264_10134647 Ga0268264_101346472 550
229 3300046457 Ga0495590_0023256 Ga0495590_0023256_394_2112 550
230 3300046523 Ga0495644_0002372 Ga0495644_0002372_1822_3540 550
231 3300047443 Ga0495687_000918 Ga0495687_000918_16152_17870 550
232 3300047447 Ga0495685_000008 Ga0495685_000008_41141_42859 550
233 3300049459 Ga0495678_004573 Ga0495678_004573_563_2281 550
234 3300049460 Ga0495682_0000064 Ga0495682_0000064_90595_92313 550
235 3300053730 Ga0500645_000229 Ga0500645_000229_31490_33199 550
236 3300046542 Ga0495597_0029948 Ga0495597_0029948_36_1769 551
237 3300046660 Ga0495625_0096022 Ga0495625_0096022_231_1964 551
238 3300005458 Ga0070681_10048704 Ga0070681_100487042 553
239 3300009147 Ga0114129_10039584 Ga0114129_100395846 553
240 3300003758 Ga0055532_1000797 Ga0055532_10007978 554
241 3300003761 Ga0055535_1000100 Ga0055535_100010017 554
242 3300003762 Ga0055542_1006081 Ga0055542_10060811 554
243 3300005364 Ga0070673_100172983 Ga0070673_1001729831 554
244 3300009177 Ga0105248_10059245 Ga0105248_100592453 554
245 3300017792 Ga0163161_10011770 Ga0163161_100117704 554
246 3300025228 Ga0209672_100015 Ga0209672_100015124 554
247 3300025229 Ga0209147_100016 Ga0209147_100016340 554
248 3300025242 Ga0209258_100026 Ga0209258_100026124 554
249 3300025254 Ga0209148_1000798 Ga0209148_100079821 554
250 3300025256 Ga0209759_1009801 Ga0209759_10098012 554
251 3300025272 Ga0209455_1000260 Ga0209455_10002601 554
252 3300025893 Ga0207682_10003843 Ga0207682_100038435 554
253 3300025941 Ga0207711_10097233 Ga0207711_100972332 554
254 3300049569 Ga0501032_0073583 Ga0501032_0073583_188_1912 554
255 3300049574 Ga0501038_0125538 Ga0501038_0125538_302_2026 554
256 3300009553 Ga0105249_10050320 Ga0105249_100503202 555
257 3300025961 Ga0207712_10026068 Ga0207712_100260682 555
258 3300047322 Ga0495680_0096592 Ga0495680_0096592_177_1895 555
259 3300005353 Ga0070669_100021888 Ga0070669_1000218884 556
260 3300005356 Ga0070674_100047009 Ga0070674_1000470092 556
261 3300005459 Ga0068867_100053351 Ga0068867_1000533512 556
262 3300005543 Ga0070672_100085099 Ga0070672_1000850991 556
263 3300025940 Ga0207691_10095518 Ga0207691_100955182 556
264 3300026089 Ga0207648_10056608 Ga0207648_100566083 556
265 3300037312 Ga0395899_0033481 Ga0395899_0033481_252_1967 556
266 3300037471 Ga0395905_0074657 Ga0395905_0074657_1446_3161 556
267 3300053730 Ga0500645_003240 Ga0500645_003240_1716_3419 557
268 3300027252 Ga0209973_1000506 Ga0209973_10005061 558
269 3300027876 Ga0209974_10005907 Ga0209974_100059075 558
270 3300053138 Ga0500564_004313 Ga0500564_004313_2966_4684 558
271 iso_pu_bacteria 2643221628 2644162472 558
272 iso_pu_bacteria 2739367756 2739791369 558
273 3300013306 Ga0163162_10064599 Ga0163162_100645993 559
274 3300003771 Ga0055526_1000251 Ga0055526_100025123 560
275 3300017792 Ga0163161_10121837 Ga0163161_101218372 560
276 3300025295 Ga0209564_1000010 Ga0209564_1000010229 560
277 3300053121 Ga0500607_004230 Ga0500607_004230_6883_8586 560
278 3300053177 Ga0500636_0000423 Ga0500636_0000423_3961_5664 560
279 3300053178 Ga0500637_0012578 Ga0500637_0012578_404_2107 560
280 iso_pu_bacteria 2519103095 2519461715 560
281 iso_pu_bacteria 2582581311 2585293222 560
282 iso_pu_bacteria 2599185239 2599735216 560
283 iso_pu_bacteria 2816332253 2817258590 560
284 iso_pu_bacteria 2816332256 2817280993 560
285 iso_pu_bacteria 2816332286 2817453283 560
286 iso_pu_bacteria 2818991452 2819632124 560
287 iso_pu_bacteria 2863421361 2863422510 560
288 iso_pu_bacteria 2904564687 2904565026 560
289 iso_pu_bacteria 2904571731 2904572278 560
290 iso_pu_bacteria 2928157003 2928157208 560
291 iso_pu_bacteria 2928163908 2928169037 560
292 iso_pu_bacteria 2928170801 2928172293 560
293 iso_pu_bacteria 2928536128 2928537604 560
294 iso_pu_bacteria 2981990288 2981995057 560
295 iso_pu_bacteria 641736154 642418297 560
296 iso_pu_bacteria 8018845410 8018852158 560
297 iso_pu_bacteria 8020807995 8020810489 560
298 iso_pu_bacteria 8020938398 8020939855 560
299 iso_pu_bacteria 8020953355 8020955060 560
300 iso_pu_bacteria 8021120328 8021120562 560
301 iso_pu_bacteria 8039098773 8039101362 560
302 iso_pu_bacteria 8040167225 8040167691 560
303 iso_pu_bacteria 8040173305 8040177750 560
304 iso_pu_bacteria 2599185240 2599743343 561
305 iso_pu_bacteria 2599185355 2600205425 561
306 iso_pu_bacteria 2675903129 2676740722 561
307 iso_pu_bacteria 2818991446 2819596798 561
308 iso_pu_bacteria 2870068957 2870072741 561
309 iso_pu_bacteria 8020945358 8020946450 561
310 3300028794 Ga0307515_10000067 Ga0307515_10000067232 562
311 3300044712 Ga0453684_0256092 Ga0453684_0256092_54_1754 562
312 3300049581 Ga0501047_0052281 Ga0501047_0052281_1058_2749 562
313 iso_pu_bacteria 2738541300 2738842797 562
314 iso_pu_bacteria 2738543018 2739273544 562
315 iso_pu_bacteria 2738543030 2739342588 562
316 iso_pu_bacteria 2643221645 2644255035 563
317 iso_pu_bacteria 2643221664 2644359176 563
318 3300003758 Ga0055532_1001574 Ga0055532_10015743 564
319 3300003758 Ga0055532_1001993 Ga0055532_10019932 564
320 3300003760 Ga0055527_1000782 Ga0055527_10007823 564
321 3300003761 Ga0055535_1000093 Ga0055535_100009319 564
322 3300003762 Ga0055542_1000106 Ga0055542_100010632 564
323 3300003763 Ga0055529_1000124 Ga0055529_100012432 564
324 3300003790 Ga0055528_1001256 Ga0055528_10012565 564
325 3300005327 Ga0070658_10130542 Ga0070658_101305421 564
326 3300005339 Ga0070660_100000002 Ga0070660_10000000225 564
327 3300005455 Ga0070663_100002294 Ga0070663_1000022943 564
328 3300005563 Ga0068855_100030340 Ga0068855_1000303403 564
329 3300005616 Ga0068852_100005330 Ga0068852_1000053303 564
330 3300005842 Ga0068858_100138892 Ga0068858_1001388921 564
331 3300009093 Ga0105240_10103542 Ga0105240_101035422 564
332 3300009545 Ga0105237_10046755 Ga0105237_100467553 564
333 3300009551 Ga0105238_10083192 Ga0105238_100831922 564
334 3300010375 Ga0105239_10032158 Ga0105239_100321584 564
335 3300025225 Ga0209566_100962 Ga0209566_1009627 564
336 3300025228 Ga0209672_100031 Ga0209672_100031189 564
337 3300025229 Ga0209147_100034 Ga0209147_100034211 564
338 3300025229 Ga0209147_100040 Ga0209147_10004089 564
339 3300025242 Ga0209258_100061 Ga0209258_10006193 564
340 3300025254 Ga0209148_1000070 Ga0209148_1000070110 564
341 3300025272 Ga0209455_1000069 Ga0209455_1000069169 564
342 3300025273 Ga0209673_1000026 Ga0209673_100002695 564
343 3300025295 Ga0209564_1002932 Ga0209564_10029329 564
344 3300025914 Ga0207671_10010652 Ga0207671_100106523 564
345 3300025919 Ga0207657_10000012 Ga0207657_10000012131 564
346 3300025924 Ga0207694_10006964 Ga0207694_100069643 564
347 3300025932 Ga0207690_10000008 Ga0207690_10000008301 564
348 3300025940 Ga0207691_10153439 Ga0207691_101534391 564
349 3300025949 Ga0207667_10265854 Ga0207667_102658541 564
350 3300026035 Ga0207703_10112493 Ga0207703_101124932 564
351 3300027312 Ga0209371_1000177 Ga0209371_100017778 564
352 3300030500 Ga0268256_1000799 Ga0268256_100079917 564
353 iso_pu_bacteria 2511231002 2511244269 564
354 iso_pu_bacteria 2945984333 2945986553 564
355 iso_pu_bacteria 639633007 639786031 564
356 3300003320 rootH2_10050623 rootH2_100506233 565
357 3300009093 Ga0105240_10000600 Ga0105240_1000060039 565
358 3300025913 Ga0207695_10003274 Ga0207695_100032743 565
359 3300047443 Ga0495687_000523 Ga0495687_000523_26992_28710 565
360 iso_pu_bacteria 2643221570 2643866994 565
361 iso_pu_bacteria 2643221596 2643993706 565
362 iso_pu_bacteria 2643221609 2644060843 565
363 iso_pu_bacteria 2643221611 2644074522 565
364 iso_pu_bacteria 2643221652 2644294845 565
365 iso_pu_bacteria 2643221717 2644646264 565
366 iso_pu_bacteria 2738543012 2739246102 565
367 iso_pu_bacteria 2808606384 2808973307 565
368 iso_pu_bacteria 2808606390 2809008755 565
369 iso_pu_bacteria 2808606391 2809014960 565
370 iso_pu_bacteria 2816332133 2816476010 565
371 iso_pu_bacteria 2842718218 2842721038 565
372 iso_pu_bacteria 2974320154 2974323951 565
373 iso_pu_bacteria 2990710928 2990712979 565
374 3300048924 Ga0496121_0012533 Ga0496121_0012533_491_2191 566
375 3300048928 Ga0496125_0007259 Ga0496125_0007259_5742_7442 566
376 3300048928 Ga0496125_0072390 Ga0496125_0072390_589_2289 566
377 3300049569 Ga0501032_0058559 Ga0501032_0058559_761_2470 566
378 3300031456 Ga0307513_10000021 Ga0307513_1000002127 568
379 3300002704 JGI25155J39150_1000008 JGI25155J39150_100000844 569
380 3300002705 JGI25156J39149_1000002 JGI25156J39149_1000002212 569
381 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010106 569
382 3300002741 JGI25157J39369_1000001 JGI25157J39369_1000001233 569
383 3300002987 JGI25159J45721_1001361 JGI25159J45721_10013618 569
384 3300003354 JGI25160J50197_1000156 JGI25160J50197_100015627 569
385 3300003374 JGI25161J50226_1000043 JGI25161J50226_100004351 569
386 3300003773 Ga0055537_1002011 Ga0055537_10020116 569
387 3300003775 Ga0055524_1000166 Ga0055524_100016641 569
388 3300003781 Ga0055536_1000085 Ga0055536_100008539 569
389 3300003784 Ga0055534_1000801 Ga0055534_10008013 569
390 3300003790 Ga0055528_1000844 Ga0055528_10008446 569
391 3300003791 Ga0055530_10000254 Ga0055530_1000025436 569
392 3300003792 Ga0055540_1000079 Ga0055540_100007967 569
393 3300003794 Ga0055531_10000623 Ga0055531_1000062326 569
394 3300004625 Ga0055543_1000160 Ga0055543_100016023 569
395 3300009176 Ga0105242_10007948 Ga0105242_100079486 569
396 3300025206 Ga0209435_100001 Ga0209435_1000011086 569
397 3300025245 Ga0207425_1001152 Ga0207425_100115211 569
398 3300025246 Ga0209646_1000001 Ga0209646_10000011455 569
399 3300025250 Ga0209026_1000001 Ga0209026_1000001107 569
400 3300025256 Ga0209759_1000001 Ga0209759_10000011086 569
401 3300025263 Ga0209565_1000096 Ga0209565_100009642 569
402 3300025263 Ga0209565_1000423 Ga0209565_100042331 569
403 3300025273 Ga0209673_1000232 Ga0209673_100023288 569
404 3300025284 Ga0209130_1000041 Ga0209130_1000041122 569
405 3300025284 Ga0209130_1000286 Ga0209130_100028626 569
406 3300025291 Ga0209675_1000195 Ga0209675_100019546 569
407 3300025291 Ga0209675_1002450 Ga0209675_10024508 569
408 3300025292 Ga0209676_1000054 Ga0209676_1000054247 569
409 3300025294 Ga0209025_1011469 Ga0209025_10114693 569
410 3300025295 Ga0209564_1000463 Ga0209564_100046329 569
411 3300025295 Ga0209564_1000534 Ga0209564_100053427 569
412 3300025298 Ga0209050_1000066 Ga0209050_1000066247 569
413 3300025298 Ga0209050_1004870 Ga0209050_10048708 569
414 3300025299 Ga0209256_1000003 Ga0209256_10000031519 569
415 3300025302 Ga0207426_1000061 Ga0207426_1000061119 569
416 3300025303 Ga0209051_1000044 Ga0209051_1000044247 569
417 3300025304 Ga0209257_1000082 Ga0209257_1000082247 569
418 3300025304 Ga0209257_1009713 Ga0209257_10097134 569
419 3300031548 Ga0307408_100007271 Ga0307408_1000072714 569
420 3300047320 Ga0495672_0010425 Ga0495672_0010425_2229_3953 569
421 3300055283 Ga0500661_001107 Ga0500661_001107_1552_3270 569

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

429

544

0.96

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

15

390

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j9u-assembly2.cif.gz_F crystal structure of the trkh/trka potassium transport complex 0.8927 427 542
3cp8-assembly2.cif.gz_D crystal structure of gida from chlorobium tepidum 0.8921 425 457
3fwz-assembly1.cif.gz_B crystal structure of trka-n domain of inner membrane protein ybal from escherichia coli 0.8821 425 555
4g65-assembly1.cif.gz_A potassium transporter peripheral membrane component (trka) from vibrio vulnificus 0.876 425 542
3fwz-assembly1.cif.gz_B crystal structure of trka-n domain of inner membrane protein ybal from escherichia coli 0.8508 425 555
ID Description Score Start End Superfamily
af_P39830_6_397_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9649 8 399 1.20.1530.20
af_P39830_6_397_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9505 8 399 1.20.1530.20
3coxA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9266 427 457 3.50.50.60
af_A0A1D6MVG0_125_298_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9024 219 391 1.20.1530.20
af_Q0DVI9_1_189_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.895 211 391 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A3D3LAR8-F1-model_v4 Portal protein 0.9361 8 348 GO:0015297
GO:0016020
GO:1902600
AF-A0A3S4M0X1-F1-model_v4 Transport protein 0.9335 116 389 GO:0005886
GO:0015297
GO:1902600
AF-A0A537J0C5-F1-model_v4 Cation/H+ exchanger transmembrane domain-containing protein 0.9291 233 386 GO:0015297
GO:0016020
GO:1902600
AF-A0A381G3V5-F1-model_v4 deleted 0.9257 1 364
AF-A0A3S4M0X1-F1-model_v4 Transport protein 0.9238 116 389 GO:0005886
GO:0015297
GO:1902600

Feature Viewer

pLDDT pTM Quality
80.98 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map