F439902

General Info

Members Datasets Scaffolds Average Seq Length
421 205 842 273

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10068386|Ga0065712_100683866
Length 279
Sequence MSGRRVRVPDLRHKKQAGEKIAMLTAYDATMARLFDRAGIDVILVGDSLASVILGHQHTLTVTLDAMIHHTGAVARGTEHALVVTDMPFLTYQVSVEEAVRNAGRLLQSGASAVKLEGGRPVLDVVRRLVDVGIPVMGHLGLQPQSVHQLGGYGRRGSEPHEAAALVEDAVALEQAGAFAIVLESIPPELAQTVTKRVDVPTIGIGSGADCDGQVLVSYDMLGLFEGPVPSFVKQYANLASTVTIAARAYIDEVRSGSYPTTRSTISSSSKPLGTGTEG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
150 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
151 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
202 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.48
Rhizosphere 99.29
Stem 0
Stem Tuber 0
Unclassified 2.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10068386 3300005290 Bacteria 11051
2 JGI24746J21847_1002750 3300001977 Bacteria 2772
3 JGI24749J21850_1008540 3300002076 Bacteria 1429
4 Ga0065712_10009384 3300005290 Bacteria 2436
5 Ga0065715_10092008 3300005293 Bacteria 5394
6 Ga0065715_10104369 3300005293 Bacteria 2966
7 Ga0065707_10000708 3300005295 Bacteria 23505
8 Ga0065707_10028059 3300005295 Bacteria 1136
9 Ga0070676_10118006 3300005328 Bacteria 1661
10 Ga0070690_100013406 3300005330 Bacteria 4842
11 Ga0070690_100485617 3300005330 Bacteria 922
12 Ga0070670_100194865 3300005331 Bacteria 1760
13 Ga0070670_100270074 3300005331 Bacteria 1484
14 Ga0070677_10000496 3300005333 Bacteria 13547
15 Ga0070677_10008440 3300005333 Unclassified 3466
16 Ga0068869_100027596 3300005334 Bacteria 3960
17 Ga0068869_100035529 3300005334 Bacteria 3532
18 Ga0070666_10014675 3300005335 Bacteria 4989
19 Ga0070666_10024615 3300005335 Bacteria 3923
20 Ga0070666_10330141 3300005335 Bacteria 1089
21 Ga0070680_100434717 3300005336 Bacteria 1120
22 Ga0070680_100693425 3300005336 Bacteria 876
23 Ga0070682_100158841 3300005337 Bacteria 1559
24 Ga0068868_100023620 3300005338 Bacteria 4655
25 Ga0070689_100048634 3300005340 Bacteria 3271
26 Ga0070691_10053881 3300005341 Bacteria 1925
27 Ga0070687_100029363 3300005343 Bacteria 2677
28 Ga0070687_100097882 3300005343 Bacteria 1637
29 Ga0070661_100044224 3300005344 Bacteria 3254
30 Ga0070661_100046600 3300005344 Bacteria 3171
31 Ga0070668_100060167 3300005347 Bacteria 2941
32 Ga0070669_100029595 3300005353 Bacteria 3948
33 Ga0070669_100136333 3300005353 Bacteria 1888
34 Ga0070675_100003437 3300005354 Bacteria 12002
35 Ga0070675_100012320 3300005354 Bacteria 6702
36 Ga0070675_100053230 3300005354 Bacteria 3329
37 Ga0070675_100118909 3300005354 Bacteria 2244
38 Ga0070675_100150023 3300005354 Bacteria 1998
39 Ga0070675_100250258 3300005354 Bacteria 1551
40 Ga0070675_100462957 3300005354 Bacteria 1138
41 Ga0070671_100044624 3300005355 Bacteria 3684
42 Ga0070671_100269194 3300005355 Bacteria 1448
43 Ga0070674_100001307 3300005356 Bacteria 13100
44 Ga0070674_100071741 3300005356 Bacteria 2450
45 Ga0070673_100012223 3300005364 Bacteria 5887
46 Ga0070673_100079725 3300005364 Bacteria 2652
47 Ga0070673_100123875 3300005364 Bacteria 2160
48 Ga0070673_100343525 3300005364 Bacteria 1323
49 Ga0070688_100016321 3300005365 Bacteria 4244
50 Ga0070688_100193292 3300005365 Bacteria 1419
51 Ga0070659_100127911 3300005366 Bacteria 2062
52 Ga0070667_100010221 3300005367 Bacteria 7753
53 Ga0070667_100115231 3300005367 Bacteria 2334
54 Ga0070703_10055234 3300005406 Bacteria 1282
55 Ga0070701_10049044 3300005438 Bacteria 2181
56 Ga0070701_10161484 3300005438 Bacteria 1298
57 Ga0070705_100001358 3300005440 Bacteria 13055
58 Ga0070705_100002288 3300005440 Bacteria 9684
59 Ga0070705_100014355 3300005440 Bacteria 4073
60 Ga0070705_100048311 3300005440 Bacteria 2464
61 Ga0070694_100000451 3300005444 Bacteria 22467
62 Ga0070694_100001389 3300005444 Bacteria 14158
63 Ga0070694_100080399 3300005444 Bacteria 2265
64 Ga0070694_100089442 3300005444 Bacteria 2158
65 Ga0070708_100016440 3300005445 Bacteria 6140
66 Ga0070708_100035203 3300005445 Bacteria 4361
67 Ga0070708_100298121 3300005445 Bacteria 1518
68 Ga0070663_100299369 3300005455 Bacteria 1287
69 Ga0070678_100020936 3300005456 Bacteria 4301
70 Ga0070678_100039522 3300005456 Bacteria 3329
71 Ga0070678_100433348 3300005456 Bacteria 1148
72 Ga0070662_100053139 3300005457 Bacteria 2931
73 Ga0068867_100023579 3300005459 Bacteria 4405
74 Ga0068867_100290634 3300005459 Archaea 1344
75 Ga0070685_10263479 3300005466 Bacteria 1147
76 Ga0070706_100152843 3300005467 Bacteria 2155
77 Ga0070707_100032633 3300005468 Bacteria 4962
78 Ga0070707_100049920 3300005468 Bacteria 4011
79 Ga0070707_100064334 3300005468 Bacteria 3522
80 Ga0070707_100425541 3300005468 Bacteria 1288
81 Ga0070698_100002614 3300005471 Bacteria 19841
82 Ga0070698_100004008 3300005471 Bacteria 16211
83 Ga0070698_100006737 3300005471 Bacteria 12455
84 Ga0070698_100422450 3300005471 Bacteria 1268
85 Ga0070699_100001199 3300005518 Bacteria 23945
86 Ga0070699_100004302 3300005518 Bacteria 12586
87 Ga0070699_100032676 3300005518 Bacteria 4494
88 Ga0070699_100043398 3300005518 Bacteria 3892
89 Ga0070699_100086357 3300005518 Bacteria 2738
90 Ga0070699_100144720 3300005518 Bacteria 2100
91 Ga0070684_100033660 3300005535 Bacteria 4377
92 Ga0070697_100179612 3300005536 Bacteria 1794
93 Ga0070672_100048716 3300005543 Bacteria 3294
94 Ga0070672_100074118 3300005543 Bacteria 2715
95 Ga0070672_100142037 3300005543 Bacteria 1981
96 Ga0070672_100443240 3300005543 Bacteria 1118
97 Ga0070686_100038123 3300005544 Bacteria 2985
98 Ga0070695_100001840 3300005545 Bacteria 11962
99 Ga0070695_100267349 3300005545 Bacteria 1251
100 Ga0070696_100001204 3300005546 Bacteria 16788
101 Ga0070696_100002806 3300005546 Bacteria 11567
102 Ga0070696_100003976 3300005546 Bacteria 9854
103 Ga0070696_100008932 3300005546 Bacteria 6705
104 Ga0070696_100010532 3300005546 Bacteria 6197
105 Ga0070696_100044281 3300005546 Bacteria 3081
106 Ga0070696_100047646 3300005546 Bacteria 2974
107 Ga0070665_100031729 3300005548 Bacteria 5317
108 Ga0070704_100001803 3300005549 Bacteria 11778
109 Ga0070704_100004371 3300005549 Bacteria 8163
110 Ga0070704_100036267 3300005549 Bacteria 3359
111 Ga0070704_100040557 3300005549 Bacteria 3206
112 Ga0070664_100021881 3300005564 Bacteria 5271
113 Ga0070664_100024237 3300005564 Bacteria 5018
114 Ga0070664_100025022 3300005564 Bacteria 4946
115 Ga0070702_100021025 3300005615 Bacteria 3428
116 Ga0068859_100024131 3300005617 Bacteria 6102
117 Ga0068859_100143377 3300005617 Bacteria 2462
118 Ga0068864_100039463 3300005618 Bacteria 4036
119 Ga0068864_100043788 3300005618 Bacteria 3834
120 Ga0068866_10282356 3300005718 Bacteria 1029
121 Ga0068861_100101018 3300005719 Bacteria 2294
122 Ga0068861_100231286 3300005719 Bacteria 1568
123 Ga0068870_10001387 3300005840 Bacteria 9797
124 Ga0068863_100012661 3300005841 Bacteria 8135
125 Ga0068863_100309105 3300005841 Bacteria 1534
126 Ga0068858_100017000 3300005842 Bacteria 6830
127 Ga0068858_100490477 3300005842 Bacteria 1186
128 Ga0068858_100589746 3300005842 Bacteria 1078
129 Ga0068860_100041624 3300005843 Bacteria 4388
130 Ga0068862_100030996 3300005844 Bacteria 4510
131 Ga0068862_100087708 3300005844 Bacteria 2706
132 Ga0068862_100231927 3300005844 Bacteria 1675
133 Ga0070716_100013187 3300006173 Bacteria 4209
134 Ga0068871_100034508 3300006358 Bacteria 4014
135 Ga0068871_100116868 3300006358 Bacteria 2249
136 Ga0068871_100160336 3300006358 Bacteria 1923
137 Ga0075428_100000786 3300006844 Bacteria 33072
138 Ga0075428_100022011 3300006844 Bacteria 7056
139 Ga0075428_100053179 3300006844 Bacteria 4437
140 Ga0075428_100054420 3300006844 Bacteria 4386
141 Ga0075428_100068878 3300006844 Bacteria 3870
142 Ga0075428_100167812 3300006844 Bacteria 2381
143 Ga0075428_100748155 3300006844 Bacteria 1040
144 Ga0075430_100001331 3300006846 Bacteria 19957
145 Ga0075430_100003419 3300006846 Bacteria 13269
146 Ga0075430_100072990 3300006846 Bacteria 2878
147 Ga0075431_100001181 3300006847 Bacteria 23559
148 Ga0075431_100007844 3300006847 Bacteria 10640
149 Ga0075431_100010115 3300006847 Bacteria 9478
150 Ga0075431_100040861 3300006847 Bacteria 4781
151 Ga0075431_100047310 3300006847 Bacteria 4435
152 Ga0075431_100146433 3300006847 Bacteria 2434
153 Ga0075431_100209501 3300006847 Bacteria 1992
154 Ga0075433_10000226 3300006852 Bacteria 32302
155 Ga0075433_10009974 3300006852 Bacteria 7611
156 Ga0075433_10010755 3300006852 Bacteria 7360
157 Ga0075433_10050201 3300006852 Bacteria 3631
158 Ga0075433_10157327 3300006852 Bacteria 2022
159 Ga0075433_10239738 3300006852 Bacteria 1610
160 Ga0075434_100000664 3300006871 Bacteria 26666
161 Ga0075434_100019701 3300006871 Bacteria 6530
162 Ga0075434_100032856 3300006871 Bacteria 5118
163 Ga0075434_100039511 3300006871 Bacteria 4676
164 Ga0075434_100089788 3300006871 Bacteria 3074
165 Ga0075434_100169324 3300006871 Bacteria 2204
166 Ga0075434_100285999 3300006871 Bacteria 1668
167 Ga0075434_100398936 3300006871 Bacteria 1396
168 Ga0075434_100604963 3300006871 Bacteria 1115
169 Ga0075429_100014552 3300006880 Bacteria 6818
170 Ga0075429_100025940 3300006880 Bacteria 5087
171 Ga0075429_100224823 3300006880 Bacteria 1644
172 Ga0075436_100027420 3300006914 Bacteria 3920
173 Ga0097620_100024131 3300006931 Bacteria 6102
174 Ga0097620_100143383 3300006931 Bacteria 2462
175 Ga0075435_100009539 3300007076 Bacteria 7036
176 Ga0075435_100017166 3300007076 Bacteria 5471
177 Ga0075435_100026053 3300007076 Bacteria 4559
178 Ga0075435_100047520 3300007076 Bacteria 3446
179 Ga0099794_10142339 3300007265 Bacteria 1215
180 Ga0099794_10165987 3300007265 Unclassified 1124
181 Ga0111539_10000002 3300009094 Bacteria 983359
182 Ga0111539_10003968 3300009094 Bacteria 19443
183 Ga0111539_10004218 3300009094 Bacteria 18846
184 Ga0111539_10008729 3300009094 Bacteria 12857
185 Ga0111539_10049693 3300009094 Bacteria 5000
186 Ga0111539_10148909 3300009094 Bacteria 2740
187 Ga0111539_10348647 3300009094 Bacteria 1723
188 Ga0105245_10078786 3300009098 Bacteria 3007
189 Ga0114129_10001185 3300009147 Bacteria 34615
190 Ga0114129_10001421 3300009147 Bacteria 32301
191 Ga0114129_10002563 3300009147 Bacteria 25231
192 Ga0114129_10007194 3300009147 Bacteria 15838
193 Ga0114129_10030884 3300009147 Bacteria 7577
194 Ga0114129_10100757 3300009147 Bacteria 3996
195 Ga0114129_10312917 3300009147 Bacteria 2089
196 Ga0114129_10331033 3300009147 Bacteria 2022
197 Ga0114129_10683260 3300009147 Bacteria 1321
198 Ga0105243_10227469 3300009148 Bacteria 1653
199 Ga0105243_10250601 3300009148 Bacteria 1581
200 Ga0105242_10042803 3300009176 Bacteria 3659
201 Ga0105248_10068901 3300009177 Bacteria 3972
202 Ga0105249_10004857 3300009553 Bacteria 11597
203 Ga0157374_10100590 3300013296 Bacteria 2771
204 Ga0157374_10421061 3300013296 Bacteria 1334
205 Ga0163162_10006226 3300013306 Bacteria 11566
206 Ga0157375_10193611 3300013308 Bacteria 2188
207 Ga0157380_10000640 3300014326 Bacteria 21595
208 Ga0157380_10056952 3300014326 Bacteria 3110
209 Ga0157380_10069511 3300014326 Bacteria 2842
210 Ga0157377_10004677 3300014745 Bacteria 6335
211 Ga0157379_10050880 3300014968 Bacteria 3699
212 Ga0157376_10073812 3300014969 Bacteria 2906
213 Ga0157376_10304344 3300014969 Bacteria 1510
214 Ga0163161_10023641 3300017792 Bacteria 4337
215 Ga0213872_10115493 3300021361 Bacteria 1189
216 Ga0207697_10001265 3300025315 Bacteria 13892
217 Ga0207653_10017132 3300025885 Bacteria 2279
218 Ga0207682_10007252 3300025893 Bacteria 4427
219 Ga0207682_10041206 3300025893 Bacteria 1884
220 Ga0207682_10138211 3300025893 Bacteria 1092
221 Ga0207682_10144697 3300025893 Bacteria 1068
222 Ga0207680_10068015 3300025903 Bacteria 2196
223 Ga0207680_10278127 3300025903 Bacteria 1162
224 Ga0207680_10430562 3300025903 Bacteria 935
225 Ga0207645_10003058 3300025907 Bacteria 12851
226 Ga0207643_10001525 3300025908 Bacteria 13223
227 Ga0207684_10093952 3300025910 Bacteria 2558
228 Ga0207684_10345071 3300025910 Bacteria 1282
229 Ga0207662_10001040 3300025918 Bacteria 12994
230 Ga0207662_10011592 3300025918 Bacteria 4896
231 Ga0207649_10106592 3300025920 Bacteria 1864
232 Ga0207646_10035759 3300025922 Bacteria 4485
233 Ga0207646_10045711 3300025922 Bacteria 3930
234 Ga0207646_10087530 3300025922 Bacteria 2787
235 Ga0207681_10005415 3300025923 Bacteria 7836
236 Ga0207650_10123948 3300025925 Bacteria 2015
237 Ga0207650_10161673 3300025925 Bacteria 1775
238 Ga0207650_10432808 3300025925 Unclassified 1093
239 Ga0207659_10032572 3300025926 Bacteria 3579
240 Ga0207659_10035749 3300025926 Bacteria 3436
241 Ga0207659_10084432 3300025926 Bacteria 2356
242 Ga0207659_10141309 3300025926 Bacteria 1869
243 Ga0207644_10029556 3300025931 Bacteria 3803
244 Ga0207644_10237803 3300025931 Bacteria 1449
245 Ga0207644_10249883 3300025931 Bacteria 1415
246 Ga0207690_10067726 3300025932 Bacteria 2450
247 Ga0207706_10010919 3300025933 Bacteria 8283
248 Ga0207686_10152166 3300025934 Bacteria 1612
249 Ga0207709_10103501 3300025935 Bacteria 1887
250 Ga0207709_10544668 3300025935 Unclassified 912
251 Ga0207670_10034311 3300025936 Bacteria 3278
252 Ga0207669_10000672 3300025937 Bacteria 14741
253 Ga0207669_10268013 3300025937 Bacteria 1281
254 Ga0207704_10183021 3300025938 Bacteria 1516
255 Ga0207665_10008932 3300025939 Bacteria 6581
256 Ga0207691_10199262 3300025940 Archaea 1743
257 Ga0207691_10356468 3300025940 Bacteria 1251
258 Ga0207711_10134636 3300025941 Bacteria 2218
259 Ga0207711_10144079 3300025941 Bacteria 2145
260 Ga0207689_10009117 3300025942 Bacteria 8588
261 Ga0207661_10042774 3300025944 Bacteria 3573
262 Ga0207679_10014360 3300025945 Bacteria 5206
263 Ga0207679_10026812 3300025945 Bacteria 3978
264 Ga0207651_10009323 3300025960 Bacteria 5364
265 Ga0207651_10158609 3300025960 Bacteria 1771
266 Ga0207651_10167470 3300025960 Bacteria 1729
267 Ga0207651_10254067 3300025960 Bacteria 1439
268 Ga0207712_10019812 3300025961 Bacteria 4397
269 Ga0207712_10197613 3300025961 Bacteria 1592
270 Ga0207668_10064488 3300025972 Bacteria 2589
271 Ga0207668_10160170 3300025972 Bacteria 1753
272 Ga0207640_10067079 3300025981 Bacteria 2399
273 Ga0207658_10246694 3300025986 Bacteria 1516
274 Ga0207677_10111401 3300026023 Bacteria 2039
275 Ga0207703_10066757 3300026035 Bacteria 2960
276 Ga0207703_10242697 3300026035 Bacteria 1620
277 Ga0207678_10076265 3300026067 Bacteria 2871
278 Ga0207708_10008617 3300026075 Bacteria 7545
279 Ga0207708_10026458 3300026075 Bacteria 4391
280 Ga0207708_10254749 3300026075 Bacteria 1415
281 Ga0207641_10055002 3300026088 Bacteria 3379
282 Ga0207641_10578273 3300026088 Bacteria 1098
283 Ga0207648_10016008 3300026089 Bacteria 6872
284 Ga0207648_10191682 3300026089 Bacteria 1812
285 Ga0207648_10378003 3300026089 Bacteria 1281
286 Ga0207676_10030700 3300026095 Bacteria 4036
287 Ga0207676_10808443 3300026095 Bacteria 915
288 Ga0207674_10092623 3300026116 Bacteria 3011
289 Ga0207675_100007903 3300026118 Bacteria 10027
290 Ga0207675_100091850 3300026118 Bacteria 2854
291 Ga0207675_100172059 3300026118 Bacteria 2070
292 Ga0207675_100194308 3300026118 Bacteria 1947
293 Ga0207683_10031763 3300026121 Bacteria 4584
294 Ga0207683_10113890 3300026121 Bacteria 2423
295 Ga0207683_10222726 3300026121 Bacteria 1719
296 Ga0209588_1000671 3300027671 Bacteria 8606
297 Ga0207428_10000026 3300027907 Bacteria 255539
298 Ga0207428_10001447 3300027907 Bacteria 24864
299 Ga0207428_10085456 3300027907 Bacteria 2457
300 Ga0207428_10090034 3300027907 Bacteria 2384
301 Ga0207428_10156208 3300027907 Unclassified 1735
302 Ga0268266_10429264 3300028379 Bacteria 1253
303 Ga0268265_10002584 3300028380 Bacteria 13512
304 Ga0307408_100051549 3300031548 Bacteria 2964
305 Ga0316576_10384245 3300031727 Bacteria 1042
306 Ga0307410_10015122 3300031852 Bacteria 4568
307 Ga0307406_10247378 3300031901 Bacteria 1341
308 Ga0307407_10147154 3300031903 Bacteria 1527
309 Ga0307416_101033669 3300032002 Bacteria 925
310 Ga0307415_100023116 3300032126 Bacteria 3853
311 Ga0373940_0026148 3300035088 Bacteria 1525
312 Ga0373932_0002999 3300035112 Bacteria 4141
313 Ga0373939_0028262 3300035114 Bacteria 1595
314 Ga0373956_0076809 3300035119 Bacteria 1529
315 Ga0373955_0149385 3300035172 Bacteria 1374
316 Ga0373937_0310299 3300036401 Bacteria 1492
317 Ga0436364_0430888 3300037853 Unclassified 2725
318 Ga0436361_0273103 3300039447 Bacteria 3497
319 Ga0439450_008137 3300042008 Bacteria 1948
320 Ga0439435_0051497 3300042436 Bacteria 1180
321 Ga0451577_0241192 3300042876 Bacteria 1636
322 Ga0453683_0221932 3300044673 Unclassified 1202
323 Ga0451576_0230447 3300045051 Bacteria 1934
324 Ga0451576_0297543 3300045051 Bacteria 1687
325 Ga0495603_0029035 3300046455 Bacteria 3336
326 Ga0495629_0012232 3300046459 Bacteria 6215
327 Ga0495629_0075517 3300046459 Bacteria 2354
328 Ga0495582_0076733 3300046473 Bacteria 1853
329 Ga0495584_0077888 3300046491 Unclassified 1668
330 Ga0495594_0061341 3300046499 Bacteria 2081
331 Ga0495608_0230465 3300046511 Bacteria 1160
332 Ga0495628_0177833 3300046516 Bacteria 1611
333 Ga0495598_0003257 3300046537 Bacteria 3431
334 Ga0495598_0040852 3300046537 Bacteria 1354
335 Ga0495598_0047592 3300046537 Bacteria 1279
336 Ga0495645_0117881 3300046543 Bacteria 1873
337 Ga0495656_0095458 3300046615 Bacteria 1367
338 Ga0495656_0109017 3300046615 Bacteria 1292
339 Ga0495659_0042447 3300046664 Bacteria 1628
340 Ga0495647_0005768 3300046681 Bacteria 4071
341 Ga0495658_0034972 3300046683 Bacteria 2760
342 Ga0495658_0048446 3300046683 Bacteria 2396
343 Ga0495669_0005981 3300046684 Bacteria 5072
344 Ga0495669_0082990 3300046684 Bacteria 1473
345 Ga0495670_0138396 3300046691 Bacteria 1272
346 Ga0495604_0401723 3300047317 Bacteria 902
347 Ga0495676_0047655 3300047321 Bacteria 3462
348 Ga0495684_0216358 3300047471 Bacteria 1407
349 Ga0496108_0566345 3300048911 Bacteria 991
350 Ga0496113_0047209 3300048916 Bacteria 3200
351 Ga0501031_0200343 3300049568 Bacteria 1303
352 Ga0501036_0063921 3300049572 Bacteria 3116
353 Ga0501036_0354887 3300049572 Bacteria 1224
354 Ga0501038_0317648 3300049574 Bacteria 1219
355 Ga0501039_0101453 3300049575 Bacteria 2246
356 Ga0501039_0501142 3300049575 Bacteria 953
357 Ga0501040_0219538 3300049576 Bacteria 1352
358 Ga0501041_0046320 3300049577 Bacteria 2645
359 Ga0501042_0004762 3300049578 Bacteria 8663
360 Ga0501046_0479446 3300049580 Bacteria 892
361 Ga0501048_0063231 3300049582 Bacteria 2618
362 Ga0501048_0318690 3300049582 Bacteria 1107
363 Ga0501072_0024344 3300049588 Bacteria 4709
364 Ga0501073_0097047 3300049589 Bacteria 2047
365 Ga0501074_0040510 3300049590 Bacteria 3374
366 Ga0501074_0058701 3300049590 Bacteria 2772
367 Ga0501075_0017972 3300049591 Bacteria 5110
368 Ga0501075_0134524 3300049591 Bacteria 1883
369 Ga0501076_0282656 3300049592 Bacteria 1359
370 Ga0501076_0358988 3300049592 Bacteria 1197
371 Ga0501076_0558684 3300049592 Bacteria 944
372 Ga0501077_0127719 3300049593 Bacteria 1611
373 Ga0501079_0024095 3300049741 Bacteria 4670
374 Ga0501081_0057993 3300049743 Bacteria 2678
375 Ga0501081_0089641 3300049743 Bacteria 2161
376 Ga0501035_0116718 3300049822 Bacteria 2336
377 Ga0501045_0073721 3300049824 Bacteria 2514
378 nmdc:mga05p37_101215_c1 3300050507 Bacteria 3548
379 nmdc:mga05p37_14944_c1 3300050507 Bacteria 9319
380 nmdc:mga05p37_15091_c1 3300050507 Bacteria 9275
381 nmdc:mga05p37_274973_c1 3300050507 Bacteria 2011
382 nmdc:mga09592_15261_c1 3300050508 Bacteria 6276
383 nmdc:mga09592_16629_c1 3300050508 Bacteria 6020
384 nmdc:mga09592_6049_c1 3300050508 Bacteria 9871
385 nmdc:mga0qj67_26983_c1 3300050509 Bacteria 4448
386 nmdc:mga0qj67_3237_c1 3300050509 Bacteria 11722
387 nmdc:mga06r32_125051_c1 3300050510 Bacteria 2539
388 nmdc:mga06r32_202278_c1 3300050510 Bacteria 1974
389 nmdc:mga06r32_27711_c1 3300050510 Bacteria 5296
390 nmdc:mga06r32_32659_c1 3300050510 Bacteria 4899
391 nmdc:mga06r32_52217_c1 3300050510 Bacteria 3915
392 nmdc:mga06r32_6086_c1 3300050510 Bacteria 10838
393 nmdc:mga06r32_661079_c1 3300050510 Bacteria 1012
394 nmdc:mga08y16_12024_c1 3300050511 Bacteria 9093
395 nmdc:mga08y16_243750_c1 3300050511 Bacteria 1858
396 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
397 nmdc:mga08y16_318608_c1 3300050511 Bacteria 1601
398 nmdc:mga08y16_39206_c1 3300050511 Bacteria 4971
399 nmdc:mga08y16_57893_c1 3300050511 Bacteria 4049
400 nmdc:mga08y16_598329_c1 3300050511 Bacteria 1112
401 nmdc:mga0n895_133761_c1 3300050512 Bacteria 2506
402 nmdc:mga0n895_24503_c1 3300050512 Bacteria 5687
403 nmdc:mga0n895_302059_c1 3300050512 Unclassified 1623
404 nmdc:mga0n895_344408_c1 3300050512 Bacteria 1510
405 nmdc:mga0n895_4796_c1 3300050512 Bacteria 11195
406 nmdc:mga0n895_99088_c1 3300050512 Bacteria 2922
407 nmdc:mga0rr50_130645_c1 3300050513 Bacteria 2011
408 nmdc:mga0rr50_4512_c1 3300050513 Bacteria 8198
409 nmdc:mga0rr50_51166_c1 3300050513 Bacteria 3064
410 nmdc:mga0rr50_72704_c1 3300050513 Bacteria 2627
411 nmdc:mga08x19_185737_c1 3300050514 Bacteria 1421
412 nmdc:mga0a205_11163_c1 3300050515 Bacteria 8268
413 nmdc:mga0a205_130743_c1 3300050515 Bacteria 2411
414 nmdc:mga0a205_144180_c1 3300050515 Bacteria 2282
415 nmdc:mga0a205_28378_c1 3300050515 Bacteria 5351
416 nmdc:mga0a205_349497_c1 3300050515 Bacteria 1346
417 nmdc:mga0a205_356_c1 3300050515 Bacteria 34589
418 Ga0495601_0072069 3300053077 Bacteria 2207
419 Ga0501084_0027597 3300054114 Bacteria 4744
420 Ga0501082_0044066 3300060353 Bacteria 3849
421 Ga0501082_0071529 3300060353 Bacteria 2987
422 Ga0065712_10068386
423 JGI24746J21847_1002750
424 JGI24749J21850_1008540
425 Ga0065712_10009384
426 Ga0065715_10092008
427 Ga0065715_10104369
428 Ga0065707_10000708
429 Ga0065707_10028059
430 Ga0070676_10118006
431 Ga0070690_100013406
432 Ga0070690_100485617
433 Ga0070670_100194865
434 Ga0070670_100270074
435 Ga0070677_10000496
436 Ga0070677_10008440
437 Ga0068869_100027596
438 Ga0068869_100035529
439 Ga0070666_10014675
440 Ga0070666_10024615
441 Ga0070666_10330141
442 Ga0070680_100434717
443 Ga0070680_100693425
444 Ga0070682_100158841
445 Ga0068868_100023620
446 Ga0070689_100048634
447 Ga0070691_10053881
448 Ga0070687_100029363
449 Ga0070687_100097882
450 Ga0070661_100044224
451 Ga0070661_100046600
452 Ga0070668_100060167
453 Ga0070669_100029595
454 Ga0070669_100136333
455 Ga0070675_100003437
456 Ga0070675_100012320
457 Ga0070675_100053230
458 Ga0070675_100118909
459 Ga0070675_100150023
460 Ga0070675_100250258
461 Ga0070675_100462957
462 Ga0070671_100044624
463 Ga0070671_100269194
464 Ga0070674_100001307
465 Ga0070674_100071741
466 Ga0070673_100012223
467 Ga0070673_100079725
468 Ga0070673_100123875
469 Ga0070673_100343525
470 Ga0070688_100016321
471 Ga0070688_100193292
472 Ga0070659_100127911
473 Ga0070667_100010221
474 Ga0070667_100115231
475 Ga0070703_10055234
476 Ga0070701_10049044
477 Ga0070701_10161484
478 Ga0070705_100001358
479 Ga0070705_100002288
480 Ga0070705_100014355
481 Ga0070705_100048311
482 Ga0070694_100000451
483 Ga0070694_100001389
484 Ga0070694_100080399
485 Ga0070694_100089442
486 Ga0070708_100016440
487 Ga0070708_100035203
488 Ga0070708_100298121
489 Ga0070663_100299369
490 Ga0070678_100020936
491 Ga0070678_100039522
492 Ga0070678_100433348
493 Ga0070662_100053139
494 Ga0068867_100023579
495 Ga0068867_100290634
496 Ga0070685_10263479
497 Ga0070706_100152843
498 Ga0070707_100032633
499 Ga0070707_100049920
500 Ga0070707_100064334
501 Ga0070707_100425541
502 Ga0070698_100002614
503 Ga0070698_100004008
504 Ga0070698_100006737
505 Ga0070698_100422450
506 Ga0070699_100001199
507 Ga0070699_100004302
508 Ga0070699_100032676
509 Ga0070699_100043398
510 Ga0070699_100086357
511 Ga0070699_100144720
512 Ga0070684_100033660
513 Ga0070697_100179612
514 Ga0070672_100048716
515 Ga0070672_100074118
516 Ga0070672_100142037
517 Ga0070672_100443240
518 Ga0070686_100038123
519 Ga0070695_100001840
520 Ga0070695_100267349
521 Ga0070696_100001204
522 Ga0070696_100002806
523 Ga0070696_100003976
524 Ga0070696_100008932
525 Ga0070696_100010532
526 Ga0070696_100044281
527 Ga0070696_100047646
528 Ga0070665_100031729
529 Ga0070704_100001803
530 Ga0070704_100004371
531 Ga0070704_100036267
532 Ga0070704_100040557
533 Ga0070664_100021881
534 Ga0070664_100024237
535 Ga0070664_100025022
536 Ga0070702_100021025
537 Ga0068859_100024131
538 Ga0068859_100143377
539 Ga0068864_100039463
540 Ga0068864_100043788
541 Ga0068866_10282356
542 Ga0068861_100101018
543 Ga0068861_100231286
544 Ga0068870_10001387
545 Ga0068863_100012661
546 Ga0068863_100309105
547 Ga0068858_100017000
548 Ga0068858_100490477
549 Ga0068858_100589746
550 Ga0068860_100041624
551 Ga0068862_100030996
552 Ga0068862_100087708
553 Ga0068862_100231927
554 Ga0070716_100013187
555 Ga0068871_100034508
556 Ga0068871_100116868
557 Ga0068871_100160336
558 Ga0075428_100000786
559 Ga0075428_100022011
560 Ga0075428_100053179
561 Ga0075428_100054420
562 Ga0075428_100068878
563 Ga0075428_100167812
564 Ga0075428_100748155
565 Ga0075430_100001331
566 Ga0075430_100003419
567 Ga0075430_100072990
568 Ga0075431_100001181
569 Ga0075431_100007844
570 Ga0075431_100010115
571 Ga0075431_100040861
572 Ga0075431_100047310
573 Ga0075431_100146433
574 Ga0075431_100209501
575 Ga0075433_10000226
576 Ga0075433_10009974
577 Ga0075433_10010755
578 Ga0075433_10050201
579 Ga0075433_10157327
580 Ga0075433_10239738
581 Ga0075434_100000664
582 Ga0075434_100019701
583 Ga0075434_100032856
584 Ga0075434_100039511
585 Ga0075434_100089788
586 Ga0075434_100169324
587 Ga0075434_100285999
588 Ga0075434_100398936
589 Ga0075434_100604963
590 Ga0075429_100014552
591 Ga0075429_100025940
592 Ga0075429_100224823
593 Ga0075436_100027420
594 Ga0097620_100024131
595 Ga0097620_100143383
596 Ga0075435_100009539
597 Ga0075435_100017166
598 Ga0075435_100026053
599 Ga0075435_100047520
600 Ga0099794_10142339
601 Ga0099794_10165987
602 Ga0111539_10000002
603 Ga0111539_10003968
604 Ga0111539_10004218
605 Ga0111539_10008729
606 Ga0111539_10049693
607 Ga0111539_10148909
608 Ga0111539_10348647
609 Ga0105245_10078786
610 Ga0114129_10001185
611 Ga0114129_10001421
612 Ga0114129_10002563
613 Ga0114129_10007194
614 Ga0114129_10030884
615 Ga0114129_10100757
616 Ga0114129_10312917
617 Ga0114129_10331033
618 Ga0114129_10683260
619 Ga0105243_10227469
620 Ga0105243_10250601
621 Ga0105242_10042803
622 Ga0105248_10068901
623 Ga0105249_10004857
624 Ga0157374_10100590
625 Ga0157374_10421061
626 Ga0163162_10006226
627 Ga0157375_10193611
628 Ga0157380_10000640
629 Ga0157380_10056952
630 Ga0157380_10069511
631 Ga0157377_10004677
632 Ga0157379_10050880
633 Ga0157376_10073812
634 Ga0157376_10304344
635 Ga0163161_10023641
636 Ga0213872_10115493
637 Ga0207697_10001265
638 Ga0207653_10017132
639 Ga0207682_10007252
640 Ga0207682_10041206
641 Ga0207682_10138211
642 Ga0207682_10144697
643 Ga0207680_10068015
644 Ga0207680_10278127
645 Ga0207680_10430562
646 Ga0207645_10003058
647 Ga0207643_10001525
648 Ga0207684_10093952
649 Ga0207684_10345071
650 Ga0207662_10001040
651 Ga0207662_10011592
652 Ga0207649_10106592
653 Ga0207646_10035759
654 Ga0207646_10045711
655 Ga0207646_10087530
656 Ga0207681_10005415
657 Ga0207650_10123948
658 Ga0207650_10161673
659 Ga0207650_10432808
660 Ga0207659_10032572
661 Ga0207659_10035749
662 Ga0207659_10084432
663 Ga0207659_10141309
664 Ga0207644_10029556
665 Ga0207644_10237803
666 Ga0207644_10249883
667 Ga0207690_10067726
668 Ga0207706_10010919
669 Ga0207686_10152166
670 Ga0207709_10103501
671 Ga0207709_10544668
672 Ga0207670_10034311
673 Ga0207669_10000672
674 Ga0207669_10268013
675 Ga0207704_10183021
676 Ga0207665_10008932
677 Ga0207691_10199262
678 Ga0207691_10356468
679 Ga0207711_10134636
680 Ga0207711_10144079
681 Ga0207689_10009117
682 Ga0207661_10042774
683 Ga0207679_10014360
684 Ga0207679_10026812
685 Ga0207651_10009323
686 Ga0207651_10158609
687 Ga0207651_10167470
688 Ga0207651_10254067
689 Ga0207712_10019812
690 Ga0207712_10197613
691 Ga0207668_10064488
692 Ga0207668_10160170
693 Ga0207640_10067079
694 Ga0207658_10246694
695 Ga0207677_10111401
696 Ga0207703_10066757
697 Ga0207703_10242697
698 Ga0207678_10076265
699 Ga0207708_10008617
700 Ga0207708_10026458
701 Ga0207708_10254749
702 Ga0207641_10055002
703 Ga0207641_10578273
704 Ga0207648_10016008
705 Ga0207648_10191682
706 Ga0207648_10378003
707 Ga0207676_10030700
708 Ga0207676_10808443
709 Ga0207674_10092623
710 Ga0207675_100007903
711 Ga0207675_100091850
712 Ga0207675_100172059
713 Ga0207675_100194308
714 Ga0207683_10031763
715 Ga0207683_10113890
716 Ga0207683_10222726
717 Ga0209588_1000671
718 Ga0207428_10000026
719 Ga0207428_10001447
720 Ga0207428_10085456
721 Ga0207428_10090034
722 Ga0207428_10156208
723 Ga0268266_10429264
724 Ga0268265_10002584
725 Ga0307408_100051549
726 Ga0316576_10384245
727 Ga0307410_10015122
728 Ga0307406_10247378
729 Ga0307407_10147154
730 Ga0307416_101033669
731 Ga0307415_100023116
732 Ga0373940_0026148
733 Ga0373932_0002999
734 Ga0373939_0028262
735 Ga0373956_0076809
736 Ga0373955_0149385
737 Ga0373937_0310299
738 Ga0436364_0430888
739 Ga0436361_0273103
740 Ga0439450_008137
741 Ga0439435_0051497
742 Ga0451577_0241192
743 Ga0453683_0221932
744 Ga0451576_0230447
745 Ga0451576_0297543
746 Ga0495603_0029035
747 Ga0495629_0012232
748 Ga0495629_0075517
749 Ga0495582_0076733
750 Ga0495584_0077888
751 Ga0495594_0061341
752 Ga0495608_0230465
753 Ga0495628_0177833
754 Ga0495598_0003257
755 Ga0495598_0040852
756 Ga0495598_0047592
757 Ga0495645_0117881
758 Ga0495656_0095458
759 Ga0495656_0109017
760 Ga0495659_0042447
761 Ga0495647_0005768
762 Ga0495658_0034972
763 Ga0495658_0048446
764 Ga0495669_0005981
765 Ga0495669_0082990
766 Ga0495670_0138396
767 Ga0495604_0401723
768 Ga0495676_0047655
769 Ga0495684_0216358
770 Ga0496108_0566345
771 Ga0496113_0047209
772 Ga0501031_0200343
773 Ga0501036_0063921
774 Ga0501036_0354887
775 Ga0501038_0317648
776 Ga0501039_0101453
777 Ga0501039_0501142
778 Ga0501040_0219538
779 Ga0501041_0046320
780 Ga0501042_0004762
781 Ga0501046_0479446
782 Ga0501048_0063231
783 Ga0501048_0318690
784 Ga0501072_0024344
785 Ga0501073_0097047
786 Ga0501074_0040510
787 Ga0501074_0058701
788 Ga0501075_0017972
789 Ga0501075_0134524
790 Ga0501076_0282656
791 Ga0501076_0358988
792 Ga0501076_0558684
793 Ga0501077_0127719
794 Ga0501079_0024095
795 Ga0501081_0057993
796 Ga0501081_0089641
797 Ga0501035_0116718
798 Ga0501045_0073721
799 nmdc:mga05p37_101215_c1
800 nmdc:mga05p37_14944_c1
801 nmdc:mga05p37_15091_c1
802 nmdc:mga05p37_274973_c1
803 nmdc:mga09592_15261_c1
804 nmdc:mga09592_16629_c1
805 nmdc:mga09592_6049_c1
806 nmdc:mga0qj67_26983_c1
807 nmdc:mga0qj67_3237_c1
808 nmdc:mga06r32_125051_c1
809 nmdc:mga06r32_202278_c1
810 nmdc:mga06r32_27711_c1
811 nmdc:mga06r32_32659_c1
812 nmdc:mga06r32_52217_c1
813 nmdc:mga06r32_6086_c1
814 nmdc:mga06r32_661079_c1
815 nmdc:mga08y16_12024_c1
816 nmdc:mga08y16_243750_c1
817 nmdc:mga08y16_2_c1
818 nmdc:mga08y16_318608_c1
819 nmdc:mga08y16_39206_c1
820 nmdc:mga08y16_57893_c1
821 nmdc:mga08y16_598329_c1
822 nmdc:mga0n895_133761_c1
823 nmdc:mga0n895_24503_c1
824 nmdc:mga0n895_302059_c1
825 nmdc:mga0n895_344408_c1
826 nmdc:mga0n895_4796_c1
827 nmdc:mga0n895_99088_c1
828 nmdc:mga0rr50_130645_c1
829 nmdc:mga0rr50_4512_c1
830 nmdc:mga0rr50_51166_c1
831 nmdc:mga0rr50_72704_c1
832 nmdc:mga08x19_185737_c1
833 nmdc:mga0a205_11163_c1
834 nmdc:mga0a205_130743_c1
835 nmdc:mga0a205_144180_c1
836 nmdc:mga0a205_28378_c1
837 nmdc:mga0a205_349497_c1
838 nmdc:mga0a205_356_c1
839 Ga0495601_0072069
840 Ga0501084_0027597
841 Ga0501082_0044066
842 Ga0501082_0071529

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02548

Pantoate_transf

Ketopantoate hydroxymethyltransferase

5

262

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9753 4 261
1oy0-assembly1.cif.gz_A the crystal structure of the first enzyme of pantothenate biosynthetic pathway, ketopantoate hydroxymethyltransferase from mycobacterium tuberculosis shows a decameric assembly and terminal helix-swapping 0.9521 4 261
3vav-assembly1.cif.gz_G crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.8915 4 263
3vav-assembly1.cif.gz_I crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia thailandensis 0.8877 4 263
3ez4-assembly1.cif.gz_D crystal structure of 3-methyl-2-oxobutanoate hydroxymethyltransferase from burkholderia pseudomallei 0.8876 5 263
ID Description Score Start End Superfamily
1oy0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9753 4 261 3.20.20.60
af_Q2FV21_2_270_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9699 8 263 3.20.20.60
af_Q5ABB3_27_304_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9668 4 261 3.20.20.60
af_Q9AWZ7_81_360_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9623 4 263 3.20.20.60
af_P38122_25_306_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9529 8 263 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A497KEM3-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9841 6 143 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A535T109-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9827 6 140 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A3D5BQY2-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9818 7 145 GO:0000287
GO:0003864
GO:0005737
GO:0008168
GO:0015940
GO:0032259
AF-A0A2V9UH40-F1-model_v4 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) 0.9789 1 143 GO:0000287
GO:0003864
GO:0008168
GO:0015940
GO:0032259
AF-A0A0F2IWS3-F1-model_v4 deleted 0.9784 4 263

Map