F439854

General Info

Members Datasets Scaffolds Average Seq Length
420 252 840 150

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0132525|Ga0501045_0132525_1073_1564
Length 163
Sequence MIGIPQPGGEVADEAYRAVFLRVHPTGKMVLSLTTESDGKEHEYAQLVARALGVPALDVKVVPADTNRFGNGHGFNTSPSGGTPAAIAGTTEKILAKGRLLAGMALDAPPESLKWSNGAWMKADGDDPTQVKTIEDVALYAHGTGELPPGVEGGLDAQTVYRD

Samples

Sample ID Description Type Environment
1 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
149 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
158 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
233 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
234 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.1
Metatranscriptomes 1.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 12.38
Rhizosphere 87.14
Stem 0
Stem Tuber 0
Unclassified 16.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501045_0132525 3300049824 Bacteria 1853
2 JGI24735J21928_10131088 3300002067 Bacteria 723
3 JGI25406J46586_10043311 3300003203 Bacteria 1568
4 Ga0070658_10858248 3300005327 Bacteria 789
5 Ga0070658_11425264 3300005327 Bacteria 601
6 Ga0070683_100007399 3300005329 Bacteria 9276
7 Ga0070683_100149157 3300005329 Bacteria 2217
8 Ga0070683_100534267 3300005329 Bacteria 1121
9 Ga0070683_101012776 3300005329 Bacteria 797
10 Ga0070690_100440578 3300005330 Bacteria 964
11 Ga0070690_101162509 3300005330 Bacteria 614
12 Ga0070666_10483934 3300005335 Bacteria 896
13 Ga0070680_100018952 3300005336 Bacteria 5445
14 Ga0068868_100042666 3300005338 Bacteria 3541
15 Ga0070660_100004701 3300005339 Bacteria 9455
16 Ga0070660_100694959 3300005339 Unclassified 853
17 Ga0070691_10261672 3300005341 Bacteria 931
18 Ga0070691_10813659 3300005341 Bacteria 570
19 Ga0070661_100020233 3300005344 Bacteria 4744
20 Ga0070692_10075337 3300005345 Bacteria 1807
21 Ga0070669_100604294 3300005353 Bacteria 919
22 Ga0070674_100212118 3300005356 Unclassified 1501
23 Ga0070674_100368706 3300005356 Bacteria 1165
24 Ga0070659_100022813 3300005366 Bacteria 4781
25 Ga0070659_100333635 3300005366 Bacteria 1270
26 Ga0070659_100422341 3300005366 Bacteria 1128
27 Ga0070659_100457239 3300005366 Unclassified 1084
28 Ga0070709_10949666 3300005434 Bacteria 682
29 Ga0070714_100003099 3300005435 Bacteria 12346
30 Ga0070713_101185650 3300005436 Bacteria 739
31 Ga0070710_10400355 3300005437 Bacteria 920
32 Ga0070711_100025636 3300005439 Bacteria 3859
33 Ga0070711_100067551 3300005439 Bacteria 2509
34 Ga0070700_100523171 3300005441 Bacteria 917
35 Ga0070694_100985924 3300005444 Bacteria 699
36 Ga0070663_100117200 3300005455 Bacteria 2008
37 Ga0070663_100350134 3300005455 Unclassified 1196
38 Ga0070663_100700077 3300005455 Bacteria 861
39 Ga0070663_101455032 3300005455 Unclassified 608
40 Ga0070678_100011077 3300005456 Bacteria 5543
41 Ga0070681_10014682 3300005458 Bacteria 7790
42 Ga0070681_10147509 3300005458 Bacteria 2281
43 Ga0070685_10699263 3300005466 Bacteria 739
44 Ga0070706_100429229 3300005467 Bacteria 1230
45 Ga0070679_100042669 3300005530 Bacteria 4518
46 Ga0070684_100008992 3300005535 Bacteria 7848
47 Ga0070684_100344232 3300005535 Unclassified 1371
48 Ga0070684_100800526 3300005535 Archaea 881
49 Ga0070684_100928972 3300005535 Bacteria 815
50 Ga0070684_100988921 3300005535 Bacteria 789
51 Ga0070684_101060887 3300005535 Bacteria 761
52 Ga0068853_100469738 3300005539 Bacteria 1185
53 Ga0068853_100482904 3300005539 Bacteria 1168
54 Ga0070672_100150316 3300005543 Bacteria 1926
55 Ga0070686_100050418 3300005544 Bacteria 2645
56 Ga0070686_100149321 3300005544 Bacteria 1635
57 Ga0070695_100606567 3300005545 Bacteria 860
58 Ga0070696_100047166 3300005546 Bacteria 2989
59 Ga0070693_100257612 3300005547 Unclassified 1159
60 Ga0070704_100446201 3300005549 Bacteria 1113
61 Ga0068855_101403550 3300005563 Bacteria 720
62 Ga0070664_100112964 3300005564 Bacteria 2372
63 Ga0070664_100399931 3300005564 Bacteria 1256
64 Ga0068857_100090637 3300005577 Bacteria 2736
65 Ga0068857_100150434 3300005577 Bacteria 2108
66 Ga0068856_100065616 3300005614 Bacteria 3587
67 Ga0068856_100072711 3300005614 Bacteria 3404
68 Ga0068856_100088805 3300005614 Bacteria 3073
69 Ga0068856_101533297 3300005614 Unclassified 680
70 Ga0068852_100009704 3300005616 Bacteria 7153
71 Ga0068852_100328262 3300005616 Bacteria 1488
72 Ga0068852_100874746 3300005616 Unclassified 915
73 Ga0068864_100424967 3300005618 Unclassified 1267
74 Ga0068866_10256444 3300005718 Bacteria 1073
75 Ga0068861_100251483 3300005719 Unclassified 1508
76 Ga0068851_10412930 3300005834 Bacteria 796
77 Ga0068863_100742938 3300005841 Bacteria 977
78 Ga0068858_100175146 3300005842 Bacteria 2024
79 Ga0068860_100015334 3300005843 Bacteria 7485
80 Ga0068860_100221247 3300005843 Bacteria 1838
81 Ga0068862_100719194 3300005844 Bacteria 969
82 Ga0081455_10017482 3300005937 Bacteria 6871
83 Ga0081455_10085768 3300005937 Bacteria 2566
84 Ga0081455_10156672 3300005937 Bacteria 1750
85 Ga0081538_10019678 3300005981 Bacteria 5001
86 Ga0081538_10048324 3300005981 Bacteria 2596
87 Ga0081539_10017320 3300005985 Bacteria 5067
88 Ga0070717_10272651 3300006028 Unclassified 1499
89 Ga0075365_10492814 3300006038 Bacteria 866
90 Ga0070715_10027493 3300006163 Bacteria 2272
91 Ga0070712_100004801 3300006175 Bacteria 8356
92 Ga0070712_100007279 3300006175 Bacteria 6906
93 Ga0070712_101059255 3300006175 Bacteria 703
94 Ga0097621_100229847 3300006237 Bacteria 1619
95 Ga0068871_100191513 3300006358 Bacteria 1762
96 Ga0068871_100208166 3300006358 Unclassified 1691
97 Ga0075428_100260878 3300006844 Bacteria 1866
98 Ga0075428_100813207 3300006844 Bacteria 993
99 Ga0075434_100009741 3300006871 Bacteria 8981
100 Ga0068865_100364408 3300006881 Bacteria 1174
101 Ga0075436_100009143 3300006914 Bacteria 6778
102 Ga0075435_100005424 3300007076 Bacteria 8900
103 Ga0105240_10553743 3300009093 Unclassified 1272
104 Ga0105240_11759094 3300009093 Bacteria 646
105 Ga0111539_10887654 3300009094 Bacteria 1037
106 Ga0105245_10462306 3300009098 Unclassified 1279
107 Ga0105245_10664139 3300009098 Bacteria 1073
108 Ga0105245_11538254 3300009098 Bacteria 716
109 Ga0105245_11881038 3300009098 Bacteria 652
110 Ga0105247_10048222 3300009101 Bacteria 2616
111 Ga0114129_10353317 3300009147 Bacteria 1946
112 Ga0114129_11215620 3300009147 Bacteria 938
113 Ga0105243_10067103 3300009148 Bacteria 2887
114 Ga0105243_10227682 3300009148 Bacteria 1652
115 Ga0105243_10280881 3300009148 Unclassified 1500
116 Ga0105241_10086929 3300009174 Bacteria 2459
117 Ga0105242_10010591 3300009176 Bacteria 7080
118 Ga0105242_10489866 3300009176 Unclassified 1167
119 Ga0105248_10261295 3300009177 Bacteria 1949
120 Ga0105237_10179379 3300009545 Bacteria 2118
121 Ga0105238_10041751 3300009551 Bacteria 4646
122 Ga0105238_10385089 3300009551 Bacteria 1394
123 Ga0105238_11607409 3300009551 Bacteria 680
124 Ga0105249_10710776 3300009553 Unclassified 1065
125 Ga0105239_10079872 3300010375 Bacteria 3599
126 Ga0105239_10160274 3300010375 Bacteria 2513
127 Ga0105239_10323928 3300010375 Bacteria 1738
128 Ga0105246_10211487 3300011119 Bacteria 1514
129 Ga0105246_10500603 3300011119 Bacteria 1032
130 Ga0105246_10533030 3300011119 Bacteria 1003
131 Ga0157371_10024406 3300013102 Bacteria 4415
132 Ga0157369_10003184 3300013105 Bacteria 19579
133 Ga0157369_10007709 3300013105 Bacteria 12386
134 Ga0157378_10013326 3300013297 Bacteria 7186
135 Ga0163162_10213498 3300013306 Bacteria 2060
136 Ga0163162_12753729 3300013306 Bacteria 566
137 Ga0157372_10019291 3300013307 Bacteria 7344
138 Ga0157372_10755560 3300013307 Bacteria 1131
139 Ga0157372_10768565 3300013307 Bacteria 1120
140 Ga0157372_10974705 3300013307 Bacteria 982
141 Ga0157372_12783573 3300013307 Bacteria 561
142 Ga0157375_10332437 3300013308 Bacteria 1684
143 Ga0157375_11769785 3300013308 Unclassified 732
144 Ga0163163_10161782 3300014325 Bacteria 2284
145 Ga0157380_10360874 3300014326 Bacteria 1363
146 Ga0157380_10903782 3300014326 Unclassified 909
147 Ga0157377_10186743 3300014745 Bacteria 1307
148 Ga0157379_10239985 3300014968 Bacteria 1644
149 Ga0157376_10132072 3300014969 Bacteria 2229
150 Ga0157376_11629395 3300014969 Unclassified 680
151 Ga0157376_11667495 3300014969 Bacteria 672
152 Ga0163161_11302709 3300017792 Bacteria 632
153 Ga0206356_10907563 3300020070 Bacteria 918
154 Ga0206356_11041398 3300020070 Unclassified 1259
155 Ga0206354_10235575 3300020081 Bacteria 4119
156 Ga0206354_11458746 3300020081 Bacteria 1006
157 Ga0206353_10050565 3300020082 Bacteria 1760
158 Ga0206353_11074253 3300020082 Bacteria 3832
159 Ga0213875_10632641 3300021388 Unclassified 518
160 Ga0224712_10119979 3300022467 Bacteria 1138
161 Ga0224712_10213875 3300022467 Bacteria 880
162 Ga0207642_10159579 3300025899 Unclassified 1209
163 Ga0207710_10038277 3300025900 Bacteria 2120
164 Ga0207680_10100758 3300025903 Bacteria 1855
165 Ga0207647_10170809 3300025904 Bacteria 1266
166 Ga0207685_10011826 3300025905 Bacteria 2641
167 Ga0207699_10884452 3300025906 Bacteria 659
168 Ga0207654_10617863 3300025911 Bacteria 774
169 Ga0207654_11066170 3300025911 Bacteria 588
170 Ga0207707_10114734 3300025912 Unclassified 2354
171 Ga0207707_10578708 3300025912 Bacteria 952
172 Ga0207707_10957996 3300025912 Unclassified 704
173 Ga0207695_10172984 3300025913 Bacteria 2084
174 Ga0207695_10709342 3300025913 Bacteria 886
175 Ga0207671_10761751 3300025914 Bacteria 769
176 Ga0207693_10006167 3300025915 Bacteria 9947
177 Ga0207693_10122284 3300025915 Bacteria 2044
178 Ga0207663_10044454 3300025916 Bacteria 2727
179 Ga0207663_10052119 3300025916 Unclassified 2551
180 Ga0207660_10072877 3300025917 Bacteria 2502
181 Ga0207662_10061269 3300025918 Bacteria 2258
182 Ga0207657_10021960 3300025919 Bacteria 5992
183 Ga0207649_10131538 3300025920 Unclassified 1700
184 Ga0207652_10651162 3300025921 Bacteria 942
185 Ga0207652_10964922 3300025921 Unclassified 751
186 Ga0207652_11406653 3300025921 Bacteria 601
187 Ga0207652_11411447 3300025921 Unclassified 600
188 Ga0207694_10065020 3300025924 Bacteria 2843
189 Ga0207694_10264734 3300025924 Bacteria 1409
190 Ga0207687_10469313 3300025927 Unclassified 1046
191 Ga0207700_11378466 3300025928 Bacteria 627
192 Ga0207664_10019891 3300025929 Bacteria 4969
193 Ga0207664_10206786 3300025929 Unclassified 1697
194 Ga0207644_10065320 3300025931 Unclassified 2646
195 Ga0207644_11132815 3300025931 Unclassified 658
196 Ga0207690_10010104 3300025932 Bacteria 5606
197 Ga0207706_10230250 3300025933 Bacteria 1621
198 Ga0207686_10008490 3300025934 Bacteria 5549
199 Ga0207686_10823962 3300025934 Bacteria 745
200 Ga0207709_10028119 3300025935 Bacteria 3248
201 Ga0207670_10315516 3300025936 Unclassified 1229
202 Ga0207669_10132473 3300025937 Bacteria 1716
203 Ga0207669_10915769 3300025937 Bacteria 733
204 Ga0207704_10249443 3300025938 Bacteria 1332
205 Ga0207704_10263814 3300025938 Unclassified 1300
206 Ga0207665_10235733 3300025939 Unclassified 1346
207 Ga0207691_11352200 3300025940 Unclassified 587
208 Ga0207711_10162061 3300025941 Bacteria 2025
209 Ga0207661_10002505 3300025944 Bacteria 12646
210 Ga0207661_10012397 3300025944 Bacteria 6193
211 Ga0207661_10128029 3300025944 Bacteria 2171
212 Ga0207679_10129273 3300025945 Bacteria 2024
213 Ga0207679_10676056 3300025945 Bacteria 935
214 Ga0207679_11033910 3300025945 Bacteria 753
215 Ga0207667_10563023 3300025949 Bacteria 1152
216 Ga0207712_10158621 3300025961 Bacteria 1755
217 Ga0207668_10086097 3300025972 Bacteria 2295
218 Ga0207640_10647461 3300025981 Bacteria 900
219 Ga0207640_12177224 3300025981 Bacteria 503
220 Ga0207677_10133095 3300026023 Bacteria 1891
221 Ga0207703_10093596 3300026035 Bacteria 2531
222 Ga0207639_10251194 3300026041 Bacteria 1542
223 Ga0207639_10429913 3300026041 Bacteria 1195
224 Ga0207639_10504332 3300026041 Bacteria 1106
225 Ga0207639_10950893 3300026041 Bacteria 804
226 Ga0207639_12205367 3300026041 Unclassified 512
227 Ga0207678_10241108 3300026067 Bacteria 1548
228 Ga0207678_10341501 3300026067 Unclassified 1290
229 Ga0207678_10507752 3300026067 Bacteria 1051
230 Ga0207708_10702241 3300026075 Unclassified 865
231 Ga0207702_10041274 3300026078 Bacteria 3869
232 Ga0207702_10092679 3300026078 Bacteria 2648
233 Ga0207702_10262847 3300026078 Bacteria 1626
234 Ga0207702_10265613 3300026078 Bacteria 1617
235 Ga0207648_11600897 3300026089 Unclassified 612
236 Ga0207676_12142010 3300026095 Unclassified 557
237 Ga0207674_10370053 3300026116 Bacteria 1385
238 Ga0207674_10808206 3300026116 Bacteria 905
239 Ga0207675_100258394 3300026118 Bacteria 1687
240 Ga0207675_100928706 3300026118 Bacteria 887
241 Ga0207683_10000098 3300026121 Bacteria 71739
242 Ga0207698_10021877 3300026142 Bacteria 4431
243 Ga0207698_10059363 3300026142 Bacteria 2970
244 Ga0207698_10283347 3300026142 Bacteria 1534
245 Ga0207698_10690854 3300026142 Bacteria 1014
246 Ga0268265_11075008 3300028380 Bacteria 798
247 Ga0268264_10093314 3300028381 Bacteria 2600
248 Ga0268264_11187219 3300028381 Bacteria 772
249 Ga0265337_1108361 3300028556 Bacteria 755
250 Ga0265326_10061220 3300028558 Unclassified 1065
251 Ga0265319_1007727 3300028563 Bacteria 4795
252 Ga0265319_1047543 3300028563 Unclassified 1427
253 Ga0265334_10037437 3300028573 Bacteria 1912
254 Ga0265334_10109717 3300028573 Unclassified 993
255 Ga0265318_10007533 3300028577 Bacteria 4911
256 Ga0265322_10022529 3300028654 Unclassified 1802
257 Ga0265322_10156053 3300028654 Bacteria 652
258 Ga0265338_10100973 3300028800 Bacteria 2351
259 Ga0265338_10204822 3300028800 Bacteria 1485
260 Ga0265330_10087805 3300031235 Bacteria 1336
261 Ga0265332_10037123 3300031238 Bacteria 2114
262 Ga0265320_10117898 3300031240 Unclassified 1212
263 Ga0265320_10317869 3300031240 Unclassified 688
264 Ga0265340_10125704 3300031247 Unclassified 1178
265 Ga0265327_10004579 3300031251 Bacteria 12173
266 Ga0265316_10042414 3300031344 Bacteria 3636
267 Ga0265314_10022410 3300031711 Bacteria 4837
268 Ga0265314_10251298 3300031711 Bacteria 1015
269 Ga0265314_10252805 3300031711 Bacteria 1011
270 Ga0265342_10056846 3300031712 Bacteria 2317
271 Ga0265342_10472873 3300031712 Bacteria 641
272 Ga0307405_10183407 3300031731 Unclassified 1505
273 Ga0307413_10079409 3300031824 Bacteria 2097
274 Ga0307413_10276487 3300031824 Bacteria 1260
275 Ga0307410_10094803 3300031852 Bacteria 2127
276 Ga0307410_11139711 3300031852 Unclassified 677
277 Ga0307406_11121733 3300031901 Unclassified 680
278 Ga0307407_10186674 3300031903 Bacteria 1378
279 Ga0307412_10534708 3300031911 Bacteria 982
280 Ga0307409_100645076 3300031995 Bacteria 1052
281 Ga0307416_100560894 3300032002 Bacteria 1217
282 Ga0307416_101443288 3300032002 Unclassified 794
283 Ga0307415_100061585 3300032126 Bacteria 2599
284 Ga0307415_100213534 3300032126 Unclassified 1541
285 Ga0373955_0349127 3300035172 Bacteria 896
286 Ga0373937_0174769 3300036401 Bacteria 2016
287 Ga0373937_0214869 3300036401 Bacteria 1810
288 Ga0373925_0602138 3300037068 Bacteria 905
289 Ga0395898_1539001 3300037466 Bacteria 590
290 Ga0395905_1189753 3300037471 Unclassified 666
291 Ga0395901_0056615 3300038443 Bacteria 4079
292 Ga0466967_0007852 3300045976 Bacteria 7752
293 Ga0466967_1175108 3300045976 Bacteria 764
294 Ga0495603_0168477 3300046455 Bacteria 1269
295 Ga0495629_0139341 3300046459 Bacteria 1688
296 Ga0495641_0061259 3300046461 Bacteria 1699
297 Ga0495651_0012763 3300046462 Bacteria 6486
298 Ga0495582_0124539 3300046473 Bacteria 1454
299 Ga0495662_0622691 3300046476 Unclassified 527
300 Ga0495584_0130727 3300046491 Bacteria 1274
301 Ga0495584_0446215 3300046491 Unclassified 658
302 Ga0495585_0338548 3300046492 Bacteria 733
303 Ga0495608_0053417 3300046511 Bacteria 2673
304 Ga0495616_0296482 3300046513 Bacteria 684
305 Ga0495618_0007884 3300046514 Bacteria 6445
306 Ga0495628_0009380 3300046516 Bacteria 8353
307 Ga0495630_0004756 3300046517 Bacteria 9527
308 Ga0495663_0158287 3300046525 Bacteria 776
309 Ga0495652_0054116 3300046529 Bacteria 3419
310 Ga0495640_0019889 3300046533 Bacteria 4952
311 Ga0495640_0836812 3300046533 Unclassified 547
312 Ga0495586_0111212 3300046535 Bacteria 1525
313 Ga0495645_0150976 3300046543 Bacteria 1614
314 Ga0495667_0056270 3300046559 Bacteria 2586
315 Ga0495656_0375476 3300046615 Bacteria 740
316 Ga0495634_0157129 3300046642 Bacteria 1435
317 Ga0495635_0216784 3300046663 Bacteria 1295
318 Ga0495635_0673489 3300046663 Unclassified 672
319 Ga0495657_0011660 3300046675 Bacteria 6561
320 Ga0495647_0386589 3300046681 Bacteria 641
321 Ga0495647_0473601 3300046681 Unclassified 581
322 Ga0495658_0483673 3300046683 Bacteria 791
323 Ga0495613_0131464 3300046689 Bacteria 1792
324 Ga0495589_0286799 3300046794 Bacteria 765
325 Ga0495600_0285339 3300046809 Bacteria 1044
326 Ga0495581_0262618 3300047315 Bacteria 1010
327 Ga0495674_0001934 3300047319 Bacteria 20441
328 Ga0495674_0233446 3300047319 Bacteria 1518
329 Ga0495674_0540340 3300047319 Unclassified 929
330 Ga0495676_0685621 3300047321 Bacteria 663
331 Ga0495680_0081775 3300047322 Bacteria 2438
332 Ga0495680_0299253 3300047322 Unclassified 1130
333 Ga0495684_0030072 3300047471 Bacteria 4170
334 Ga0495602_0746512 3300048088 Bacteria 661
335 Ga0496100_0002084 3300048903 Bacteria 10065
336 Ga0496100_0213766 3300048903 Unclassified 1412
337 Ga0496101_0018561 3300048904 Bacteria 4731
338 Ga0496101_0027219 3300048904 Bacteria 3980
339 Ga0496101_0853839 3300048904 Bacteria 717
340 Ga0496102_0002511 3300048905 Bacteria 15657
341 Ga0496102_0022947 3300048905 Bacteria 5536
342 Ga0496102_0067827 3300048905 Bacteria 3272
343 Ga0496102_1094213 3300048905 Unclassified 717
344 Ga0496103_0370408 3300048906 Bacteria 921
345 Ga0496104_0002813 3300048907 Bacteria 15001
346 Ga0496104_0015200 3300048907 Bacteria 6968
347 Ga0496104_0022969 3300048907 Bacteria 5732
348 Ga0496104_1425739 3300048907 Bacteria 596
349 Ga0496105_0000346 3300048908 Bacteria 30492
350 Ga0496105_0009674 3300048908 Bacteria 7546
351 Ga0496105_0644180 3300048908 Bacteria 818
352 Ga0496106_0029955 3300048909 Bacteria 4057
353 Ga0496106_0046292 3300048909 Bacteria 3269
354 Ga0496106_0396371 3300048909 Bacteria 1109
355 Ga0496107_0000876 3300048910 Bacteria 17713
356 Ga0496107_0004168 3300048910 Bacteria 9760
357 Ga0496107_0924674 3300048910 Bacteria 635
358 Ga0496108_0005288 3300048911 Bacteria 10418
359 Ga0496108_0008193 3300048911 Bacteria 8482
360 Ga0496108_0092812 3300048911 Bacteria 2567
361 Ga0496109_0002399 3300048912 Bacteria 15681
362 Ga0496109_0009001 3300048912 Bacteria 8502
363 Ga0496109_0017500 3300048912 Bacteria 6283
364 Ga0496109_0265251 3300048912 Unclassified 1618
365 Ga0496110_0004818 3300048913 Bacteria 10511
366 Ga0496110_0057804 3300048913 Bacteria 3415
367 Ga0496110_0149895 3300048913 Bacteria 2111
368 Ga0496111_0010905 3300048914 Bacteria 6113
369 Ga0496111_0016831 3300048914 Bacteria 5044
370 Ga0496111_0172226 3300048914 Bacteria 1608
371 Ga0496112_0035394 3300048915 Bacteria 4864
372 Ga0496112_0046637 3300048915 Bacteria 4251
373 Ga0496112_0079967 3300048915 Bacteria 3233
374 Ga0496112_0927974 3300048915 Bacteria 792
375 Ga0496113_0021444 3300048916 Bacteria 4557
376 Ga0496113_0067595 3300048916 Bacteria 2710
377 Ga0496113_0780120 3300048916 Bacteria 760
378 Ga0496114_0001893 3300048917 Bacteria 15899
379 Ga0496114_0020808 3300048917 Bacteria 5326
380 Ga0496114_0274673 3300048917 Bacteria 1485
381 Ga0496114_0383772 3300048917 Bacteria 1244
382 Ga0496115_0009605 3300048918 Bacteria 7193
383 Ga0496115_0033248 3300048918 Bacteria 4071
384 Ga0496115_0161637 3300048918 Bacteria 1851
385 Ga0496115_0206162 3300048918 Bacteria 1624
386 Ga0496115_0220197 3300048918 Bacteria 1566
387 Ga0501036_1003479 3300049572 Bacteria 683
388 Ga0501039_0347338 3300049575 Unclassified 1166
389 Ga0501041_0914722 3300049577 Bacteria 564
390 Ga0501067_0510712 3300049583 Bacteria 672
391 Ga0501068_1057049 3300049584 Bacteria 536
392 Ga0501069_0769321 3300049585 Bacteria 583
393 Ga0501071_0803219 3300049587 Bacteria 725
394 Ga0501075_0361975 3300049591 Bacteria 1106
395 Ga0501076_0697169 3300049592 Bacteria 838
396 Ga0501076_0758902 3300049592 Bacteria 800
397 Ga0501079_0277575 3300049741 Bacteria 1310
398 Ga0501081_0334098 3300049743 Bacteria 1115
399 Ga0501081_1089273 3300049743 Bacteria 604
400 Ga0501045_0342161 3300049824 Bacteria 1113
401 Ga0501045_1139234 3300049824 Bacteria 570
402 nmdc:mga09592_126603_c1 3300050508 Bacteria 2196
403 nmdc:mga06r32_40205_c1 3300050510 Bacteria 4438
404 nmdc:mga08y16_403131_c1 3300050511 Unclassified 1399
405 nmdc:mga0n895_26031_c1 3300050512 Bacteria 5534
406 nmdc:mga0rr50_10324_c1 3300050513 Bacteria 5921
407 nmdc:mga08x19_3557_c1 3300050514 Bacteria 9274
408 nmdc:mga0a205_295321_c1 3300050515 Bacteria 1494
409 Ga0495601_0144696 3300053077 Bacteria 1551
410 Ga0495601_0496170 3300053077 Unclassified 788
411 Ga0495601_0947965 3300053077 Unclassified 542
412 Ga0495612_0036493 3300053078 Bacteria 1995
413 Ga0495612_0173450 3300053078 Bacteria 945
414 Ga0495595_0047191 3300053084 Bacteria 1986
415 Ga0495595_0200206 3300053084 Bacteria 994
416 Ga0495619_0083154 3300053085 Bacteria 2159
417 Ga0495619_0274303 3300053085 Bacteria 1169
418 Ga0501084_0671630 3300054114 Bacteria 874
419 Ga0501084_1055124 3300054114 Bacteria 682
420 Ga0530510_0489965 3300061734 Bacteria 931
421 Ga0501045_0132525
422 JGI24735J21928_10131088
423 JGI25406J46586_10043311
424 Ga0070658_10858248
425 Ga0070658_11425264
426 Ga0070683_100007399
427 Ga0070683_100149157
428 Ga0070683_100534267
429 Ga0070683_101012776
430 Ga0070690_100440578
431 Ga0070690_101162509
432 Ga0070666_10483934
433 Ga0070680_100018952
434 Ga0068868_100042666
435 Ga0070660_100004701
436 Ga0070660_100694959
437 Ga0070691_10261672
438 Ga0070691_10813659
439 Ga0070661_100020233
440 Ga0070692_10075337
441 Ga0070669_100604294
442 Ga0070674_100212118
443 Ga0070674_100368706
444 Ga0070659_100022813
445 Ga0070659_100333635
446 Ga0070659_100422341
447 Ga0070659_100457239
448 Ga0070709_10949666
449 Ga0070714_100003099
450 Ga0070713_101185650
451 Ga0070710_10400355
452 Ga0070711_100025636
453 Ga0070711_100067551
454 Ga0070700_100523171
455 Ga0070694_100985924
456 Ga0070663_100117200
457 Ga0070663_100350134
458 Ga0070663_100700077
459 Ga0070663_101455032
460 Ga0070678_100011077
461 Ga0070681_10014682
462 Ga0070681_10147509
463 Ga0070685_10699263
464 Ga0070706_100429229
465 Ga0070679_100042669
466 Ga0070684_100008992
467 Ga0070684_100344232
468 Ga0070684_100800526
469 Ga0070684_100928972
470 Ga0070684_100988921
471 Ga0070684_101060887
472 Ga0068853_100469738
473 Ga0068853_100482904
474 Ga0070672_100150316
475 Ga0070686_100050418
476 Ga0070686_100149321
477 Ga0070695_100606567
478 Ga0070696_100047166
479 Ga0070693_100257612
480 Ga0070704_100446201
481 Ga0068855_101403550
482 Ga0070664_100112964
483 Ga0070664_100399931
484 Ga0068857_100090637
485 Ga0068857_100150434
486 Ga0068856_100065616
487 Ga0068856_100072711
488 Ga0068856_100088805
489 Ga0068856_101533297
490 Ga0068852_100009704
491 Ga0068852_100328262
492 Ga0068852_100874746
493 Ga0068864_100424967
494 Ga0068866_10256444
495 Ga0068861_100251483
496 Ga0068851_10412930
497 Ga0068863_100742938
498 Ga0068858_100175146
499 Ga0068860_100015334
500 Ga0068860_100221247
501 Ga0068862_100719194
502 Ga0081455_10017482
503 Ga0081455_10085768
504 Ga0081455_10156672
505 Ga0081538_10019678
506 Ga0081538_10048324
507 Ga0081539_10017320
508 Ga0070717_10272651
509 Ga0075365_10492814
510 Ga0070715_10027493
511 Ga0070712_100004801
512 Ga0070712_100007279
513 Ga0070712_101059255
514 Ga0097621_100229847
515 Ga0068871_100191513
516 Ga0068871_100208166
517 Ga0075428_100260878
518 Ga0075428_100813207
519 Ga0075434_100009741
520 Ga0068865_100364408
521 Ga0075436_100009143
522 Ga0075435_100005424
523 Ga0105240_10553743
524 Ga0105240_11759094
525 Ga0111539_10887654
526 Ga0105245_10462306
527 Ga0105245_10664139
528 Ga0105245_11538254
529 Ga0105245_11881038
530 Ga0105247_10048222
531 Ga0114129_10353317
532 Ga0114129_11215620
533 Ga0105243_10067103
534 Ga0105243_10227682
535 Ga0105243_10280881
536 Ga0105241_10086929
537 Ga0105242_10010591
538 Ga0105242_10489866
539 Ga0105248_10261295
540 Ga0105237_10179379
541 Ga0105238_10041751
542 Ga0105238_10385089
543 Ga0105238_11607409
544 Ga0105249_10710776
545 Ga0105239_10079872
546 Ga0105239_10160274
547 Ga0105239_10323928
548 Ga0105246_10211487
549 Ga0105246_10500603
550 Ga0105246_10533030
551 Ga0157371_10024406
552 Ga0157369_10003184
553 Ga0157369_10007709
554 Ga0157378_10013326
555 Ga0163162_10213498
556 Ga0163162_12753729
557 Ga0157372_10019291
558 Ga0157372_10755560
559 Ga0157372_10768565
560 Ga0157372_10974705
561 Ga0157372_12783573
562 Ga0157375_10332437
563 Ga0157375_11769785
564 Ga0163163_10161782
565 Ga0157380_10360874
566 Ga0157380_10903782
567 Ga0157377_10186743
568 Ga0157379_10239985
569 Ga0157376_10132072
570 Ga0157376_11629395
571 Ga0157376_11667495
572 Ga0163161_11302709
573 Ga0206356_10907563
574 Ga0206356_11041398
575 Ga0206354_10235575
576 Ga0206354_11458746
577 Ga0206353_10050565
578 Ga0206353_11074253
579 Ga0213875_10632641
580 Ga0224712_10119979
581 Ga0224712_10213875
582 Ga0207642_10159579
583 Ga0207710_10038277
584 Ga0207680_10100758
585 Ga0207647_10170809
586 Ga0207685_10011826
587 Ga0207699_10884452
588 Ga0207654_10617863
589 Ga0207654_11066170
590 Ga0207707_10114734
591 Ga0207707_10578708
592 Ga0207707_10957996
593 Ga0207695_10172984
594 Ga0207695_10709342
595 Ga0207671_10761751
596 Ga0207693_10006167
597 Ga0207693_10122284
598 Ga0207663_10044454
599 Ga0207663_10052119
600 Ga0207660_10072877
601 Ga0207662_10061269
602 Ga0207657_10021960
603 Ga0207649_10131538
604 Ga0207652_10651162
605 Ga0207652_10964922
606 Ga0207652_11406653
607 Ga0207652_11411447
608 Ga0207694_10065020
609 Ga0207694_10264734
610 Ga0207687_10469313
611 Ga0207700_11378466
612 Ga0207664_10019891
613 Ga0207664_10206786
614 Ga0207644_10065320
615 Ga0207644_11132815
616 Ga0207690_10010104
617 Ga0207706_10230250
618 Ga0207686_10008490
619 Ga0207686_10823962
620 Ga0207709_10028119
621 Ga0207670_10315516
622 Ga0207669_10132473
623 Ga0207669_10915769
624 Ga0207704_10249443
625 Ga0207704_10263814
626 Ga0207665_10235733
627 Ga0207691_11352200
628 Ga0207711_10162061
629 Ga0207661_10002505
630 Ga0207661_10012397
631 Ga0207661_10128029
632 Ga0207679_10129273
633 Ga0207679_10676056
634 Ga0207679_11033910
635 Ga0207667_10563023
636 Ga0207712_10158621
637 Ga0207668_10086097
638 Ga0207640_10647461
639 Ga0207640_12177224
640 Ga0207677_10133095
641 Ga0207703_10093596
642 Ga0207639_10251194
643 Ga0207639_10429913
644 Ga0207639_10504332
645 Ga0207639_10950893
646 Ga0207639_12205367
647 Ga0207678_10241108
648 Ga0207678_10341501
649 Ga0207678_10507752
650 Ga0207708_10702241
651 Ga0207702_10041274
652 Ga0207702_10092679
653 Ga0207702_10262847
654 Ga0207702_10265613
655 Ga0207648_11600897
656 Ga0207676_12142010
657 Ga0207674_10370053
658 Ga0207674_10808206
659 Ga0207675_100258394
660 Ga0207675_100928706
661 Ga0207683_10000098
662 Ga0207698_10021877
663 Ga0207698_10059363
664 Ga0207698_10283347
665 Ga0207698_10690854
666 Ga0268265_11075008
667 Ga0268264_10093314
668 Ga0268264_11187219
669 Ga0265337_1108361
670 Ga0265326_10061220
671 Ga0265319_1007727
672 Ga0265319_1047543
673 Ga0265334_10037437
674 Ga0265334_10109717
675 Ga0265318_10007533
676 Ga0265322_10022529
677 Ga0265322_10156053
678 Ga0265338_10100973
679 Ga0265338_10204822
680 Ga0265330_10087805
681 Ga0265332_10037123
682 Ga0265320_10117898
683 Ga0265320_10317869
684 Ga0265340_10125704
685 Ga0265327_10004579
686 Ga0265316_10042414
687 Ga0265314_10022410
688 Ga0265314_10251298
689 Ga0265314_10252805
690 Ga0265342_10056846
691 Ga0265342_10472873
692 Ga0307405_10183407
693 Ga0307413_10079409
694 Ga0307413_10276487
695 Ga0307410_10094803
696 Ga0307410_11139711
697 Ga0307406_11121733
698 Ga0307407_10186674
699 Ga0307412_10534708
700 Ga0307409_100645076
701 Ga0307416_100560894
702 Ga0307416_101443288
703 Ga0307415_100061585
704 Ga0307415_100213534
705 Ga0373955_0349127
706 Ga0373937_0174769
707 Ga0373937_0214869
708 Ga0373925_0602138
709 Ga0395898_1539001
710 Ga0395905_1189753
711 Ga0395901_0056615
712 Ga0466967_0007852
713 Ga0466967_1175108
714 Ga0495603_0168477
715 Ga0495629_0139341
716 Ga0495641_0061259
717 Ga0495651_0012763
718 Ga0495582_0124539
719 Ga0495662_0622691
720 Ga0495584_0130727
721 Ga0495584_0446215
722 Ga0495585_0338548
723 Ga0495608_0053417
724 Ga0495616_0296482
725 Ga0495618_0007884
726 Ga0495628_0009380
727 Ga0495630_0004756
728 Ga0495663_0158287
729 Ga0495652_0054116
730 Ga0495640_0019889
731 Ga0495640_0836812
732 Ga0495586_0111212
733 Ga0495645_0150976
734 Ga0495667_0056270
735 Ga0495656_0375476
736 Ga0495634_0157129
737 Ga0495635_0216784
738 Ga0495635_0673489
739 Ga0495657_0011660
740 Ga0495647_0386589
741 Ga0495647_0473601
742 Ga0495658_0483673
743 Ga0495613_0131464
744 Ga0495589_0286799
745 Ga0495600_0285339
746 Ga0495581_0262618
747 Ga0495674_0001934
748 Ga0495674_0233446
749 Ga0495674_0540340
750 Ga0495676_0685621
751 Ga0495680_0081775
752 Ga0495680_0299253
753 Ga0495684_0030072
754 Ga0495602_0746512
755 Ga0496100_0002084
756 Ga0496100_0213766
757 Ga0496101_0018561
758 Ga0496101_0027219
759 Ga0496101_0853839
760 Ga0496102_0002511
761 Ga0496102_0022947
762 Ga0496102_0067827
763 Ga0496102_1094213
764 Ga0496103_0370408
765 Ga0496104_0002813
766 Ga0496104_0015200
767 Ga0496104_0022969
768 Ga0496104_1425739
769 Ga0496105_0000346
770 Ga0496105_0009674
771 Ga0496105_0644180
772 Ga0496106_0029955
773 Ga0496106_0046292
774 Ga0496106_0396371
775 Ga0496107_0000876
776 Ga0496107_0004168
777 Ga0496107_0924674
778 Ga0496108_0005288
779 Ga0496108_0008193
780 Ga0496108_0092812
781 Ga0496109_0002399
782 Ga0496109_0009001
783 Ga0496109_0017500
784 Ga0496109_0265251
785 Ga0496110_0004818
786 Ga0496110_0057804
787 Ga0496110_0149895
788 Ga0496111_0010905
789 Ga0496111_0016831
790 Ga0496111_0172226
791 Ga0496112_0035394
792 Ga0496112_0046637
793 Ga0496112_0079967
794 Ga0496112_0927974
795 Ga0496113_0021444
796 Ga0496113_0067595
797 Ga0496113_0780120
798 Ga0496114_0001893
799 Ga0496114_0020808
800 Ga0496114_0274673
801 Ga0496114_0383772
802 Ga0496115_0009605
803 Ga0496115_0033248
804 Ga0496115_0161637
805 Ga0496115_0206162
806 Ga0496115_0220197
807 Ga0501036_1003479
808 Ga0501039_0347338
809 Ga0501041_0914722
810 Ga0501067_0510712
811 Ga0501068_1057049
812 Ga0501069_0769321
813 Ga0501071_0803219
814 Ga0501075_0361975
815 Ga0501076_0697169
816 Ga0501076_0758902
817 Ga0501079_0277575
818 Ga0501081_0334098
819 Ga0501081_1089273
820 Ga0501045_0342161
821 Ga0501045_1139234
822 nmdc:mga09592_126603_c1
823 nmdc:mga06r32_40205_c1
824 nmdc:mga08y16_403131_c1
825 nmdc:mga0n895_26031_c1
826 nmdc:mga0rr50_10324_c1
827 nmdc:mga08x19_3557_c1
828 nmdc:mga0a205_295321_c1
829 Ga0495601_0144696
830 Ga0495601_0496170
831 Ga0495601_0947965
832 Ga0495612_0036493
833 Ga0495612_0173450
834 Ga0495595_0047191
835 Ga0495595_0200206
836 Ga0495619_0083154
837 Ga0495619_0274303
838 Ga0501084_0671630
839 Ga0501084_1055124
840 Ga0530510_0489965

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20256

MoCoBD_2

Molybdopterin cofactor-binding domain

2

163

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_E carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.8271 8 153
1n5w-assembly1.cif.gz_B crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8068 8 151
1zxi-assembly1.cif.gz_B reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8011 5 153
4zoh-assembly1.cif.gz_A crystal structure of glyceraldehyde oxidoreductase 0.788 6 151
1ffv-assembly1.cif.gz_E carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.7819 8 153
ID Description Score Start End Superfamily
1n5wB03 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.8074 8 151 3.30.365.10
4zohA05 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.7731 1 151 3.30.365.10
1n5wB03 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.7543 8 151 3.30.365.10
af_P90835_1_115_3.30.429.10 Alpha Beta;2-Layer Sandwich;Macrophage Migration Inhibitory Factor;Macrophage Migration Inhibitory Factor 0.7501 27 54 3.30.429.10
1sb3D05 Alpha Beta;2-Layer Sandwich;Aldehyde Oxidoreductase; domain 4;Aldehyde oxidase/xanthine dehydrogenase, molybdopterin binding domain 0.7454 2 151 3.30.365.10
ID Description Score Start End GO Terms
AF-A0A7V9S1N4-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9359 1 153 GO:0016491
AF-A0A6J4TFH0-F1-model_v4 Aldehyde oxidase/xanthine dehydrogenase second molybdopterin binding domain-containing protein 0.8725 3 153 GO:0016491
AF-A0A6J4TFH0-F1-model_v4 Aldehyde oxidase/xanthine dehydrogenase second molybdopterin binding domain-containing protein 0.8615 3 153 GO:0016491
AF-K4LJS1-F1-model_v4 Carbon monoxide dehydrogenase form I large subunit 0.8554 8 151 GO:0005506
GO:0016491
AF-A0A7W1K9S7-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.85 4 140 GO:0016491

Map