F439764

General Info

Members Datasets Scaffolds Average Seq Length
420 212 840 131

Family's Representative Sequence

Representative Sequence 3300028563|Ga0265319_1015122|Ga0265319_10151226
Length 145
Sequence MPIRRRGALCRRHPGRRTRVPEPGPSSFELLVERALDGLPEPFVRLLDGVAVVIEDEPTREQSRDTRGRPLGRYGLYGLYEGTPLIEYGADLVPFPNKITLFRLALEEDFPEPNELAEEVRKTVVHELAHHAGFDEDRLREMDFE

Samples

Sample ID Description Type Environment
1 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
139 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
140 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
141 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
158 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
176 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
198 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
202 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
204 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 3.57
Rhizosphere 95.95
Stem 0
Stem Tuber 0
Unclassified 19.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265319_1015122 3300028563 Bacteria 3002
2 Ga0065715_10684380 3300005293 Unclassified 661
3 Ga0065707_10196232 3300005295 Bacteria 1328
4 Ga0070683_100175485 3300005329 Bacteria 2034
5 Ga0068869_100475577 3300005334 Bacteria 1039
6 Ga0068869_100772349 3300005334 Bacteria 824
7 Ga0070666_10391770 3300005335 Bacteria 998
8 Ga0070666_10489299 3300005335 Bacteria 891
9 Ga0070682_100467149 3300005337 Bacteria 970
10 Ga0068868_101160613 3300005338 Bacteria 713
11 Ga0070691_10355191 3300005341 Bacteria 815
12 Ga0070668_100380696 3300005347 Bacteria 1201
13 Ga0070669_100091012 3300005353 Bacteria 2287
14 Ga0070669_101023991 3300005353 Unclassified 709
15 Ga0070675_100000134 3300005354 Bacteria 44325
16 Ga0070675_100491639 3300005354 Bacteria 1105
17 Ga0070671_100009515 3300005355 Bacteria 7800
18 Ga0070671_100700012 3300005355 Unclassified 879
19 Ga0070674_100020633 3300005356 Bacteria 4215
20 Ga0070674_100136361 3300005356 Bacteria 1836
21 Ga0070674_100824597 3300005356 Unclassified 803
22 Ga0070673_100034160 3300005364 Bacteria 3845
23 Ga0070673_100117570 3300005364 Bacteria 2213
24 Ga0070673_100449386 3300005364 Unclassified 1159
25 Ga0070673_101354991 3300005364 Bacteria 669
26 Ga0070688_101277176 3300005365 Unclassified 592
27 Ga0070667_100079430 3300005367 Bacteria 2804
28 Ga0070701_10235741 3300005438 Bacteria 1098
29 Ga0070705_100267076 3300005440 Bacteria 1210
30 Ga0070700_100892349 3300005441 Bacteria 723
31 Ga0070694_100325034 3300005444 Bacteria 1185
32 Ga0070708_100582789 3300005445 Bacteria 1055
33 Ga0070708_100888547 3300005445 Bacteria 837
34 Ga0070678_101004915 3300005456 Unclassified 767
35 Ga0070678_101083583 3300005456 Bacteria 739
36 Ga0070662_101924318 3300005457 Bacteria 511
37 Ga0068867_100364144 3300005459 Bacteria 1210
38 Ga0068867_100665162 3300005459 Unclassified 915
39 Ga0070685_10273011 3300005466 Bacteria 1129
40 Ga0070706_100708277 3300005467 Bacteria 933
41 Ga0070707_100469116 3300005468 Bacteria 1220
42 Ga0070707_100583634 3300005468 Bacteria 1080
43 Ga0070707_102285803 3300005468 Bacteria 508
44 Ga0070698_100657698 3300005471 Bacteria 989
45 Ga0070699_100063912 3300005518 Bacteria 3192
46 Ga0070699_100110354 3300005518 Bacteria 2415
47 Ga0070699_100354432 3300005518 Bacteria 1322
48 Ga0070699_100496918 3300005518 Unclassified 1108
49 Ga0070697_100152043 3300005536 Bacteria 1951
50 Ga0070697_100175706 3300005536 Bacteria 1814
51 Ga0070697_100229552 3300005536 Bacteria 1583
52 Ga0070697_100261184 3300005536 Bacteria 1483
53 Ga0070697_100390949 3300005536 Bacteria 1206
54 Ga0070672_100013127 3300005543 Bacteria 5838
55 Ga0070672_100264191 3300005543 Bacteria 1452
56 Ga0070686_100050701 3300005544 Bacteria 2639
57 Ga0070695_100171519 3300005545 Unclassified 1531
58 Ga0070696_100698349 3300005546 Unclassified 827
59 Ga0070696_101040878 3300005546 Unclassified 685
60 Ga0070693_100505259 3300005547 Bacteria 858
61 Ga0070704_100029720 3300005549 Bacteria 3653
62 Ga0070664_100480897 3300005564 Bacteria 1143
63 Ga0068854_100471781 3300005578 Unclassified 1052
64 Ga0068854_101205764 3300005578 Bacteria 678
65 Ga0070702_100194887 3300005615 Bacteria 1336
66 Ga0068859_101565558 3300005617 Bacteria 728
67 Ga0068859_101920927 3300005617 Unclassified 654
68 Ga0068864_101019898 3300005618 Bacteria 821
69 Ga0068866_10581855 3300005718 Unclassified 753
70 Ga0068861_100033834 3300005719 Bacteria 3774
71 Ga0068861_100112258 3300005719 Bacteria 2185
72 Ga0068863_100086786 3300005841 Bacteria 2965
73 Ga0068863_100334480 3300005841 Bacteria 1472
74 Ga0068863_100342893 3300005841 Bacteria 1454
75 Ga0068860_100034524 3300005843 Bacteria 4852
76 Ga0068860_100655386 3300005843 Bacteria 1058
77 Ga0068862_100113824 3300005844 Bacteria 2377
78 Ga0068862_100395285 3300005844 Bacteria 1292
79 Ga0081455_10108724 3300005937 Bacteria 2208
80 Ga0070712_100642145 3300006175 Bacteria 901
81 Ga0097621_100027247 3300006237 Bacteria 4492
82 Ga0097621_100163628 3300006237 Bacteria 1914
83 Ga0097621_101339570 3300006237 Bacteria 677
84 Ga0068871_100049837 3300006358 Bacteria 3386
85 Ga0068871_100999473 3300006358 Bacteria 779
86 Ga0068871_101118523 3300006358 Bacteria 737
87 Ga0075428_100231839 3300006844 Bacteria 1992
88 Ga0075428_101116318 3300006844 Bacteria 833
89 Ga0075433_10081188 3300006852 Bacteria 2859
90 Ga0075433_10119826 3300006852 Bacteria 2336
91 Ga0075433_10172300 3300006852 Bacteria 1926
92 Ga0075433_10370681 3300006852 Bacteria 1264
93 Ga0075433_10584237 3300006852 Unclassified 981
94 Ga0075434_100000442 3300006871 Bacteria 30797
95 Ga0075434_100756561 3300006871 Unclassified 988
96 Ga0075434_100899860 3300006871 Unclassified 900
97 Ga0075434_100907724 3300006871 Bacteria 896
98 Ga0075434_101446284 3300006871 Unclassified 697
99 Ga0075429_101027016 3300006880 Unclassified 721
100 Ga0068865_100037132 3300006881 Bacteria 3288
101 Ga0068865_100072828 3300006881 Bacteria 2441
102 Ga0068865_100879560 3300006881 Bacteria 778
103 Ga0075436_100002424 3300006914 Bacteria 12850
104 Ga0075436_100080333 3300006914 Bacteria 2259
105 Ga0075436_100516533 3300006914 Unclassified 875
106 Ga0097620_101565639 3300006931 Bacteria 728
107 Ga0097620_101921002 3300006931 Unclassified 654
108 Ga0075435_100000293 3300007076 Bacteria 30982
109 Ga0075435_100002142 3300007076 Bacteria 13020
110 Ga0075435_100007134 3300007076 Bacteria 7941
111 Ga0075435_100057908 3300007076 Bacteria 3135
112 Ga0075435_100092553 3300007076 Bacteria 2497
113 Ga0075435_100398233 3300007076 Bacteria 1184
114 Ga0075435_100834911 3300007076 Bacteria 803
115 Ga0105240_10035120 3300009093 Bacteria 6464
116 Ga0105240_10146612 3300009093 Bacteria 2816
117 Ga0111539_10026198 3300009094 Bacteria 7135
118 Ga0111539_10480817 3300009094 Bacteria 1447
119 Ga0111539_10805602 3300009094 Unclassified 1093
120 Ga0105245_10016947 3300009098 Bacteria 6361
121 Ga0105245_10166172 3300009098 Bacteria 2098
122 Ga0105245_10365457 3300009098 Bacteria 1433
123 Ga0105245_10748698 3300009098 Bacteria 1013
124 Ga0105245_11240711 3300009098 Bacteria 794
125 Ga0105247_11665291 3300009101 Bacteria 526
126 Ga0114129_10002338 3300009147 Bacteria 26309
127 Ga0114129_10003015 3300009147 Bacteria 23608
128 Ga0114129_10015456 3300009147 Bacteria 10857
129 Ga0114129_10021659 3300009147 Bacteria 9122
130 Ga0114129_10023706 3300009147 Bacteria 8700
131 Ga0114129_10056128 3300009147 Bacteria 5518
132 Ga0114129_10093219 3300009147 Bacteria 4172
133 Ga0114129_10130821 3300009147 Bacteria 3447
134 Ga0114129_10290454 3300009147 Bacteria 2182
135 Ga0114129_10292025 3300009147 Bacteria 2175
136 Ga0114129_10303480 3300009147 Bacteria 2127
137 Ga0114129_10412094 3300009147 Bacteria 1779
138 Ga0114129_10503459 3300009147 Bacteria 1582
139 Ga0114129_10963768 3300009147 Unclassified 1077
140 Ga0105243_10018903 3300009148 Bacteria 5225
141 Ga0105241_10083475 3300009174 Bacteria 2506
142 Ga0105242_10030730 3300009176 Bacteria 4289
143 Ga0105242_10087968 3300009176 Bacteria 2609
144 Ga0105242_10376540 3300009176 Unclassified 1318
145 Ga0105242_11438379 3300009176 Bacteria 718
146 Ga0105248_10024188 3300009177 Bacteria 6751
147 Ga0105248_10188734 3300009177 Bacteria 2322
148 Ga0105248_10381745 3300009177 Bacteria 1586
149 Ga0105248_11494976 3300009177 Bacteria 765
150 Ga0105238_10069511 3300009551 Bacteria 3522
151 Ga0105238_10957691 3300009551 Unclassified 876
152 Ga0105238_12001143 3300009551 Bacteria 613
153 Ga0105249_10130365 3300009553 Bacteria 2400
154 Ga0105249_10419381 3300009553 Bacteria 1372
155 Ga0105249_10810451 3300009553 Bacteria 1000
156 Ga0105249_11428277 3300009553 Unclassified 764
157 Ga0105239_11026005 3300010375 Bacteria 949
158 Ga0105239_12915786 3300010375 Unclassified 558
159 Ga0157374_10424466 3300013296 Bacteria 1329
160 Ga0157374_11312331 3300013296 Bacteria 746
161 Ga0157378_10286272 3300013297 Bacteria 1590
162 Ga0157378_11634442 3300013297 Unclassified 690
163 Ga0157378_11679764 3300013297 Unclassified 682
164 Ga0163162_10028358 3300013306 Bacteria 5539
165 Ga0163162_10068695 3300013306 Bacteria 3595
166 Ga0157375_10057282 3300013308 Bacteria 3851
167 Ga0157375_10117857 3300013308 Bacteria 2761
168 Ga0157375_10760469 3300013308 Unclassified 1120
169 Ga0163163_11165170 3300014325 Unclassified 833
170 Ga0163163_11947885 3300014325 Bacteria 647
171 Ga0157380_10101122 3300014326 Bacteria 2401
172 Ga0157380_10350898 3300014326 Unclassified 1380
173 Ga0157380_10420439 3300014326 Bacteria 1275
174 Ga0157380_10743759 3300014326 Bacteria 991
175 Ga0157380_11074393 3300014326 Unclassified 842
176 Ga0157380_11087749 3300014326 Unclassified 838
177 Ga0157377_10518277 3300014745 Bacteria 836
178 Ga0157379_10014346 3300014968 Bacteria 6953
179 Ga0157379_10367632 3300014968 Unclassified 1319
180 Ga0157379_11818871 3300014968 Unclassified 599
181 Ga0157376_10003337 3300014969 Bacteria 11040
182 Ga0157376_10173863 3300014969 Bacteria 1963
183 Ga0157376_10277844 3300014969 Unclassified 1576
184 Ga0163161_10314295 3300017792 Bacteria 1237
185 Ga0163161_10635819 3300017792 Bacteria 883
186 Ga0207697_10028285 3300025315 Bacteria 2293
187 Ga0207642_10383690 3300025899 Bacteria 837
188 Ga0207680_10241527 3300025903 Bacteria 1245
189 Ga0207685_10067639 3300025905 Bacteria 1437
190 Ga0207645_10190251 3300025907 Unclassified 1348
191 Ga0207645_10558963 3300025907 Bacteria 776
192 Ga0207684_10185355 3300025910 Bacteria 1795
193 Ga0207707_10051774 3300025912 Bacteria 3576
194 Ga0207695_10043788 3300025913 Bacteria 4766
195 Ga0207693_10476694 3300025915 Bacteria 974
196 Ga0207662_10397563 3300025918 Bacteria 934
197 Ga0207652_11739448 3300025921 Bacteria 528
198 Ga0207646_10129675 3300025922 Bacteria 2269
199 Ga0207646_10581061 3300025922 Bacteria 1006
200 Ga0207681_10031728 3300025923 Bacteria 3452
201 Ga0207681_10177427 3300025923 Bacteria 1620
202 Ga0207694_10184368 3300025924 Bacteria 1693
203 Ga0207694_10556548 3300025924 Bacteria 963
204 Ga0207659_10002378 3300025926 Bacteria 11202
205 Ga0207659_10264035 3300025926 Bacteria 1402
206 Ga0207659_11152999 3300025926 Unclassified 666
207 Ga0207687_10010364 3300025927 Bacteria 6089
208 Ga0207687_10325492 3300025927 Bacteria 1245
209 Ga0207687_10499078 3300025927 Bacteria 1015
210 Ga0207644_10023932 3300025931 Bacteria 4188
211 Ga0207644_10537515 3300025931 Unclassified 967
212 Ga0207686_10002322 3300025934 Bacteria 10411
213 Ga0207686_10351364 3300025934 Unclassified 1110
214 Ga0207709_10082274 3300025935 Bacteria 2079
215 Ga0207709_10914859 3300025935 Bacteria 713
216 Ga0207709_11315964 3300025935 Bacteria 597
217 Ga0207670_10320978 3300025936 Bacteria 1219
218 Ga0207670_10518508 3300025936 Bacteria 970
219 Ga0207669_10539513 3300025937 Bacteria 939
220 Ga0207669_10802603 3300025937 Bacteria 781
221 Ga0207704_10041693 3300025938 Unclassified 2694
222 Ga0207704_10467447 3300025938 Unclassified 1010
223 Ga0207704_10820290 3300025938 Bacteria 778
224 Ga0207691_10036213 3300025940 Bacteria 4572
225 Ga0207691_10306318 3300025940 Bacteria 1364
226 Ga0207711_10056083 3300025941 Bacteria 3384
227 Ga0207711_10091939 3300025941 Bacteria 2669
228 Ga0207711_10113116 3300025941 Unclassified 2417
229 Ga0207711_10231413 3300025941 Unclassified 1693
230 Ga0207711_11278622 3300025941 Archaea 676
231 Ga0207689_10498825 3300025942 Bacteria 1020
232 Ga0207661_10180213 3300025944 Bacteria 1845
233 Ga0207679_10120594 3300025945 Bacteria 2087
234 Ga0207651_10039551 3300025960 Bacteria 3111
235 Ga0207651_10060500 3300025960 Bacteria 2630
236 Ga0207651_10455660 3300025960 Unclassified 1098
237 Ga0207651_10486521 3300025960 Bacteria 1064
238 Ga0207651_10673015 3300025960 Unclassified 910
239 Ga0207651_11099740 3300025960 Unclassified 712
240 Ga0207712_10633077 3300025961 Bacteria 928
241 Ga0207668_10121472 3300025972 Bacteria 1979
242 Ga0207668_10591422 3300025972 Bacteria 966
243 Ga0207640_10825744 3300025981 Bacteria 805
244 Ga0207640_11449194 3300025981 Bacteria 616
245 Ga0207658_10061154 3300025986 Bacteria 2813
246 Ga0207658_10765109 3300025986 Bacteria 875
247 Ga0207658_11061250 3300025986 Bacteria 740
248 Ga0207677_10045228 3300026023 Bacteria 2939
249 Ga0207677_11093777 3300026023 Bacteria 726
250 Ga0207703_10725911 3300026035 Bacteria 946
251 Ga0207678_10704915 3300026067 Bacteria 888
252 Ga0207708_10047836 3300026075 Bacteria 3255
253 Ga0207641_10015850 3300026088 Bacteria 6171
254 Ga0207641_10178954 3300026088 Bacteria 1941
255 Ga0207641_10183963 3300026088 Bacteria 1916
256 Ga0207641_10291361 3300026088 Bacteria 1539
257 Ga0207641_11636165 3300026088 Bacteria 646
258 Ga0207648_10159890 3300026089 Bacteria 1989
259 Ga0207648_11894402 3300026089 Bacteria 558
260 Ga0207676_10952051 3300026095 Bacteria 844
261 Ga0207675_100068906 3300026118 Bacteria 3306
262 Ga0207675_100790980 3300026118 Unclassified 961
263 Ga0207675_101042335 3300026118 Bacteria 837
264 Ga0207675_102270622 3300026118 Unclassified 557
265 Ga0207683_10165936 3300026121 Bacteria 1998
266 Ga0207683_10175763 3300026121 Bacteria 1940
267 Ga0207683_10482369 3300026121 Bacteria 1144
268 Ga0207683_11310303 3300026121 Unclassified 670
269 Ga0209998_10003242 3300027717 Bacteria 3586
270 Ga0209998_10044178 3300027717 Bacteria 1018
271 Ga0207428_10375243 3300027907 Unclassified 1044
272 Ga0207428_10970524 3300027907 Unclassified 598
273 Ga0268266_10756857 3300028379 Bacteria 938
274 Ga0268265_10636462 3300028380 Bacteria 1023
275 Ga0268265_10828417 3300028380 Bacteria 904
276 Ga0268264_10087555 3300028381 Bacteria 2678
277 Ga0268264_10751454 3300028381 Bacteria 971
278 Ga0265319_1036235 3300028563 Bacteria 1688
279 Ga0265318_10016135 3300028577 Bacteria 3091
280 Ga0265318_10058863 3300028577 Bacteria 1433
281 Ga0265329_10210761 3300031242 Bacteria 641
282 Ga0265339_10266343 3300031249 Bacteria 825
283 Ga0265316_10599181 3300031344 Unclassified 781
284 Ga0307412_10734396 3300031911 Unclassified 851
285 Ga0307411_10485026 3300032005 Unclassified 1042
286 Ga0373930_0007988 3300034816 Bacteria 1839
287 Ga0373948_0007640 3300034817 Unclassified 1824
288 Ga0373950_0001312 3300034818 Bacteria 3217
289 Ga0373958_0018650 3300034819 Bacteria 1260
290 Ga0373959_0010613 3300034820 Bacteria 1612
291 Ga0373959_0182922 3300034820 Bacteria 546
292 Ga0373938_0041263 3300034957 Unclassified 1026
293 Ga0373928_0000213 3300035084 Bacteria 11230
294 Ga0373928_0287745 3300035084 Unclassified 500
295 Ga0373929_0000613 3300035085 Bacteria 6888
296 Ga0373940_0032083 3300035088 Bacteria 1406
297 Ga0373949_0007666 3300035090 Bacteria 2365
298 Ga0373951_0002652 3300035091 Bacteria 4489
299 Ga0373952_0205934 3300035092 Unclassified 578
300 Ga0373932_0005469 3300035112 Bacteria 2988
301 Ga0373939_0000214 3300035114 Bacteria 15833
302 Ga0373941_0000595 3300035115 Bacteria 7321
303 Ga0373960_0004715 3300035121 Bacteria 3137
304 Ga0373960_0374194 3300035121 Bacteria 545
305 Ga0373943_0116353 3300035170 Bacteria 1416
306 Ga0373943_0771723 3300035170 Bacteria 571
307 Ga0373942_0000656 3300035207 Bacteria 9706
308 Ga0373942_0342729 3300035207 Bacteria 527
309 Ga0373961_0002177 3300035241 Bacteria 5205
310 Ga0373961_0269152 3300035241 Unclassified 622
311 Ga0373962_0011990 3300035242 Bacteria 2179
312 Ga0373962_0063442 3300035242 Bacteria 1090
313 Ga0373931_0026436 3300035691 Bacteria 2954
314 Ga0373931_0082604 3300035691 Bacteria 1776
315 Ga0373931_0399932 3300035691 Unclassified 869
316 Ga0373931_0832830 3300035691 Unclassified 617
317 Ga0373935_0376537 3300035692 Bacteria 1016
318 Ga0373925_1518068 3300037068 Bacteria 548
319 Ga0451847_0706269 3300041503 Unclassified 542
320 Ga0439431_0175914 3300041997 Bacteria 616
321 Ga0439434_0182459 3300042435 Bacteria 703
322 Ga0439435_0228369 3300042436 Bacteria 621
323 Ga0439460_0183235 3300042461 Unclassified 708
324 Ga0450893_0062498 3300042532 Unclassified 713
325 Ga0466963_0670079 3300044694 Unclassified 732
326 Ga0453684_0168134 3300044712 Bacteria 2587
327 Ga0451576_0069049 3300045051 Bacteria 3677
328 Ga0451576_0679345 3300045051 Bacteria 1082
329 Ga0451576_0957677 3300045051 Bacteria 897
330 Ga0466967_0240252 3300045976 Bacteria 1728
331 Ga0495641_0201484 3300046461 Bacteria 892
332 Ga0495651_0364409 3300046462 Bacteria 952
333 Ga0495580_0996603 3300046472 Bacteria 534
334 Ga0495582_0424692 3300046473 Bacteria 767
335 Ga0495639_0342931 3300046475 Bacteria 749
336 Ga0495628_0251321 3300046516 Unclassified 1320
337 Ga0495644_0400069 3300046523 Bacteria 544
338 Ga0495665_0209016 3300046531 Bacteria 1011
339 Ga0495640_0094603 3300046533 Bacteria 1968
340 Ga0495609_0404492 3300046538 Unclassified 546
341 Ga0495633_0049958 3300046558 Unclassified 1973
342 Ga0495659_0079158 3300046664 Bacteria 1245
343 Ga0495670_0814602 3300046691 Archaea 510
344 Ga0495674_0246006 3300047319 Bacteria 1473
345 Ga0495676_0298947 3300047321 Bacteria 1086
346 Ga0495680_0726310 3300047322 Bacteria 654
347 Ga0496101_0782120 3300048904 Unclassified 753
348 Ga0496102_0712916 3300048905 Unclassified 926
349 Ga0496102_1912938 3300048905 Bacteria 510
350 Ga0496103_0758674 3300048906 Unclassified 613
351 Ga0496105_0268627 3300048908 Bacteria 1378
352 Ga0496107_1075672 3300048910 Bacteria 582
353 Ga0496108_0151195 3300048911 Bacteria 2003
354 Ga0496108_0648575 3300048911 Unclassified 918
355 Ga0496110_0409758 3300048913 Bacteria 1236
356 Ga0496111_0217064 3300048914 Bacteria 1421
357 Ga0496111_0385813 3300048914 Unclassified 1036
358 Ga0496111_0996060 3300048914 Bacteria 601
359 Ga0496112_0422744 3300048915 Bacteria 1271
360 Ga0496113_0177977 3300048916 Bacteria 1686
361 Ga0496114_0432046 3300048917 Bacteria 1166
362 Ga0501034_0020919 3300049571 Bacteria 6680
363 Ga0501034_0082399 3300049571 Bacteria 3219
364 Ga0501043_0033720 3300049579 Bacteria 4029
365 Ga0501047_0167995 3300049581 Bacteria 2064
366 Ga0501069_0260945 3300049585 Bacteria 1012
367 Ga0501070_0121915 3300049586 Bacteria 2155
368 Ga0501071_0333493 3300049587 Bacteria 1153
369 Ga0501073_0120686 3300049589 Bacteria 1817
370 Ga0501083_0720599 3300049744 Bacteria 649
371 Ga0501035_0214479 3300049822 Bacteria 1646
372 Ga0501044_0002002 3300049823 Bacteria 23517
373 nmdc:mga0yw44_262429_c1 3300050492 Unclassified 1151
374 nmdc:mga05p37_113286_c1 3300050507 Bacteria 3335
375 nmdc:mga05p37_1167413_c1 3300050507 Bacteria 799
376 nmdc:mga05p37_16475_c1 3300050507 Bacteria 8904
377 nmdc:mga05p37_194423_c1 3300050507 Bacteria 2461
378 nmdc:mga05p37_24653_c1 3300050507 Bacteria 7312
379 nmdc:mga05p37_3502_c1 3300050507 Bacteria 18353
380 nmdc:mga05p37_365357_c1 3300050507 Bacteria 1695
381 nmdc:mga05p37_487578_c1 3300050507 Bacteria 1418
382 nmdc:mga05p37_508834_c1 3300050507 Bacteria 1380
383 nmdc:mga05p37_65728_c1 3300050507 Bacteria 4462
384 nmdc:mga05p37_76741_c1 3300050507 Bacteria 4113
385 nmdc:mga05p37_83155_c1 3300050507 Bacteria 3943
386 nmdc:mga05p37_993281_c1 3300050507 Unclassified 893
387 nmdc:mga08y16_158333_c1 3300050511 Bacteria 2353
388 nmdc:mga08y16_24817_c1 3300050511 Bacteria 6326
389 nmdc:mga08y16_337159_c1 3300050511 Bacteria 1550
390 nmdc:mga08y16_9374_c1 3300050511 Bacteria 10268
391 nmdc:mga08y16_975595_c1 3300050511 Bacteria 829
392 nmdc:mga0n895_120761_c1 3300050512 Bacteria 2641
393 nmdc:mga0n895_21_c1 3300050512 Bacteria 93738
394 nmdc:mga0n895_368639_c1 3300050512 Bacteria 1454
395 nmdc:mga0n895_398680_c1 3300050512 Bacteria 1392
396 nmdc:mga0n895_591833_c1 3300050512 Bacteria 1112
397 nmdc:mga0n895_639213_c1 3300050512 Bacteria 1064
398 nmdc:mga0n895_81754_c1 3300050512 Bacteria 3219
399 nmdc:mga0rr50_1099204_c1 3300050513 Bacteria 676
400 nmdc:mga0rr50_123_c1 3300050513 Bacteria 42941
401 nmdc:mga0rr50_133232_c1 3300050513 Bacteria 1992
402 nmdc:mga0rr50_175109_c1 3300050513 Bacteria 1751
403 nmdc:mga0rr50_556040_c1 3300050513 Bacteria 977
404 nmdc:mga0rr50_609044_c1 3300050513 Bacteria 931
405 nmdc:mga0rr50_744238_c1 3300050513 Bacteria 837
406 nmdc:mga0rr50_8_c1 3300050513 Bacteria 271775
407 nmdc:mga08x19_29254_c1 3300050514 Bacteria 3455
408 nmdc:mga08x19_333_c1 3300050514 Bacteria 34084
409 nmdc:mga08x19_7264_c1 3300050514 Bacteria 6578
410 nmdc:mga0a205_1419483_c1 3300050515 Unclassified 542
411 nmdc:mga0a205_160225_c1 3300050515 Bacteria 1329
412 nmdc:mga0a205_163849_c1 3300050515 Bacteria 2119
413 nmdc:mga0a205_323299_c1 3300050515 Unclassified 1413
414 nmdc:mga0a205_335694_c1 3300050515 Bacteria 1380
415 nmdc:mga0a205_3697_c1 3300050515 Bacteria 13689
416 nmdc:mga0a205_71209_c1 3300050515 Bacteria 3358
417 nmdc:mga0a205_91564_c1 3300050515 Bacteria 2939
418 Ga0495612_0448069 3300053078 Unclassified 590
419 Ga0495619_0034475 3300053085 Bacteria 3291
420 Ga0495619_0808485 3300053085 Bacteria 634
421 Ga0265319_1015122
422 Ga0065715_10684380
423 Ga0065707_10196232
424 Ga0070683_100175485
425 Ga0068869_100475577
426 Ga0068869_100772349
427 Ga0070666_10391770
428 Ga0070666_10489299
429 Ga0070682_100467149
430 Ga0068868_101160613
431 Ga0070691_10355191
432 Ga0070668_100380696
433 Ga0070669_100091012
434 Ga0070669_101023991
435 Ga0070675_100000134
436 Ga0070675_100491639
437 Ga0070671_100009515
438 Ga0070671_100700012
439 Ga0070674_100020633
440 Ga0070674_100136361
441 Ga0070674_100824597
442 Ga0070673_100034160
443 Ga0070673_100117570
444 Ga0070673_100449386
445 Ga0070673_101354991
446 Ga0070688_101277176
447 Ga0070667_100079430
448 Ga0070701_10235741
449 Ga0070705_100267076
450 Ga0070700_100892349
451 Ga0070694_100325034
452 Ga0070708_100582789
453 Ga0070708_100888547
454 Ga0070678_101004915
455 Ga0070678_101083583
456 Ga0070662_101924318
457 Ga0068867_100364144
458 Ga0068867_100665162
459 Ga0070685_10273011
460 Ga0070706_100708277
461 Ga0070707_100469116
462 Ga0070707_100583634
463 Ga0070707_102285803
464 Ga0070698_100657698
465 Ga0070699_100063912
466 Ga0070699_100110354
467 Ga0070699_100354432
468 Ga0070699_100496918
469 Ga0070697_100152043
470 Ga0070697_100175706
471 Ga0070697_100229552
472 Ga0070697_100261184
473 Ga0070697_100390949
474 Ga0070672_100013127
475 Ga0070672_100264191
476 Ga0070686_100050701
477 Ga0070695_100171519
478 Ga0070696_100698349
479 Ga0070696_101040878
480 Ga0070693_100505259
481 Ga0070704_100029720
482 Ga0070664_100480897
483 Ga0068854_100471781
484 Ga0068854_101205764
485 Ga0070702_100194887
486 Ga0068859_101565558
487 Ga0068859_101920927
488 Ga0068864_101019898
489 Ga0068866_10581855
490 Ga0068861_100033834
491 Ga0068861_100112258
492 Ga0068863_100086786
493 Ga0068863_100334480
494 Ga0068863_100342893
495 Ga0068860_100034524
496 Ga0068860_100655386
497 Ga0068862_100113824
498 Ga0068862_100395285
499 Ga0081455_10108724
500 Ga0070712_100642145
501 Ga0097621_100027247
502 Ga0097621_100163628
503 Ga0097621_101339570
504 Ga0068871_100049837
505 Ga0068871_100999473
506 Ga0068871_101118523
507 Ga0075428_100231839
508 Ga0075428_101116318
509 Ga0075433_10081188
510 Ga0075433_10119826
511 Ga0075433_10172300
512 Ga0075433_10370681
513 Ga0075433_10584237
514 Ga0075434_100000442
515 Ga0075434_100756561
516 Ga0075434_100899860
517 Ga0075434_100907724
518 Ga0075434_101446284
519 Ga0075429_101027016
520 Ga0068865_100037132
521 Ga0068865_100072828
522 Ga0068865_100879560
523 Ga0075436_100002424
524 Ga0075436_100080333
525 Ga0075436_100516533
526 Ga0097620_101565639
527 Ga0097620_101921002
528 Ga0075435_100000293
529 Ga0075435_100002142
530 Ga0075435_100007134
531 Ga0075435_100057908
532 Ga0075435_100092553
533 Ga0075435_100398233
534 Ga0075435_100834911
535 Ga0105240_10035120
536 Ga0105240_10146612
537 Ga0111539_10026198
538 Ga0111539_10480817
539 Ga0111539_10805602
540 Ga0105245_10016947
541 Ga0105245_10166172
542 Ga0105245_10365457
543 Ga0105245_10748698
544 Ga0105245_11240711
545 Ga0105247_11665291
546 Ga0114129_10002338
547 Ga0114129_10003015
548 Ga0114129_10015456
549 Ga0114129_10021659
550 Ga0114129_10023706
551 Ga0114129_10056128
552 Ga0114129_10093219
553 Ga0114129_10130821
554 Ga0114129_10290454
555 Ga0114129_10292025
556 Ga0114129_10303480
557 Ga0114129_10412094
558 Ga0114129_10503459
559 Ga0114129_10963768
560 Ga0105243_10018903
561 Ga0105241_10083475
562 Ga0105242_10030730
563 Ga0105242_10087968
564 Ga0105242_10376540
565 Ga0105242_11438379
566 Ga0105248_10024188
567 Ga0105248_10188734
568 Ga0105248_10381745
569 Ga0105248_11494976
570 Ga0105238_10069511
571 Ga0105238_10957691
572 Ga0105238_12001143
573 Ga0105249_10130365
574 Ga0105249_10419381
575 Ga0105249_10810451
576 Ga0105249_11428277
577 Ga0105239_11026005
578 Ga0105239_12915786
579 Ga0157374_10424466
580 Ga0157374_11312331
581 Ga0157378_10286272
582 Ga0157378_11634442
583 Ga0157378_11679764
584 Ga0163162_10028358
585 Ga0163162_10068695
586 Ga0157375_10057282
587 Ga0157375_10117857
588 Ga0157375_10760469
589 Ga0163163_11165170
590 Ga0163163_11947885
591 Ga0157380_10101122
592 Ga0157380_10350898
593 Ga0157380_10420439
594 Ga0157380_10743759
595 Ga0157380_11074393
596 Ga0157380_11087749
597 Ga0157377_10518277
598 Ga0157379_10014346
599 Ga0157379_10367632
600 Ga0157379_11818871
601 Ga0157376_10003337
602 Ga0157376_10173863
603 Ga0157376_10277844
604 Ga0163161_10314295
605 Ga0163161_10635819
606 Ga0207697_10028285
607 Ga0207642_10383690
608 Ga0207680_10241527
609 Ga0207685_10067639
610 Ga0207645_10190251
611 Ga0207645_10558963
612 Ga0207684_10185355
613 Ga0207707_10051774
614 Ga0207695_10043788
615 Ga0207693_10476694
616 Ga0207662_10397563
617 Ga0207652_11739448
618 Ga0207646_10129675
619 Ga0207646_10581061
620 Ga0207681_10031728
621 Ga0207681_10177427
622 Ga0207694_10184368
623 Ga0207694_10556548
624 Ga0207659_10002378
625 Ga0207659_10264035
626 Ga0207659_11152999
627 Ga0207687_10010364
628 Ga0207687_10325492
629 Ga0207687_10499078
630 Ga0207644_10023932
631 Ga0207644_10537515
632 Ga0207686_10002322
633 Ga0207686_10351364
634 Ga0207709_10082274
635 Ga0207709_10914859
636 Ga0207709_11315964
637 Ga0207670_10320978
638 Ga0207670_10518508
639 Ga0207669_10539513
640 Ga0207669_10802603
641 Ga0207704_10041693
642 Ga0207704_10467447
643 Ga0207704_10820290
644 Ga0207691_10036213
645 Ga0207691_10306318
646 Ga0207711_10056083
647 Ga0207711_10091939
648 Ga0207711_10113116
649 Ga0207711_10231413
650 Ga0207711_11278622
651 Ga0207689_10498825
652 Ga0207661_10180213
653 Ga0207679_10120594
654 Ga0207651_10039551
655 Ga0207651_10060500
656 Ga0207651_10455660
657 Ga0207651_10486521
658 Ga0207651_10673015
659 Ga0207651_11099740
660 Ga0207712_10633077
661 Ga0207668_10121472
662 Ga0207668_10591422
663 Ga0207640_10825744
664 Ga0207640_11449194
665 Ga0207658_10061154
666 Ga0207658_10765109
667 Ga0207658_11061250
668 Ga0207677_10045228
669 Ga0207677_11093777
670 Ga0207703_10725911
671 Ga0207678_10704915
672 Ga0207708_10047836
673 Ga0207641_10015850
674 Ga0207641_10178954
675 Ga0207641_10183963
676 Ga0207641_10291361
677 Ga0207641_11636165
678 Ga0207648_10159890
679 Ga0207648_11894402
680 Ga0207676_10952051
681 Ga0207675_100068906
682 Ga0207675_100790980
683 Ga0207675_101042335
684 Ga0207675_102270622
685 Ga0207683_10165936
686 Ga0207683_10175763
687 Ga0207683_10482369
688 Ga0207683_11310303
689 Ga0209998_10003242
690 Ga0209998_10044178
691 Ga0207428_10375243
692 Ga0207428_10970524
693 Ga0268266_10756857
694 Ga0268265_10636462
695 Ga0268265_10828417
696 Ga0268264_10087555
697 Ga0268264_10751454
698 Ga0265319_1036235
699 Ga0265318_10016135
700 Ga0265318_10058863
701 Ga0265329_10210761
702 Ga0265339_10266343
703 Ga0265316_10599181
704 Ga0307412_10734396
705 Ga0307411_10485026
706 Ga0373930_0007988
707 Ga0373948_0007640
708 Ga0373950_0001312
709 Ga0373958_0018650
710 Ga0373959_0010613
711 Ga0373959_0182922
712 Ga0373938_0041263
713 Ga0373928_0000213
714 Ga0373928_0287745
715 Ga0373929_0000613
716 Ga0373940_0032083
717 Ga0373949_0007666
718 Ga0373951_0002652
719 Ga0373952_0205934
720 Ga0373932_0005469
721 Ga0373939_0000214
722 Ga0373941_0000595
723 Ga0373960_0004715
724 Ga0373960_0374194
725 Ga0373943_0116353
726 Ga0373943_0771723
727 Ga0373942_0000656
728 Ga0373942_0342729
729 Ga0373961_0002177
730 Ga0373961_0269152
731 Ga0373962_0011990
732 Ga0373962_0063442
733 Ga0373931_0026436
734 Ga0373931_0082604
735 Ga0373931_0399932
736 Ga0373931_0832830
737 Ga0373935_0376537
738 Ga0373925_1518068
739 Ga0451847_0706269
740 Ga0439431_0175914
741 Ga0439434_0182459
742 Ga0439435_0228369
743 Ga0439460_0183235
744 Ga0450893_0062498
745 Ga0466963_0670079
746 Ga0453684_0168134
747 Ga0451576_0069049
748 Ga0451576_0679345
749 Ga0451576_0957677
750 Ga0466967_0240252
751 Ga0495641_0201484
752 Ga0495651_0364409
753 Ga0495580_0996603
754 Ga0495582_0424692
755 Ga0495639_0342931
756 Ga0495628_0251321
757 Ga0495644_0400069
758 Ga0495665_0209016
759 Ga0495640_0094603
760 Ga0495609_0404492
761 Ga0495633_0049958
762 Ga0495659_0079158
763 Ga0495670_0814602
764 Ga0495674_0246006
765 Ga0495676_0298947
766 Ga0495680_0726310
767 Ga0496101_0782120
768 Ga0496102_0712916
769 Ga0496102_1912938
770 Ga0496103_0758674
771 Ga0496105_0268627
772 Ga0496107_1075672
773 Ga0496108_0151195
774 Ga0496108_0648575
775 Ga0496110_0409758
776 Ga0496111_0217064
777 Ga0496111_0385813
778 Ga0496111_0996060
779 Ga0496112_0422744
780 Ga0496113_0177977
781 Ga0496114_0432046
782 Ga0501034_0020919
783 Ga0501034_0082399
784 Ga0501043_0033720
785 Ga0501047_0167995
786 Ga0501069_0260945
787 Ga0501070_0121915
788 Ga0501071_0333493
789 Ga0501073_0120686
790 Ga0501083_0720599
791 Ga0501035_0214479
792 Ga0501044_0002002
793 nmdc:mga0yw44_262429_c1
794 nmdc:mga05p37_113286_c1
795 nmdc:mga05p37_1167413_c1
796 nmdc:mga05p37_16475_c1
797 nmdc:mga05p37_194423_c1
798 nmdc:mga05p37_24653_c1
799 nmdc:mga05p37_3502_c1
800 nmdc:mga05p37_365357_c1
801 nmdc:mga05p37_487578_c1
802 nmdc:mga05p37_508834_c1
803 nmdc:mga05p37_65728_c1
804 nmdc:mga05p37_76741_c1
805 nmdc:mga05p37_83155_c1
806 nmdc:mga05p37_993281_c1
807 nmdc:mga08y16_158333_c1
808 nmdc:mga08y16_24817_c1
809 nmdc:mga08y16_337159_c1
810 nmdc:mga08y16_9374_c1
811 nmdc:mga08y16_975595_c1
812 nmdc:mga0n895_120761_c1
813 nmdc:mga0n895_21_c1
814 nmdc:mga0n895_368639_c1
815 nmdc:mga0n895_398680_c1
816 nmdc:mga0n895_591833_c1
817 nmdc:mga0n895_639213_c1
818 nmdc:mga0n895_81754_c1
819 nmdc:mga0rr50_1099204_c1
820 nmdc:mga0rr50_123_c1
821 nmdc:mga0rr50_133232_c1
822 nmdc:mga0rr50_175109_c1
823 nmdc:mga0rr50_556040_c1
824 nmdc:mga0rr50_609044_c1
825 nmdc:mga0rr50_744238_c1
826 nmdc:mga0rr50_8_c1
827 nmdc:mga08x19_29254_c1
828 nmdc:mga08x19_333_c1
829 nmdc:mga08x19_7264_c1
830 nmdc:mga0a205_1419483_c1
831 nmdc:mga0a205_160225_c1
832 nmdc:mga0a205_163849_c1
833 nmdc:mga0a205_323299_c1
834 nmdc:mga0a205_335694_c1
835 nmdc:mga0a205_3697_c1
836 nmdc:mga0a205_71209_c1
837 nmdc:mga0a205_91564_c1
838 Ga0495612_0448069
839 Ga0495619_0034475
840 Ga0495619_0808485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06262

Zincin_1

Zincin-like metallopeptidase

47

144

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.8075 1 119
3e11-assembly2.cif.gz_B crystal structure of a predicted zincin-like metalloprotease (acel_2062) from acidothermus cellulolyticus 11b at 1.80 a resolution 0.7617 1 119
4r29-assembly1.cif.gz_A crystal structure of bacterial cysteine methyltransferase effector nlee 0.6989 93 126
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6824 4 110
2ejq-assembly1.cif.gz_A conserved hypothetical protein (ttha0227) from thermo thermophilus hb8 0.6348 4 110
ID Description Score Start End Superfamily
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.808 1 119 3.30.2010.20
3e11B00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.768 1 119 3.30.2010.20
af_O53352_14_135_3.30.2010.20 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6976 1 116 3.30.2010.20
2ejqA00 Alpha Beta;2-Layer Sandwich;Zincin-like; 0.6824 4 110 3.30.2010.20
af_Q9VM87_551_610_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.6787 95 125 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A0M8K9W0-F1-model_v4 Metallopeptidase family protein 0.9703 1 126
AF-A0A7R8AVA6-F1-model_v4 deleted 0.9675 1 126
AF-A0A3D2Z3D2-F1-model_v4 Metallopeptidase family protein 0.9577 1 119
AF-A0A7W0LFM5-F1-model_v4 Metallopeptidase family protein 0.9569 1 80
AF-A0A2V8GUZ2-F1-model_v4 Metallopeptidase family protein 0.9562 27 127

Map