F439762

General Info

Members Datasets Scaffolds Average Seq Length
420 255 840 137

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_11551106|Ga0268266_115511061
Length 135
Sequence MTSFVLRPVGRVESPLTDPSDAPRQPDEGAPEAWLVFDAFAPALEGLAPGTDMLLFTWLDRGDRETLAVHPRGDLSRPLTGVFATRAPDRPNPIGLHTVHVLAVEGNRVRVRHLEAVDGTPILDVKPLLGPTPER

Samples

Sample ID Description Type Environment
1 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
156 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
159 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
171 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
254 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
255 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.24
Isolates 0.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 8.1
Rhizosphere 88.81
Stem 0
Stem Tuber 0
Unclassified 15.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0268266_11551106 3300028379 Bacteria 638
2 rootH1_10001257 3300003316 Bacteria 2063
3 rootL2_10035585 3300003322 Bacteria 4460
4 rootH1_10380731 3300003323 Bacteria 1938
5 Ga0058862_11966842 3300004803 Bacteria 1194
6 Ga0070683_100109993 3300005329 Bacteria 2599
7 Ga0070683_100225307 3300005329 Bacteria 1782
8 Ga0070670_100095555 3300005331 Unclassified 2556
9 Ga0070677_10172794 3300005333 Bacteria 1023
10 Ga0068869_100398650 3300005334 Bacteria 1131
11 Ga0070666_10351567 3300005335 Bacteria 1055
12 Ga0070680_100009914 3300005336 Bacteria 7335
13 Ga0070682_100129709 3300005337 Bacteria 1705
14 Ga0068868_100187949 3300005338 Bacteria 1717
15 Ga0068868_100692395 3300005338 Bacteria 911
16 Ga0068868_101034290 3300005338 Bacteria 753
17 Ga0070660_100990432 3300005339 Bacteria 710
18 Ga0070689_100015623 3300005340 Bacteria 5540
19 Ga0070691_10015127 3300005341 Bacteria 3545
20 Ga0070687_100022735 3300005343 Unclassified 2968
21 Ga0070661_100152800 3300005344 Bacteria 1746
22 Ga0070661_100450017 3300005344 Unclassified 1024
23 Ga0070668_100643144 3300005347 Bacteria 931
24 Ga0070671_100037794 3300005355 Bacteria 4005
25 Ga0070671_100301415 3300005355 Unclassified 1364
26 Ga0070671_100388555 3300005355 Bacteria 1193
27 Ga0070671_101790446 3300005355 Bacteria 546
28 Ga0070674_100033394 3300005356 Bacteria 3425
29 Ga0070659_100009099 3300005366 Bacteria 7285
30 Ga0070667_100078769 3300005367 Bacteria 2816
31 Ga0070709_10761800 3300005434 Bacteria 757
32 Ga0070714_100219837 3300005435 Bacteria 1745
33 Ga0070714_100711633 3300005435 Bacteria 969
34 Ga0070713_100424828 3300005436 Bacteria 1245
35 Ga0070713_100724674 3300005436 Bacteria 950
36 Ga0070713_100741349 3300005436 Bacteria 939
37 Ga0070713_100754018 3300005436 Bacteria 931
38 Ga0070710_10045055 3300005437 Bacteria 2450
39 Ga0070710_10547403 3300005437 Bacteria 799
40 Ga0070711_100005421 3300005439 Bacteria 7624
41 Ga0070711_100044736 3300005439 Bacteria 3006
42 Ga0070711_100205494 3300005439 Bacteria 1522
43 Ga0070711_100411852 3300005439 Bacteria 1099
44 Ga0070700_100034292 3300005441 Bacteria 3065
45 Ga0070708_101676624 3300005445 Unclassified 591
46 Ga0070663_100237188 3300005455 Bacteria 1438
47 Ga0070678_100183667 3300005456 Unclassified 1714
48 Ga0070678_101062017 3300005456 Bacteria 746
49 Ga0070662_100041686 3300005457 Bacteria 3276
50 Ga0070681_10005299 3300005458 Bacteria 12453
51 Ga0070681_10016679 3300005458 Bacteria 7333
52 Ga0070681_10024157 3300005458 Bacteria 6119
53 Ga0070681_10028575 3300005458 Bacteria 5607
54 Ga0068867_100659272 3300005459 Bacteria 919
55 Ga0070707_100298037 3300005468 Bacteria 1567
56 Ga0070679_100003106 3300005530 Bacteria 15181
57 Ga0070679_100010037 3300005530 Bacteria 8968
58 Ga0070679_100031042 3300005530 Bacteria 5279
59 Ga0070679_100179267 3300005530 Bacteria 2091
60 Ga0070679_100732545 3300005530 Unclassified 931
61 Ga0070684_100045671 3300005535 Bacteria 3793
62 Ga0070684_100121500 3300005535 Bacteria 2350
63 Ga0070684_100360659 3300005535 Bacteria 1338
64 Ga0068853_100663404 3300005539 Bacteria 993
65 Ga0068853_100908282 3300005539 Unclassified 846
66 Ga0070686_101540584 3300005544 Bacteria 561
67 Ga0070665_100354437 3300005548 Bacteria 1473
68 Ga0068855_100882592 3300005563 Unclassified 946
69 Ga0070664_100686168 3300005564 Unclassified 953
70 Ga0068857_100010501 3300005577 Bacteria 8048
71 Ga0068857_100503324 3300005577 Bacteria 1137
72 Ga0068854_100010504 3300005578 Bacteria 6007
73 Ga0068854_100124568 3300005578 Bacteria 1961
74 Ga0068856_100058409 3300005614 Bacteria 3809
75 Ga0068856_100185941 3300005614 Bacteria 2091
76 Ga0068856_100396961 3300005614 Bacteria 1399
77 Ga0068859_100169217 3300005617 Bacteria 2266
78 Ga0068859_100272974 3300005617 Unclassified 1783
79 Ga0068864_100078974 3300005618 Bacteria 2880
80 Ga0068864_100153671 3300005618 Bacteria 2087
81 Ga0068863_100039103 3300005841 Bacteria 4515
82 Ga0068863_100117560 3300005841 Bacteria 2534
83 Ga0068858_100016978 3300005842 Bacteria 6834
84 Ga0068858_100129338 3300005842 Bacteria 2367
85 Ga0068860_100022068 3300005843 Bacteria 6162
86 Ga0068860_100478895 3300005843 Bacteria 1240
87 Ga0068862_100146485 3300005844 Unclassified 2099
88 Ga0068862_100167043 3300005844 Bacteria 1967
89 Ga0070715_10775251 3300006163 Bacteria 580
90 Ga0070716_100030576 3300006173 Bacteria 2923
91 Ga0070712_100170180 3300006175 Bacteria 1690
92 Ga0070712_100442798 3300006175 Bacteria 1080
93 Ga0075367_10843740 3300006178 Bacteria 584
94 Ga0075366_10014267 3300006195 Bacteria 4538
95 Ga0075366_10225293 3300006195 Bacteria 1142
96 Ga0097621_101045333 3300006237 Unclassified 765
97 Ga0097621_101949228 3300006237 Bacteria 561
98 Ga0068871_100035193 3300006358 Bacteria 3977
99 Ga0075428_100004140 3300006844 Bacteria 15965
100 Ga0075428_100016361 3300006844 Bacteria 8195
101 Ga0075428_100028092 3300006844 Bacteria 6222
102 Ga0075428_101543359 3300006844 Bacteria 695
103 Ga0075430_100019614 3300006846 Bacteria 5752
104 Ga0075430_100130826 3300006846 Bacteria 2092
105 Ga0075430_100148993 3300006846 Bacteria 1949
106 Ga0075430_100294198 3300006846 Bacteria 1343
107 Ga0075430_100334950 3300006846 Bacteria 1250
108 Ga0075430_101371887 3300006846 Unclassified 581
109 Ga0075431_100023675 3300006847 Bacteria 6286
110 Ga0075431_100231433 3300006847 Bacteria 1883
111 Ga0075431_100280514 3300006847 Bacteria 1687
112 Ga0075433_10432183 3300006852 Bacteria 1161
113 Ga0075433_10909464 3300006852 Bacteria 767
114 Ga0075434_100006343 3300006871 Bacteria 10843
115 Ga0075434_100008947 3300006871 Bacteria 9325
116 Ga0075434_100201377 3300006871 Bacteria 2011
117 Ga0075434_100495852 3300006871 Bacteria 1242
118 Ga0075429_100065274 3300006880 Bacteria 3169
119 Ga0075429_100471418 3300006880 Bacteria 1100
120 Ga0075436_100041121 3300006914 Bacteria 3190
121 Ga0097620_100169218 3300006931 Bacteria 2266
122 Ga0097620_100272977 3300006931 Unclassified 1783
123 Ga0075435_100007211 3300007076 Bacteria 7907
124 Ga0075435_100474329 3300007076 Unclassified 1080
125 Ga0111539_10115886 3300009094 Bacteria 3141
126 Ga0111539_10253257 3300009094 Bacteria 2050
127 Ga0105245_10249870 3300009098 Bacteria 1722
128 Ga0105245_11156563 3300009098 Bacteria 821
129 Ga0105245_11424234 3300009098 Unclassified 743
130 Ga0105247_10120349 3300009101 Bacteria 1700
131 Ga0114129_10024381 3300009147 Bacteria 8572
132 Ga0114129_10054079 3300009147 Bacteria 5630
133 Ga0114129_10774911 3300009147 Bacteria 1226
134 Ga0105248_10024686 3300009177 Bacteria 6684
135 Ga0105248_10478922 3300009177 Bacteria 1403
136 Ga0105237_10732971 3300009545 Unclassified 995
137 Ga0105238_10502464 3300009551 Bacteria 1213
138 Ga0105249_12457515 3300009553 Bacteria 593
139 Ga0105246_10278291 3300011119 Bacteria 1341
140 Ga0157373_10259841 3300013100 Unclassified 1229
141 Ga0157369_10022113 3300013105 Bacteria 7104
142 Ga0157369_10076080 3300013105 Bacteria 3598
143 Ga0157369_10776140 3300013105 Bacteria 985
144 Ga0157374_10144195 3300013296 Bacteria 2313
145 Ga0157378_10530712 3300013297 Bacteria 1180
146 Ga0157378_10932424 3300013297 Bacteria 900
147 Ga0157372_10727152 3300013307 Bacteria 1154
148 Ga0157372_11701787 3300013307 Unclassified 726
149 Ga0157372_12015031 3300013307 Bacteria 663
150 Ga0157375_10122051 3300013308 Bacteria 2716
151 Ga0157375_11260783 3300013308 Bacteria 868
152 Ga0157375_11938197 3300013308 Bacteria 700
153 Ga0163163_10014609 3300014325 Bacteria 7223
154 Ga0163163_10044741 3300014325 Bacteria 4344
155 Ga0163163_10893804 3300014325 Unclassified 952
156 Ga0163163_11436036 3300014325 Bacteria 751
157 Ga0157380_10201351 3300014326 Unclassified 1767
158 Ga0157380_10260827 3300014326 Bacteria 1574
159 Ga0157377_10768294 3300014745 Unclassified 707
160 Ga0157379_10377709 3300014968 Bacteria 1300
161 Ga0157376_10019738 3300014969 Bacteria 5201
162 Ga0182005_1027799 3300015265 Bacteria 1542
163 Ga0207692_10299337 3300025898 Bacteria 978
164 Ga0207692_10571778 3300025898 Bacteria 724
165 Ga0207692_10690115 3300025898 Unclassified 662
166 Ga0207710_10061999 3300025900 Bacteria 1698
167 Ga0207680_10171419 3300025903 Bacteria 1462
168 Ga0207685_10061212 3300025905 Bacteria 1492
169 Ga0207699_10093293 3300025906 Bacteria 1894
170 Ga0207684_10983868 3300025910 Bacteria 706
171 Ga0207707_10019304 3300025912 Bacteria 5949
172 Ga0207707_10025936 3300025912 Bacteria 5126
173 Ga0207707_10030972 3300025912 Bacteria 4679
174 Ga0207707_10059964 3300025912 Bacteria 3310
175 Ga0207693_10850994 3300025915 Unclassified 701
176 Ga0207693_11267274 3300025915 Bacteria 553
177 Ga0207693_11272936 3300025915 Unclassified 551
178 Ga0207663_10003317 3300025916 Bacteria 7855
179 Ga0207663_10345681 3300025916 Bacteria 1125
180 Ga0207663_11551416 3300025916 Bacteria 533
181 Ga0207660_10028143 3300025917 Bacteria 3843
182 Ga0207660_10090602 3300025917 Bacteria 2266
183 Ga0207657_10037512 3300025919 Bacteria 4326
184 Ga0207657_10773782 3300025919 Bacteria 743
185 Ga0207649_10007168 3300025920 Bacteria 6060
186 Ga0207649_10502651 3300025920 Unclassified 922
187 Ga0207652_10005180 3300025921 Bacteria 10585
188 Ga0207652_10046125 3300025921 Bacteria 3717
189 Ga0207652_10108760 3300025921 Bacteria 2457
190 Ga0207652_10423250 3300025921 Bacteria 1201
191 Ga0207652_10426377 3300025921 Bacteria 1196
192 Ga0207652_10574950 3300025921 Unclassified 1012
193 Ga0207646_10592611 3300025922 Bacteria 995
194 Ga0207694_10347292 3300025924 Bacteria 1228
195 Ga0207650_10058229 3300025925 Unclassified 2876
196 Ga0207659_10010153 3300025926 Bacteria 5905
197 Ga0207687_10913408 3300025927 Bacteria 751
198 Ga0207700_10114721 3300025928 Bacteria 2174
199 Ga0207700_10123414 3300025928 Bacteria 2103
200 Ga0207700_10216741 3300025928 Bacteria 1621
201 Ga0207700_10966899 3300025928 Bacteria 762
202 Ga0207664_10630510 3300025929 Bacteria 963
203 Ga0207644_10054218 3300025931 Bacteria 2887
204 Ga0207644_11090686 3300025931 Bacteria 671
205 Ga0207690_10002601 3300025932 Bacteria 10886
206 Ga0207690_10549922 3300025932 Unclassified 938
207 Ga0207690_10906059 3300025932 Bacteria 731
208 Ga0207669_10084461 3300025937 Bacteria 2046
209 Ga0207704_11273173 3300025938 Unclassified 628
210 Ga0207691_10002077 3300025940 Bacteria 19544
211 Ga0207711_10049338 3300025941 Bacteria 3604
212 Ga0207689_10708216 3300025942 Bacteria 849
213 Ga0207661_10374710 3300025944 Bacteria 1287
214 Ga0207679_10007865 3300025945 Bacteria 6774
215 Ga0207679_11581522 3300025945 Unclassified 601
216 Ga0207667_10214927 3300025949 Bacteria 1970
217 Ga0207667_10698930 3300025949 Bacteria 1017
218 Ga0207668_10091888 3300025972 Bacteria 2232
219 Ga0207668_11452375 3300025972 Unclassified 619
220 Ga0207640_10011092 3300025981 Bacteria 5092
221 Ga0207640_11875798 3300025981 Unclassified 542
222 Ga0207703_10102263 3300026035 Bacteria 2431
223 Ga0207639_10337152 3300026041 Bacteria 1343
224 Ga0207639_10441563 3300026041 Bacteria 1180
225 Ga0207639_10707525 3300026041 Unclassified 935
226 Ga0207678_10038206 3300026067 Bacteria 4172
227 Ga0207702_10104067 3300026078 Bacteria 2511
228 Ga0207702_10247488 3300026078 Bacteria 1673
229 Ga0207702_10470872 3300026078 Unclassified 1221
230 Ga0207641_10090128 3300026088 Bacteria 2681
231 Ga0207641_10579688 3300026088 Bacteria 1096
232 Ga0207648_10967684 3300026089 Bacteria 796
233 Ga0207676_10063085 3300026095 Bacteria 2942
234 Ga0207676_10720595 3300026095 Bacteria 968
235 Ga0207674_10001105 3300026116 Bacteria 35054
236 Ga0207674_10769581 3300026116 Bacteria 929
237 Ga0207675_100003327 3300026118 Bacteria 15736
238 Ga0207683_10247677 3300026121 Unclassified 1626
239 Ga0207683_10924187 3300026121 Bacteria 810
240 Ga0207698_12071973 3300026142 Unclassified 583
241 Ga0207698_12143014 3300026142 Unclassified 572
242 Ga0268265_10136316 3300028380 Unclassified 2048
243 Ga0268265_11519544 3300028380 Bacteria 673
244 Ga0268264_10031707 3300028381 Bacteria 4334
245 Ga0307509_10094852 3300031507 Bacteria 3041
246 Ga0307411_10322577 3300032005 Unclassified 1248
247 Ga0307507_10029253 3300033179 Bacteria 5847
248 Ga0373948_0206844 3300034817 Bacteria 514
249 Ga0373958_0048946 3300034819 Bacteria 888
250 Ga0373936_0051659 3300035113 Bacteria 1664
251 Ga0373941_0021701 3300035115 Unclassified 1816
252 Ga0373953_0070889 3300035117 Bacteria 1437
253 Ga0373954_0634761 3300035118 Bacteria 529
254 Ga0373957_0054954 3300035120 Bacteria 1530
255 Ga0373960_0240631 3300035121 Unclassified 654
256 Ga0373955_0471995 3300035172 Unclassified 765
257 Ga0373931_0205742 3300035691 Bacteria 1178
258 Ga0373927_0524517 3300035695 Unclassified 783
259 Ga0373927_0591656 3300035695 Bacteria 733
260 Ga0373933_0221341 3300035724 Bacteria 1214
261 Ga0373937_0570766 3300036401 Bacteria 1074
262 Ga0373925_0404970 3300037068 Bacteria 1113
263 Ga0451791_0435390 3300041451 Bacteria 606
264 Ga0466965_0092710 3300044683 Bacteria 1538
265 Ga0466965_0283237 3300044683 Bacteria 896
266 Ga0466966_0256098 3300044684 Bacteria 1054
267 Ga0466961_0044304 3300044693 Bacteria 2847
268 Ga0466963_0023612 3300044694 Bacteria 3908
269 Ga0466963_0156833 3300044694 Bacteria 1583
270 Ga0466963_0215084 3300044694 Bacteria 1345
271 Ga0466963_0524423 3300044694 Bacteria 836
272 Ga0466971_0027468 3300044719 Bacteria 2550
273 Ga0466970_0107112 3300044765 Bacteria 1525
274 Ga0466957_0378990 3300044842 Bacteria 964
275 Ga0466960_0682969 3300044901 Bacteria 615
276 Ga0466959_0131638 3300045049 Bacteria 1772
277 Ga0451576_0126907 3300045051 Bacteria 2658
278 Ga0466958_0001930 3300045836 Bacteria 10160
279 Ga0466958_0083621 3300045836 Bacteria 1967
280 Ga0466967_0054255 3300045976 Bacteria 3526
281 Ga0466967_0084136 3300045976 Bacteria 2878
282 Ga0466967_0456072 3300045976 Bacteria 1250
283 Ga0495592_0011582 3300046454 Bacteria 6678
284 Ga0495603_0522452 3300046455 Bacteria 680
285 Ga0495629_0058023 3300046459 Bacteria 2706
286 Ga0495629_0094848 3300046459 Bacteria 2082
287 Ga0495638_0012956 3300046460 Bacteria 5693
288 Ga0495641_0534605 3300046461 Bacteria 535
289 Ga0495651_0002869 3300046462 Bacteria 13353
290 Ga0495653_0050613 3300046463 Bacteria 3194
291 Ga0495662_0032122 3300046476 Bacteria 2536
292 Ga0495662_0451848 3300046476 Bacteria 630
293 Ga0495664_0110842 3300046477 Bacteria 1656
294 Ga0495608_0077381 3300046511 Bacteria 2165
295 Ga0495618_0013624 3300046514 Bacteria 4948
296 Ga0495620_0000060 3300046515 Bacteria 95642
297 Ga0495628_0043289 3300046516 Bacteria 3587
298 Ga0495652_0054089 3300046529 Bacteria 3419
299 Ga0495665_0141233 3300046531 Bacteria 1259
300 Ga0495665_0664002 3300046531 Unclassified 518
301 Ga0495640_0092406 3300046533 Bacteria 1995
302 Ga0495586_0202568 3300046535 Bacteria 1125
303 Ga0495587_0029292 3300046536 Bacteria 3342
304 Ga0495645_0024293 3300046543 Bacteria 4396
305 Ga0495645_0659425 3300046543 Bacteria 638
306 Ga0495667_0012241 3300046559 Bacteria 5813
307 Ga0495634_0108540 3300046642 Bacteria 1786
308 Ga0495635_0026312 3300046663 Bacteria 4049
309 Ga0495657_0044122 3300046675 Bacteria 3035
310 Ga0495599_0023916 3300046678 Bacteria 3820
311 Ga0495646_0224092 3300046680 Bacteria 1015
312 Ga0495624_0068541 3300046690 Bacteria 2211
313 Ga0495604_0005531 3300047317 Bacteria 10017
314 Ga0495604_0618009 3300047317 Bacteria 693
315 Ga0495674_0022122 3300047319 Bacteria 5867
316 Ga0495676_0887637 3300047321 Bacteria 571
317 Ga0495676_1041661 3300047321 Bacteria 521
318 Ga0495680_0032368 3300047322 Bacteria 4246
319 Ga0495675_0064276 3300047444 Bacteria 2321
320 Ga0495684_0015078 3300047471 Bacteria 5952
321 Ga0495602_0018767 3300048088 Bacteria 6893
322 Ga0496100_0357858 3300048903 Bacteria 1104
323 Ga0496100_0482663 3300048903 Unclassified 953
324 Ga0496101_0170100 3300048904 Bacteria 1675
325 Ga0496101_0440657 3300048904 Unclassified 1028
326 Ga0496102_0052747 3300048905 Bacteria 3707
327 Ga0496102_0149195 3300048905 Bacteria 2196
328 Ga0496104_0234974 3300048907 Bacteria 1745
329 Ga0496105_0024910 3300048908 Bacteria 4864
330 Ga0496106_0086583 3300048909 Bacteria 2413
331 Ga0496106_0188787 3300048909 Unclassified 1638
332 Ga0496107_0236958 3300048910 Unclassified 1358
333 Ga0496107_0856605 3300048910 Bacteria 664
334 Ga0496108_0000002 3300048911 Bacteria 700890
335 Ga0496108_0049132 3300048911 Bacteria 3528
336 Ga0496108_0099804 3300048911 Bacteria 2475
337 Ga0496108_0111610 3300048911 Bacteria 2339
338 Ga0496109_0000001 3300048912 Bacteria 700852
339 Ga0496109_0010556 3300048912 Bacteria 7897
340 Ga0496109_0083729 3300048912 Unclassified 2941
341 Ga0496109_0089342 3300048912 Bacteria 2848
342 Ga0496109_0491792 3300048912 Bacteria 1158
343 Ga0496110_0044836 3300048913 Unclassified 3862
344 Ga0496111_0082515 3300048914 Bacteria 2348
345 Ga0496111_0241372 3300048914 Bacteria 1342
346 Ga0496111_0388790 3300048914 Unclassified 1031
347 Ga0496112_0061758 3300048915 Bacteria 3695
348 Ga0496112_0182624 3300048915 Unclassified 2061
349 Ga0496112_0514878 3300048915 Unclassified 1131
350 Ga0496113_0269106 3300048916 Bacteria 1362
351 Ga0496113_0274105 3300048916 Bacteria 1349
352 Ga0496113_0643013 3300048916 Unclassified 848
353 Ga0496114_0202044 3300048917 Bacteria 1741
354 Ga0496114_1096959 3300048917 Unclassified 681
355 Ga0496116_0364421 3300048919 Unclassified 655
356 Ga0496118_0207827 3300048921 Bacteria 1152
357 Ga0496125_0043688 3300048928 Unclassified 3799
358 Ga0501033_0832461 3300049570 Bacteria 623
359 Ga0501034_1192782 3300049571 Bacteria 640
360 Ga0501038_0305188 3300049574 Bacteria 1248
361 Ga0501039_0178295 3300049575 Bacteria 1671
362 Ga0501040_0074762 3300049576 Bacteria 2342
363 Ga0501042_0219303 3300049578 Bacteria 1372
364 Ga0501046_0100289 3300049580 Bacteria 2222
365 Ga0501046_0689949 3300049580 Bacteria 720
366 Ga0501047_0178860 3300049581 Bacteria 1988
367 Ga0501048_0185824 3300049582 Bacteria 1473
368 Ga0501048_1372243 3300049582 Bacteria 508
369 Ga0501068_0136583 3300049584 Unclassified 1535
370 Ga0501068_0142842 3300049584 Bacteria 1501
371 Ga0501069_0201288 3300049585 Bacteria 1154
372 Ga0501070_1269507 3300049586 Bacteria 563
373 Ga0501071_0271223 3300049587 Bacteria 1283
374 Ga0501072_0008667 3300049588 Bacteria 7720
375 Ga0501075_0017204 3300049591 Bacteria 5220
376 Ga0501075_0052538 3300049591 Bacteria 3064
377 Ga0501076_0047475 3300049592 Bacteria 3395
378 Ga0501076_0365720 3300049592 Bacteria 1185
379 Ga0501077_0112975 3300049593 Bacteria 1722
380 Ga0501079_0020288 3300049741 Bacteria 5079
381 Ga0501079_0507857 3300049741 Bacteria 948
382 Ga0501080_0779022 3300049742 Bacteria 840
383 Ga0501081_0211033 3300049743 Bacteria 1410
384 Ga0501044_0077655 3300049823 Bacteria 3367
385 Ga0501045_0385019 3300049824 Unclassified 1044
386 nmdc:mga0yw44_1061464_c1 3300050492 Unclassified 548
387 nmdc:mga05p37_117692_c1 3300050507 Bacteria 3265
388 nmdc:mga05p37_327721_c1 3300050507 Bacteria 1810
389 nmdc:mga09592_138495_c1 3300050508 Bacteria 2097
390 nmdc:mga09592_277648_c1 3300050508 Unclassified 1453
391 nmdc:mga0qj67_107742_c1 3300050509 Bacteria 2248
392 nmdc:mga0qj67_13702_c1 3300050509 Bacteria 6120
393 nmdc:mga0qj67_43147_c1 3300050509 Bacteria 3552
394 nmdc:mga0qj67_496852_c1 3300050509 Bacteria 981
395 nmdc:mga0qj67_586071_c1 3300050509 Bacteria 893
396 nmdc:mga0qj67_74579_c1 3300050509 Bacteria 2711
397 nmdc:mga06r32_350475_c1 3300050510 Bacteria 1461
398 nmdc:mga06r32_512718_c1 3300050510 Bacteria 1175
399 nmdc:mga08y16_309181_c1 3300050511 Bacteria 1628
400 nmdc:mga08y16_646293_c1 3300050511 Bacteria 1062
401 nmdc:mga0n895_19427_c1 3300050512 Bacteria 6316
402 nmdc:mga0n895_2252530_c1 3300050512 Unclassified 500
403 nmdc:mga0rr50_16263_c1 3300050513 Bacteria 4935
404 nmdc:mga0rr50_459006_c1 3300050513 Bacteria 1080
405 nmdc:mga0rr50_985683_c1 3300050513 Unclassified 718
406 nmdc:mga08x19_110105_c1 3300050514 Bacteria 1836
407 nmdc:mga0a205_430993_c1 3300050515 Bacteria 1180
408 nmdc:mga0a205_48978_c1 3300050515 Bacteria 4078
409 Ga0495601_0027620 3300053077 Bacteria 3509
410 Ga0495655_0023323 3300053083 Bacteria 1426
411 Ga0500592_015929 3300053116 Bacteria 1207
412 Ga0501084_0228032 3300054114 Bacteria 1572
413 Ga0501084_0273820 3300054114 Bacteria 1425
414 Ga0501084_1669745 3300054114 Unclassified 532
415 Ga0501082_0035739 3300060353 Bacteria 4282
416 Ga0501082_0564585 3300060353 Unclassified 996
417 Ga0466962_0035081 3300061719 Bacteria 2401
418 Ga0530510_0172406 3300061734 Bacteria 1603
419 2552112202 2551306166 Bacteria 9731570
420 2753270504 2751185782 Bacteria 11227053
421 Ga0268266_11551106
422 rootH1_10001257
423 rootL2_10035585
424 rootH1_10380731
425 Ga0058862_11966842
426 Ga0070683_100109993
427 Ga0070683_100225307
428 Ga0070670_100095555
429 Ga0070677_10172794
430 Ga0068869_100398650
431 Ga0070666_10351567
432 Ga0070680_100009914
433 Ga0070682_100129709
434 Ga0068868_100187949
435 Ga0068868_100692395
436 Ga0068868_101034290
437 Ga0070660_100990432
438 Ga0070689_100015623
439 Ga0070691_10015127
440 Ga0070687_100022735
441 Ga0070661_100152800
442 Ga0070661_100450017
443 Ga0070668_100643144
444 Ga0070671_100037794
445 Ga0070671_100301415
446 Ga0070671_100388555
447 Ga0070671_101790446
448 Ga0070674_100033394
449 Ga0070659_100009099
450 Ga0070667_100078769
451 Ga0070709_10761800
452 Ga0070714_100219837
453 Ga0070714_100711633
454 Ga0070713_100424828
455 Ga0070713_100724674
456 Ga0070713_100741349
457 Ga0070713_100754018
458 Ga0070710_10045055
459 Ga0070710_10547403
460 Ga0070711_100005421
461 Ga0070711_100044736
462 Ga0070711_100205494
463 Ga0070711_100411852
464 Ga0070700_100034292
465 Ga0070708_101676624
466 Ga0070663_100237188
467 Ga0070678_100183667
468 Ga0070678_101062017
469 Ga0070662_100041686
470 Ga0070681_10005299
471 Ga0070681_10016679
472 Ga0070681_10024157
473 Ga0070681_10028575
474 Ga0068867_100659272
475 Ga0070707_100298037
476 Ga0070679_100003106
477 Ga0070679_100010037
478 Ga0070679_100031042
479 Ga0070679_100179267
480 Ga0070679_100732545
481 Ga0070684_100045671
482 Ga0070684_100121500
483 Ga0070684_100360659
484 Ga0068853_100663404
485 Ga0068853_100908282
486 Ga0070686_101540584
487 Ga0070665_100354437
488 Ga0068855_100882592
489 Ga0070664_100686168
490 Ga0068857_100010501
491 Ga0068857_100503324
492 Ga0068854_100010504
493 Ga0068854_100124568
494 Ga0068856_100058409
495 Ga0068856_100185941
496 Ga0068856_100396961
497 Ga0068859_100169217
498 Ga0068859_100272974
499 Ga0068864_100078974
500 Ga0068864_100153671
501 Ga0068863_100039103
502 Ga0068863_100117560
503 Ga0068858_100016978
504 Ga0068858_100129338
505 Ga0068860_100022068
506 Ga0068860_100478895
507 Ga0068862_100146485
508 Ga0068862_100167043
509 Ga0070715_10775251
510 Ga0070716_100030576
511 Ga0070712_100170180
512 Ga0070712_100442798
513 Ga0075367_10843740
514 Ga0075366_10014267
515 Ga0075366_10225293
516 Ga0097621_101045333
517 Ga0097621_101949228
518 Ga0068871_100035193
519 Ga0075428_100004140
520 Ga0075428_100016361
521 Ga0075428_100028092
522 Ga0075428_101543359
523 Ga0075430_100019614
524 Ga0075430_100130826
525 Ga0075430_100148993
526 Ga0075430_100294198
527 Ga0075430_100334950
528 Ga0075430_101371887
529 Ga0075431_100023675
530 Ga0075431_100231433
531 Ga0075431_100280514
532 Ga0075433_10432183
533 Ga0075433_10909464
534 Ga0075434_100006343
535 Ga0075434_100008947
536 Ga0075434_100201377
537 Ga0075434_100495852
538 Ga0075429_100065274
539 Ga0075429_100471418
540 Ga0075436_100041121
541 Ga0097620_100169218
542 Ga0097620_100272977
543 Ga0075435_100007211
544 Ga0075435_100474329
545 Ga0111539_10115886
546 Ga0111539_10253257
547 Ga0105245_10249870
548 Ga0105245_11156563
549 Ga0105245_11424234
550 Ga0105247_10120349
551 Ga0114129_10024381
552 Ga0114129_10054079
553 Ga0114129_10774911
554 Ga0105248_10024686
555 Ga0105248_10478922
556 Ga0105237_10732971
557 Ga0105238_10502464
558 Ga0105249_12457515
559 Ga0105246_10278291
560 Ga0157373_10259841
561 Ga0157369_10022113
562 Ga0157369_10076080
563 Ga0157369_10776140
564 Ga0157374_10144195
565 Ga0157378_10530712
566 Ga0157378_10932424
567 Ga0157372_10727152
568 Ga0157372_11701787
569 Ga0157372_12015031
570 Ga0157375_10122051
571 Ga0157375_11260783
572 Ga0157375_11938197
573 Ga0163163_10014609
574 Ga0163163_10044741
575 Ga0163163_10893804
576 Ga0163163_11436036
577 Ga0157380_10201351
578 Ga0157380_10260827
579 Ga0157377_10768294
580 Ga0157379_10377709
581 Ga0157376_10019738
582 Ga0182005_1027799
583 Ga0207692_10299337
584 Ga0207692_10571778
585 Ga0207692_10690115
586 Ga0207710_10061999
587 Ga0207680_10171419
588 Ga0207685_10061212
589 Ga0207699_10093293
590 Ga0207684_10983868
591 Ga0207707_10019304
592 Ga0207707_10025936
593 Ga0207707_10030972
594 Ga0207707_10059964
595 Ga0207693_10850994
596 Ga0207693_11267274
597 Ga0207693_11272936
598 Ga0207663_10003317
599 Ga0207663_10345681
600 Ga0207663_11551416
601 Ga0207660_10028143
602 Ga0207660_10090602
603 Ga0207657_10037512
604 Ga0207657_10773782
605 Ga0207649_10007168
606 Ga0207649_10502651
607 Ga0207652_10005180
608 Ga0207652_10046125
609 Ga0207652_10108760
610 Ga0207652_10423250
611 Ga0207652_10426377
612 Ga0207652_10574950
613 Ga0207646_10592611
614 Ga0207694_10347292
615 Ga0207650_10058229
616 Ga0207659_10010153
617 Ga0207687_10913408
618 Ga0207700_10114721
619 Ga0207700_10123414
620 Ga0207700_10216741
621 Ga0207700_10966899
622 Ga0207664_10630510
623 Ga0207644_10054218
624 Ga0207644_11090686
625 Ga0207690_10002601
626 Ga0207690_10549922
627 Ga0207690_10906059
628 Ga0207669_10084461
629 Ga0207704_11273173
630 Ga0207691_10002077
631 Ga0207711_10049338
632 Ga0207689_10708216
633 Ga0207661_10374710
634 Ga0207679_10007865
635 Ga0207679_11581522
636 Ga0207667_10214927
637 Ga0207667_10698930
638 Ga0207668_10091888
639 Ga0207668_11452375
640 Ga0207640_10011092
641 Ga0207640_11875798
642 Ga0207703_10102263
643 Ga0207639_10337152
644 Ga0207639_10441563
645 Ga0207639_10707525
646 Ga0207678_10038206
647 Ga0207702_10104067
648 Ga0207702_10247488
649 Ga0207702_10470872
650 Ga0207641_10090128
651 Ga0207641_10579688
652 Ga0207648_10967684
653 Ga0207676_10063085
654 Ga0207676_10720595
655 Ga0207674_10001105
656 Ga0207674_10769581
657 Ga0207675_100003327
658 Ga0207683_10247677
659 Ga0207683_10924187
660 Ga0207698_12071973
661 Ga0207698_12143014
662 Ga0268265_10136316
663 Ga0268265_11519544
664 Ga0268264_10031707
665 Ga0307509_10094852
666 Ga0307411_10322577
667 Ga0307507_10029253
668 Ga0373948_0206844
669 Ga0373958_0048946
670 Ga0373936_0051659
671 Ga0373941_0021701
672 Ga0373953_0070889
673 Ga0373954_0634761
674 Ga0373957_0054954
675 Ga0373960_0240631
676 Ga0373955_0471995
677 Ga0373931_0205742
678 Ga0373927_0524517
679 Ga0373927_0591656
680 Ga0373933_0221341
681 Ga0373937_0570766
682 Ga0373925_0404970
683 Ga0451791_0435390
684 Ga0466965_0092710
685 Ga0466965_0283237
686 Ga0466966_0256098
687 Ga0466961_0044304
688 Ga0466963_0023612
689 Ga0466963_0156833
690 Ga0466963_0215084
691 Ga0466963_0524423
692 Ga0466971_0027468
693 Ga0466970_0107112
694 Ga0466957_0378990
695 Ga0466960_0682969
696 Ga0466959_0131638
697 Ga0451576_0126907
698 Ga0466958_0001930
699 Ga0466958_0083621
700 Ga0466967_0054255
701 Ga0466967_0084136
702 Ga0466967_0456072
703 Ga0495592_0011582
704 Ga0495603_0522452
705 Ga0495629_0058023
706 Ga0495629_0094848
707 Ga0495638_0012956
708 Ga0495641_0534605
709 Ga0495651_0002869
710 Ga0495653_0050613
711 Ga0495662_0032122
712 Ga0495662_0451848
713 Ga0495664_0110842
714 Ga0495608_0077381
715 Ga0495618_0013624
716 Ga0495620_0000060
717 Ga0495628_0043289
718 Ga0495652_0054089
719 Ga0495665_0141233
720 Ga0495665_0664002
721 Ga0495640_0092406
722 Ga0495586_0202568
723 Ga0495587_0029292
724 Ga0495645_0024293
725 Ga0495645_0659425
726 Ga0495667_0012241
727 Ga0495634_0108540
728 Ga0495635_0026312
729 Ga0495657_0044122
730 Ga0495599_0023916
731 Ga0495646_0224092
732 Ga0495624_0068541
733 Ga0495604_0005531
734 Ga0495604_0618009
735 Ga0495674_0022122
736 Ga0495676_0887637
737 Ga0495676_1041661
738 Ga0495680_0032368
739 Ga0495675_0064276
740 Ga0495684_0015078
741 Ga0495602_0018767
742 Ga0496100_0357858
743 Ga0496100_0482663
744 Ga0496101_0170100
745 Ga0496101_0440657
746 Ga0496102_0052747
747 Ga0496102_0149195
748 Ga0496104_0234974
749 Ga0496105_0024910
750 Ga0496106_0086583
751 Ga0496106_0188787
752 Ga0496107_0236958
753 Ga0496107_0856605
754 Ga0496108_0000002
755 Ga0496108_0049132
756 Ga0496108_0099804
757 Ga0496108_0111610
758 Ga0496109_0000001
759 Ga0496109_0010556
760 Ga0496109_0083729
761 Ga0496109_0089342
762 Ga0496109_0491792
763 Ga0496110_0044836
764 Ga0496111_0082515
765 Ga0496111_0241372
766 Ga0496111_0388790
767 Ga0496112_0061758
768 Ga0496112_0182624
769 Ga0496112_0514878
770 Ga0496113_0269106
771 Ga0496113_0274105
772 Ga0496113_0643013
773 Ga0496114_0202044
774 Ga0496114_1096959
775 Ga0496116_0364421
776 Ga0496118_0207827
777 Ga0496125_0043688
778 Ga0501033_0832461
779 Ga0501034_1192782
780 Ga0501038_0305188
781 Ga0501039_0178295
782 Ga0501040_0074762
783 Ga0501042_0219303
784 Ga0501046_0100289
785 Ga0501046_0689949
786 Ga0501047_0178860
787 Ga0501048_0185824
788 Ga0501048_1372243
789 Ga0501068_0136583
790 Ga0501068_0142842
791 Ga0501069_0201288
792 Ga0501070_1269507
793 Ga0501071_0271223
794 Ga0501072_0008667
795 Ga0501075_0017204
796 Ga0501075_0052538
797 Ga0501076_0047475
798 Ga0501076_0365720
799 Ga0501077_0112975
800 Ga0501079_0020288
801 Ga0501079_0507857
802 Ga0501080_0779022
803 Ga0501081_0211033
804 Ga0501044_0077655
805 Ga0501045_0385019
806 nmdc:mga0yw44_1061464_c1
807 nmdc:mga05p37_117692_c1
808 nmdc:mga05p37_327721_c1
809 nmdc:mga09592_138495_c1
810 nmdc:mga09592_277648_c1
811 nmdc:mga0qj67_107742_c1
812 nmdc:mga0qj67_13702_c1
813 nmdc:mga0qj67_43147_c1
814 nmdc:mga0qj67_496852_c1
815 nmdc:mga0qj67_586071_c1
816 nmdc:mga0qj67_74579_c1
817 nmdc:mga06r32_350475_c1
818 nmdc:mga06r32_512718_c1
819 nmdc:mga08y16_309181_c1
820 nmdc:mga08y16_646293_c1
821 nmdc:mga0n895_19427_c1
822 nmdc:mga0n895_2252530_c1
823 nmdc:mga0rr50_16263_c1
824 nmdc:mga0rr50_459006_c1
825 nmdc:mga0rr50_985683_c1
826 nmdc:mga08x19_110105_c1
827 nmdc:mga0a205_430993_c1
828 nmdc:mga0a205_48978_c1
829 Ga0495601_0027620
830 Ga0495655_0023323
831 Ga0500592_015929
832 Ga0501084_0228032
833 Ga0501084_0273820
834 Ga0501084_1669745
835 Ga0501082_0035739
836 Ga0501082_0564585
837 Ga0466962_0035081
838 Ga0530510_0172406
839 2552112202
840 2753270504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01980

TrmO

tRNA-methyltransferase O

21

131

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.9495 2 128
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9216 2 127
3okx-assembly1.cif.gz_A crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.9107 2 135
2nv4-assembly1.cif.gz_B crystal structure of upf0066 protein af0241 in complex with s-adenosylmethionine. northeast structural genomics consortium target gr27 0.8877 2 128
3okx-assembly1.cif.gz_B crystal structure of yaeb-like protein from rhodopseudomonas palustris 0.8437 2 127
ID Description Score Start End Superfamily
2nv4B00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9498 3 128 2.40.30.70
af_Q58978_4_126_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.9155 4 128 2.40.30.70
3okxB00 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8971 2 134 2.40.30.70
af_Q9BU70_29_181_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8949 3 128 2.40.30.70
af_A1Z759_99_248_2.40.30.70 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;YaeB-like 0.8948 3 128 2.40.30.70
ID Description Score Start End GO Terms
AF-A0A538A8W8-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9841 1 128 GO:0008168
GO:0032259
AF-A0A372JAW0-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9833 1 130 GO:0008168
GO:0032259
AF-A0A127JRV9-F1-model_v4 Methyltransferase 0.983 2 128 GO:0008168
GO:0032259
AF-A0A5J5JZE6-F1-model_v4 tRNA (N6-threonylcarbamoyladenosine(37)-N6)-methyltransferase TrmO 0.9822 1 130 GO:0008168
GO:0032259
AF-A0A4P2QHZ5-F1-model_v4 TsaA-like domain-containing protein 0.981 1 129

Map