F439758

General Info

Members Datasets Scaffolds Average Seq Length
420 268 840 122

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10735574|Ga0207648_107355742
Length 144
Sequence VTVFYALVLGFAAGILSGMFGVGGGVLFVPTLSLVVGLSHLSAEATSLAAIIPVVAVGAWQQDRYGNVRWRPALVIGLTSAAGVAGGVALASWLSEGALERLFAGLLLVVAAMVAGGWNREKQTFSRGAAEATTRGRSGGDQSV

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
124 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
125 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
134 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
158 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
163 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
180 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
194 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
207 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
215 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
216 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.9
Rhizosphere 87.86
Stem 0
Stem Tuber 0
Unclassified 14.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10735574 3300026089 Bacteria 916
2 JGI25406J46586_10051562 3300003203 Bacteria 1376
3 Ga0070683_100601743 3300005329 Bacteria 1052
4 Ga0068869_100623769 3300005334 Bacteria 913
5 Ga0070680_101714251 3300005336 Bacteria 545
6 Ga0068868_100570019 3300005338 Bacteria 1000
7 Ga0068868_101546206 3300005338 Bacteria 622
8 Ga0070660_100427568 3300005339 Bacteria 1097
9 Ga0070687_100402473 3300005343 Bacteria 898
10 Ga0070687_100644641 3300005343 Bacteria 733
11 Ga0070661_100594772 3300005344 Bacteria 894
12 Ga0070692_10073229 3300005345 Bacteria 1830
13 Ga0070692_10701033 3300005345 Bacteria 681
14 Ga0070675_101166480 3300005354 Bacteria 709
15 Ga0070671_100103176 3300005355 Bacteria 2393
16 Ga0070671_100517121 3300005355 Unclassified 1028
17 Ga0070674_100536215 3300005356 Bacteria 980
18 Ga0070659_100432732 3300005366 Unclassified 1114
19 Ga0070659_101151844 3300005366 Unclassified 685
20 Ga0070703_10041410 3300005406 Bacteria 1436
21 Ga0070713_100047176 3300005436 Bacteria 3539
22 Ga0070713_102028454 3300005436 Bacteria 558
23 Ga0070710_10136449 3300005437 Bacteria 1500
24 Ga0070701_10512648 3300005438 Bacteria 781
25 Ga0070711_100714640 3300005439 Bacteria 844
26 Ga0070705_100308216 3300005440 Bacteria 1138
27 Ga0070700_100113733 3300005441 Bacteria 1804
28 Ga0070700_100242816 3300005441 Bacteria 1288
29 Ga0070694_100403539 3300005444 Bacteria 1071
30 Ga0070708_100798996 3300005445 Unclassified 887
31 Ga0070663_100023531 3300005455 Bacteria 4131
32 Ga0070678_100712765 3300005456 Bacteria 905
33 Ga0070662_100586563 3300005457 Bacteria 937
34 Ga0070662_101146492 3300005457 Bacteria 668
35 Ga0070681_10330604 3300005458 Bacteria 1434
36 Ga0070681_10376773 3300005458 Bacteria 1330
37 Ga0068867_100222834 3300005459 Unclassified 1521
38 Ga0070706_100175388 3300005467 Bacteria 2002
39 Ga0070679_100407311 3300005530 Bacteria 1306
40 Ga0070684_100148510 3300005535 Bacteria 2122
41 Ga0070684_100189734 3300005535 Bacteria 1870
42 Ga0070684_100463850 3300005535 Bacteria 1171
43 Ga0070697_100711906 3300005536 Unclassified 886
44 Ga0070686_101385459 3300005544 Bacteria 590
45 Ga0070695_100122685 3300005545 Bacteria 1780
46 Ga0070695_100866372 3300005545 Bacteria 728
47 Ga0070696_100069151 3300005546 Bacteria 2480
48 Ga0070696_100092022 3300005546 Bacteria 2160
49 Ga0070693_100007112 3300005547 Bacteria 5455
50 Ga0070693_100233365 3300005547 Bacteria 1212
51 Ga0070665_101777747 3300005548 Unclassified 623
52 Ga0070665_101829123 3300005548 Bacteria 614
53 Ga0070704_100207829 3300005549 Unclassified 1584
54 Ga0068855_100119002 3300005563 Bacteria 3024
55 Ga0070664_100266867 3300005564 Bacteria 1541
56 Ga0070664_100468853 3300005564 Bacteria 1158
57 Ga0068857_100110849 3300005577 Bacteria 2466
58 Ga0068854_100391371 3300005578 Bacteria 1148
59 Ga0068856_100036211 3300005614 Bacteria 4838
60 Ga0068856_100409552 3300005614 Bacteria 1376
61 Ga0070702_100022910 3300005615 Bacteria 3310
62 Ga0070702_100091926 3300005615 Bacteria 1842
63 Ga0070702_100315736 3300005615 Bacteria 1087
64 Ga0068864_100375786 3300005618 Bacteria 1346
65 Ga0081455_10032615 3300005937 Bacteria 4691
66 Ga0081455_10046765 3300005937 Bacteria 3751
67 Ga0081455_10094729 3300005937 Unclassified 2411
68 Ga0081455_10109337 3300005937 Bacteria 2200
69 Ga0081538_10006026 3300005981 Bacteria 10776
70 Ga0081538_10007972 3300005981 Bacteria 9062
71 Ga0081538_10012819 3300005981 Bacteria 6692
72 Ga0081539_10000095 3300005985 Bacteria 204474
73 Ga0081539_10002288 3300005985 Bacteria 27746
74 Ga0070717_10201240 3300006028 Bacteria 1744
75 Ga0070715_10054318 3300006163 Bacteria 1734
76 Ga0070716_100147616 3300006173 Bacteria 1508
77 Ga0097621_100100215 3300006237 Bacteria 2437
78 Ga0097621_101822762 3300006237 Bacteria 580
79 Ga0068871_100381287 3300006358 Bacteria 1252
80 Ga0075428_100165995 3300006844 Bacteria 2395
81 Ga0075428_100522854 3300006844 Unclassified 1269
82 Ga0075434_101642569 3300006871 Unclassified 651
83 Ga0075435_100487501 3300007076 Bacteria 1065
84 Ga0105240_10064336 3300009093 Bacteria 4557
85 Ga0111539_10009040 3300009094 Bacteria 12609
86 Ga0105245_10008435 3300009098 Bacteria 8999
87 Ga0105245_10050028 3300009098 Bacteria 3744
88 Ga0105245_10093694 3300009098 Bacteria 2768
89 Ga0105245_10294478 3300009098 Bacteria 1590
90 Ga0114129_10316118 3300009147 Bacteria 2077
91 Ga0114129_10370645 3300009147 Bacteria 1893
92 Ga0105243_10124367 3300009148 Bacteria 2179
93 Ga0105243_10553315 3300009148 Bacteria 1100
94 Ga0105243_10749846 3300009148 Bacteria 957
95 Ga0105243_10844694 3300009148 Bacteria 906
96 Ga0105243_12215193 3300009148 Bacteria 586
97 Ga0105242_10655752 3300009176 Bacteria 1021
98 Ga0105242_13270699 3300009176 Bacteria 503
99 Ga0105248_10406763 3300009177 Bacteria 1532
100 Ga0105249_10102477 3300009553 Bacteria 2694
101 Ga0105249_10372177 3300009553 Bacteria 1453
102 Ga0105249_10804825 3300009553 Bacteria 1004
103 Ga0105249_10977176 3300009553 Bacteria 915
104 Ga0105239_10465547 3300010375 Bacteria 1435
105 Ga0105239_11446856 3300010375 Unclassified 794
106 Ga0105239_12598901 3300010375 Bacteria 590
107 Ga0105246_10056193 3300011119 Bacteria 2720
108 Ga0105246_10592150 3300011119 Bacteria 957
109 Ga0157373_11204793 3300013100 Bacteria 571
110 Ga0157370_10038696 3300013104 Bacteria 4613
111 Ga0157374_10147999 3300013296 Bacteria 2282
112 Ga0157378_11880865 3300013297 Bacteria 647
113 Ga0163162_11429243 3300013306 Bacteria 787
114 Ga0163162_12218514 3300013306 Bacteria 630
115 Ga0157372_11689417 3300013307 Bacteria 728
116 Ga0157375_10796359 3300013308 Bacteria 1094
117 Ga0157375_10927419 3300013308 Bacteria 1014
118 Ga0157375_11137521 3300013308 Bacteria 914
119 Ga0182008_10265833 3300014497 Bacteria 888
120 Ga0157377_10990481 3300014745 Bacteria 636
121 Ga0157376_10102713 3300014969 Bacteria 2501
122 Ga0163161_10399156 3300017792 Unclassified 1102
123 Ga0197907_10721795 3300020069 Unclassified 965
124 Ga0206353_11289920 3300020082 Unclassified 2358
125 Ga0207653_10366532 3300025885 Bacteria 564
126 Ga0207692_10121330 3300025898 Bacteria 1464
127 Ga0207688_10085658 3300025901 Bacteria 1805
128 Ga0207685_10472250 3300025905 Bacteria 656
129 Ga0207699_10058427 3300025906 Bacteria 2307
130 Ga0207643_10106124 3300025908 Bacteria 1651
131 Ga0207705_10531292 3300025909 Bacteria 914
132 Ga0207684_10240567 3300025910 Bacteria 1561
133 Ga0207707_10349270 3300025912 Bacteria 1274
134 Ga0207695_10079921 3300025913 Bacteria 3312
135 Ga0207693_10303216 3300025915 Bacteria 1251
136 Ga0207693_10416416 3300025915 Archaea 1050
137 Ga0207663_10015645 3300025916 Bacteria 4190
138 Ga0207660_10378750 3300025917 Bacteria 1137
139 Ga0207662_10613435 3300025918 Bacteria 758
140 Ga0207657_10068471 3300025919 Unclassified 3015
141 Ga0207687_10005764 3300025927 Bacteria 8196
142 Ga0207687_10053395 3300025927 Bacteria 2823
143 Ga0207664_10054291 3300025929 Bacteria 3174
144 Ga0207644_10097256 3300025931 Bacteria 2205
145 Ga0207644_10536402 3300025931 Bacteria 968
146 Ga0207690_10401821 3300025932 Unclassified 1093
147 Ga0207690_11407034 3300025932 Unclassified 583
148 Ga0207706_10065050 3300025933 Bacteria 3211
149 Ga0207706_10203324 3300025933 Bacteria 1737
150 Ga0207686_10256781 3300025934 Bacteria 1279
151 Ga0207669_10425550 3300025937 Bacteria 1046
152 Ga0207669_10708365 3300025937 Bacteria 828
153 Ga0207704_10098965 3300025938 Bacteria 1939
154 Ga0207665_10004227 3300025939 Bacteria 9558
155 Ga0207691_10153028 3300025940 Bacteria 2027
156 Ga0207689_10325695 3300025942 Bacteria 1275
157 Ga0207661_10188601 3300025944 Bacteria 1806
158 Ga0207661_10979216 3300025944 Bacteria 779
159 Ga0207679_10710672 3300025945 Bacteria 912
160 Ga0207667_10351083 3300025949 Bacteria 1504
161 Ga0207712_10044145 3300025961 Bacteria 3079
162 Ga0207712_10134244 3300025961 Bacteria 1890
163 Ga0207668_10173423 3300025972 Bacteria 1694
164 Ga0207668_11369875 3300025972 Bacteria 637
165 Ga0207640_10178824 3300025981 Bacteria 1589
166 Ga0207677_11068853 3300026023 Bacteria 734
167 Ga0207678_10033805 3300026067 Bacteria 4453
168 Ga0207708_10229970 3300026075 Bacteria 1489
169 Ga0207702_10006553 3300026078 Bacteria 10017
170 Ga0207702_10022307 3300026078 Bacteria 5248
171 Ga0207702_10394941 3300026078 Bacteria 1333
172 Ga0207641_11716396 3300026088 Bacteria 630
173 Ga0207648_10145311 3300026089 Bacteria 2092
174 Ga0207674_10152194 3300026116 Bacteria 2270
175 Ga0207675_100024563 3300026118 Bacteria 5603
176 Ga0207683_10004007 3300026121 Bacteria 12751
177 Ga0207683_10437193 3300026121 Bacteria 1206
178 Ga0207698_11963078 3300026142 Bacteria 600
179 Ga0207428_10008468 3300027907 Bacteria 9286
180 Ga0268266_11695499 3300028379 Unclassified 607
181 Ga0265326_10004775 3300028558 Bacteria 4305
182 Ga0265319_1005634 3300028563 Bacteria 5957
183 Ga0265319_1072331 3300028563 Bacteria 1104
184 Ga0265334_10002271 3300028573 Bacteria 9024
185 Ga0265318_10007841 3300028577 Bacteria 4798
186 Ga0265323_10076354 3300028653 Bacteria 1137
187 Ga0265322_10039522 3300028654 Bacteria 1342
188 Ga0265336_10022955 3300028666 Bacteria 1983
189 Ga0265338_10003691 3300028800 Bacteria 21326
190 Ga0265338_10016386 3300028800 Bacteria 8070
191 Ga0265338_10178914 3300028800 Bacteria 1619
192 Ga0265338_10237863 3300028800 Bacteria 1350
193 Ga0265324_10032475 3300029957 Bacteria 1824
194 Ga0265330_10001454 3300031235 Bacteria 13806
195 Ga0265332_10001859 3300031238 Bacteria 11214
196 Ga0265332_10366716 3300031238 Unclassified 594
197 Ga0265328_10000553 3300031239 Bacteria 17405
198 Ga0265320_10003137 3300031240 Bacteria 11217
199 Ga0265325_10001515 3300031241 Bacteria 16326
200 Ga0265329_10001572 3300031242 Bacteria 10934
201 Ga0265340_10003259 3300031247 Bacteria 9203
202 Ga0265339_10003002 3300031249 Bacteria 11894
203 Ga0265331_10001988 3300031250 Bacteria 14279
204 Ga0265327_10003921 3300031251 Bacteria 13660
205 Ga0265327_10013925 3300031251 Bacteria 5302
206 Ga0265316_10004716 3300031344 Bacteria 13502
207 Ga0265316_10593272 3300031344 Unclassified 786
208 Ga0307408_100015900 3300031548 Bacteria 5016
209 Ga0307408_100535462 3300031548 Unclassified 1031
210 Ga0265313_10003149 3300031595 Bacteria 13619
211 Ga0265314_10003611 3300031711 Bacteria 14879
212 Ga0265314_10096629 3300031711 Bacteria 1910
213 Ga0265342_10001768 3300031712 Bacteria 19717
214 Ga0265342_10429681 3300031712 Unclassified 679
215 Ga0307405_10132517 3300031731 Unclassified 1724
216 Ga0307413_10156425 3300031824 Bacteria 1595
217 Ga0307410_10593071 3300031852 Bacteria 923
218 Ga0307406_10023246 3300031901 Bacteria 3685
219 Ga0307406_10058228 3300031901 Bacteria 2482
220 Ga0307407_10099258 3300031903 Bacteria 1803
221 Ga0307412_10038184 3300031911 Bacteria 3090
222 Ga0307409_100020528 3300031995 Bacteria 4505
223 Ga0307409_100023081 3300031995 Bacteria 4303
224 Ga0307416_100002750 3300032002 Bacteria 10207
225 Ga0307416_100003893 3300032002 Bacteria 8884
226 Ga0307416_101227320 3300032002 Unclassified 855
227 Ga0307415_100000030 3300032126 Bacteria 60633
228 Ga0307415_100720203 3300032126 Unclassified 902
229 Ga0373958_0019448 3300034819 Bacteria 1241
230 Ga0373928_0019310 3300035084 Bacteria 1421
231 Ga0373934_0135735 3300035086 Bacteria 1005
232 Ga0373949_0188146 3300035090 Bacteria 615
233 Ga0373932_0021102 3300035112 Bacteria 1716
234 Ga0373941_0025951 3300035115 Bacteria 1697
235 Ga0373956_0225074 3300035119 Bacteria 891
236 Ga0373960_0011102 3300035121 Bacteria 2212
237 Ga0373955_1002920 3300035172 Unclassified 514
238 Ga0373942_0067600 3300035207 Bacteria 1037
239 Ga0373962_0008053 3300035242 Bacteria 2590
240 Ga0373924_0065873 3300035410 Bacteria 1522
241 Ga0373931_0677616 3300035691 Bacteria 679
242 Ga0373933_0082275 3300035724 Bacteria 1976
243 Ga0373937_0566052 3300036401 Bacteria 1079
244 Ga0395899_0006126 3300037312 Bacteria 9320
245 Ga0395899_0024436 3300037312 Bacteria 4568
246 Ga0395900_0713571 3300037418 Bacteria 935
247 Ga0395898_0038076 3300037466 Bacteria 4768
248 Ga0395898_0141292 3300037466 Bacteria 2305
249 Ga0395898_0315557 3300037466 Bacteria 1491
250 Ga0395905_0014356 3300037471 Bacteria 7569
251 Ga0395905_0147876 3300037471 Bacteria 2210
252 Ga0395901_0007282 3300038443 Bacteria 11166
253 Ga0395901_0174647 3300038443 Bacteria 2253
254 Ga0395901_0283340 3300038443 Bacteria 1721
255 Ga0395901_1686802 3300038443 Bacteria 585
256 Ga0439439_0026970 3300041406 Bacteria 1450
257 Ga0451853_2679312 3300041512 Bacteria 524
258 Ga0439448_0039047 3300042005 Bacteria 1530
259 Ga0439448_0059050 3300042005 Bacteria 1266
260 Ga0439463_151643 3300042016 Bacteria 601
261 Ga0439458_0143905 3300042157 Bacteria 636
262 Ga0439434_0072221 3300042435 Bacteria 1087
263 Ga0466972_0096178 3300044658 Bacteria 1403
264 Ga0466965_0103751 3300044683 Bacteria 1456
265 Ga0466961_0675997 3300044693 Bacteria 619
266 Ga0466964_0271361 3300044706 Bacteria 844
267 Ga0466968_0224644 3300044735 Bacteria 885
268 Ga0466960_0379650 3300044901 Bacteria 811
269 Ga0451576_0046462 3300045051 Bacteria 4571
270 Ga0466958_0441844 3300045836 Bacteria 842
271 Ga0466958_0470317 3300045836 Unclassified 815
272 Ga0466958_0531416 3300045836 Bacteria 764
273 Ga0466967_0554764 3300045976 Bacteria 1131
274 Ga0466967_1105282 3300045976 Bacteria 790
275 Ga0466967_1375074 3300045976 Bacteria 703
276 Ga0466967_1751955 3300045976 Bacteria 618
277 Ga0495627_147537 3300046453 Unclassified 657
278 Ga0495629_0454980 3300046459 Bacteria 866
279 Ga0495651_0332843 3300046462 Unclassified 1009
280 Ga0495651_0765264 3300046462 Unclassified 598
281 Ga0495653_0165326 3300046463 Bacteria 1532
282 Ga0495584_0045370 3300046491 Archaea 2217
283 Ga0495584_0171124 3300046491 Bacteria 1104
284 Ga0495584_0310593 3300046491 Bacteria 801
285 Ga0495584_0386300 3300046491 Unclassified 711
286 Ga0495585_0058778 3300046492 Bacteria 2121
287 Ga0495585_0410888 3300046492 Bacteria 651
288 Ga0495583_0129479 3300046506 Archaea 1057
289 Ga0495608_0066869 3300046511 Bacteria 2352
290 Ga0495608_0647893 3300046511 Bacteria 631
291 Ga0495630_0468161 3300046517 Bacteria 966
292 Ga0495631_0113116 3300046518 Unclassified 1167
293 Ga0495663_0021110 3300046525 Bacteria 1874
294 Ga0495642_0210157 3300046528 Bacteria 849
295 Ga0495598_0019821 3300046537 Unclassified 1769
296 Ga0495609_0121645 3300046538 Unclassified 1122
297 Ga0495621_0049382 3300046539 Archaea 1501
298 Ga0495597_0181456 3300046542 Bacteria 851
299 Ga0495633_0137328 3300046558 Bacteria 1131
300 Ga0495633_0316929 3300046558 Bacteria 708
301 Ga0495656_0058907 3300046615 Bacteria 1669
302 Ga0495611_0040578 3300046648 Unclassified 2076
303 Ga0495611_0297887 3300046648 Bacteria 744
304 Ga0495661_0273374 3300046665 Bacteria 854
305 Ga0495657_0033172 3300046675 Bacteria 3597
306 Ga0495623_0559606 3300046679 Unclassified 598
307 Ga0495669_0212776 3300046684 Unclassified 926
308 Ga0495670_0417360 3300046691 Unclassified 726
309 Ga0495649_0265249 3300046694 Unclassified 880
310 Ga0495649_0476531 3300046694 Bacteria 622
311 Ga0495581_0358914 3300047315 Bacteria 851
312 Ga0495680_0098320 3300047322 Bacteria 2184
313 Ga0495675_0465194 3300047444 Unclassified 730
314 Ga0495684_0208608 3300047471 Bacteria 1437
315 Ga0495602_0765439 3300048088 Unclassified 651
316 Ga0495615_0153536 3300048090 Unclassified 687
317 Ga0495615_0291215 3300048090 Unclassified 527
318 Ga0495626_0226874 3300048091 Bacteria 757
319 Ga0496100_0016358 3300048903 Bacteria 4355
320 Ga0496100_1228012 3300048903 Archaea 591
321 Ga0496100_1293031 3300048903 Bacteria 575
322 Ga0496101_0000511 3300048904 Bacteria 24342
323 Ga0496101_0165314 3300048904 Bacteria 1698
324 Ga0496101_0877522 3300048904 Bacteria 706
325 Ga0496102_0027411 3300048905 Bacteria 5087
326 Ga0496102_0194247 3300048905 Bacteria 1913
327 Ga0496102_0291454 3300048905 Bacteria 1538
328 Ga0496102_0308677 3300048905 Bacteria 1491
329 Ga0496102_1785098 3300048905 Bacteria 532
330 Ga0496103_0011420 3300048906 Bacteria 5263
331 Ga0496104_0000085 3300048907 Bacteria 90352
332 Ga0496104_0211782 3300048907 Bacteria 1849
333 Ga0496105_0002537 3300048908 Bacteria 13250
334 Ga0496105_0040648 3300048908 Bacteria 3834
335 Ga0496105_0061062 3300048908 Unclassified 3110
336 Ga0496105_0298009 3300048908 Unclassified 1297
337 Ga0496105_1101377 3300048908 Archaea 589
338 Ga0496106_0119589 3300048909 Bacteria 2058
339 Ga0496106_0419288 3300048909 Bacteria 1076
340 Ga0496106_1208373 3300048909 Bacteria 589
341 Ga0496106_1372172 3300048909 Bacteria 547
342 Ga0496106_1542621 3300048909 Bacteria 510
343 Ga0496107_0120999 3300048910 Bacteria 1929
344 Ga0496107_0251609 3300048910 Bacteria 1314
345 Ga0496108_0002785 3300048911 Bacteria 14014
346 Ga0496108_1296121 3300048911 Bacteria 613
347 Ga0496109_0000212 3300048912 Bacteria 56945
348 Ga0496109_0001953 3300048912 Bacteria 17112
349 Ga0496109_0206093 3300048912 Unclassified 1849
350 Ga0496109_0525476 3300048912 Bacteria 1117
351 Ga0496110_0011237 3300048913 Bacteria 7319
352 Ga0496110_0033445 3300048913 Bacteria 4447
353 Ga0496110_0072436 3300048913 Unclassified 3057
354 Ga0496110_0074473 3300048913 Bacteria 3015
355 Ga0496111_0000178 3300048914 Bacteria 28805
356 Ga0496111_0016313 3300048914 Bacteria 5116
357 Ga0496111_0025431 3300048914 Bacteria 4177
358 Ga0496111_0190956 3300048914 Archaea 1523
359 Ga0496112_0046513 3300048915 Bacteria 4256
360 Ga0496113_0122134 3300048916 Bacteria 2037
361 Ga0496113_0207590 3300048916 Bacteria 1559
362 Ga0496114_0000943 3300048917 Bacteria 21746
363 Ga0496114_0007657 3300048917 Bacteria 8540
364 Ga0496114_0121665 3300048917 Bacteria 2245
365 Ga0496114_0432579 3300048917 Bacteria 1165
366 Ga0496115_0026275 3300048918 Bacteria 4543
367 Ga0496115_0049454 3300048918 Bacteria 3365
368 Ga0496115_0495816 3300048918 Bacteria 982
369 Ga0501036_0172683 3300049572 Bacteria 1821
370 Ga0501039_0167859 3300049575 Unclassified 1725
371 Ga0501039_0478142 3300049575 Bacteria 978
372 Ga0501040_1014160 3300049576 Bacteria 602
373 Ga0501041_0782093 3300049577 Bacteria 612
374 Ga0501042_0584773 3300049578 Bacteria 812
375 Ga0501043_0175952 3300049579 Bacteria 1668
376 Ga0501046_0437936 3300049580 Unclassified 941
377 Ga0501048_0126214 3300049582 Bacteria 1809
378 Ga0501048_0159513 3300049582 Bacteria 1596
379 Ga0501067_0002182 3300049583 Bacteria 10797
380 Ga0501067_0021169 3300049583 Bacteria 3598
381 Ga0501068_0002363 3300049584 Bacteria 10037
382 Ga0501068_0215806 3300049584 Unclassified 1219
383 Ga0501068_0224948 3300049584 Bacteria 1193
384 Ga0501068_0238939 3300049584 Bacteria 1156
385 Ga0501069_0001361 3300049585 Bacteria 12005
386 Ga0501069_0015144 3300049585 Bacteria 4131
387 Ga0501069_0369960 3300049585 Bacteria 846
388 Ga0501070_0265246 3300049586 Unclassified 1403
389 Ga0501070_0519856 3300049586 Bacteria 955
390 Ga0501071_0130495 3300049587 Bacteria 1866
391 Ga0501071_0280293 3300049587 Bacteria 1261
392 Ga0501072_0038553 3300049588 Bacteria 3750
393 Ga0501072_0687292 3300049588 Unclassified 804
394 Ga0501074_0094778 3300049590 Bacteria 2138
395 Ga0501074_0676107 3300049590 Bacteria 729
396 Ga0501075_0175355 3300049591 Bacteria 1636
397 Ga0501075_0543498 3300049591 Bacteria 887
398 Ga0501075_0549429 3300049591 Unclassified 881
399 Ga0501076_0070534 3300049592 Bacteria 2794
400 Ga0501076_0206128 3300049592 Bacteria 1606
401 Ga0501077_0455256 3300049593 Unclassified 819
402 Ga0501233_227611 3300049668 Bacteria 553
403 Ga0501225_0316838 3300049705 Bacteria 532
404 Ga0501079_0765036 3300049741 Bacteria 760
405 Ga0501081_0326803 3300049743 Bacteria 1128
406 Ga0501081_0457706 3300049743 Bacteria 948
407 Ga0501081_0494148 3300049743 Unclassified 911
408 Ga0501045_0394872 3300049824 Unclassified 1029
409 nmdc:mga08y16_14040_c1 3300050511 Bacteria 8430
410 Ga0495655_0008589 3300053083 Bacteria 1947
411 Ga0495595_0037190 3300053084 Bacteria 2212
412 Ga0501084_0365873 3300054114 Unclassified 1218
413 Ga0501084_0517279 3300054114 Bacteria 1009
414 Ga0501084_0556449 3300054114 Bacteria 969
415 Ga0590075_125896 3300059424 Unclassified 671
416 Ga0501082_0078207 3300060353 Bacteria 2853
417 Ga0501082_0240080 3300060353 Bacteria 1577
418 Ga0530510_0013484 3300061734 Bacteria 5746
419 Ga0530510_0138088 3300061734 Bacteria 1795
420 Ga0530510_0622584 3300061734 Bacteria 821
421 Ga0207648_10735574
422 JGI25406J46586_10051562
423 Ga0070683_100601743
424 Ga0068869_100623769
425 Ga0070680_101714251
426 Ga0068868_100570019
427 Ga0068868_101546206
428 Ga0070660_100427568
429 Ga0070687_100402473
430 Ga0070687_100644641
431 Ga0070661_100594772
432 Ga0070692_10073229
433 Ga0070692_10701033
434 Ga0070675_101166480
435 Ga0070671_100103176
436 Ga0070671_100517121
437 Ga0070674_100536215
438 Ga0070659_100432732
439 Ga0070659_101151844
440 Ga0070703_10041410
441 Ga0070713_100047176
442 Ga0070713_102028454
443 Ga0070710_10136449
444 Ga0070701_10512648
445 Ga0070711_100714640
446 Ga0070705_100308216
447 Ga0070700_100113733
448 Ga0070700_100242816
449 Ga0070694_100403539
450 Ga0070708_100798996
451 Ga0070663_100023531
452 Ga0070678_100712765
453 Ga0070662_100586563
454 Ga0070662_101146492
455 Ga0070681_10330604
456 Ga0070681_10376773
457 Ga0068867_100222834
458 Ga0070706_100175388
459 Ga0070679_100407311
460 Ga0070684_100148510
461 Ga0070684_100189734
462 Ga0070684_100463850
463 Ga0070697_100711906
464 Ga0070686_101385459
465 Ga0070695_100122685
466 Ga0070695_100866372
467 Ga0070696_100069151
468 Ga0070696_100092022
469 Ga0070693_100007112
470 Ga0070693_100233365
471 Ga0070665_101777747
472 Ga0070665_101829123
473 Ga0070704_100207829
474 Ga0068855_100119002
475 Ga0070664_100266867
476 Ga0070664_100468853
477 Ga0068857_100110849
478 Ga0068854_100391371
479 Ga0068856_100036211
480 Ga0068856_100409552
481 Ga0070702_100022910
482 Ga0070702_100091926
483 Ga0070702_100315736
484 Ga0068864_100375786
485 Ga0081455_10032615
486 Ga0081455_10046765
487 Ga0081455_10094729
488 Ga0081455_10109337
489 Ga0081538_10006026
490 Ga0081538_10007972
491 Ga0081538_10012819
492 Ga0081539_10000095
493 Ga0081539_10002288
494 Ga0070717_10201240
495 Ga0070715_10054318
496 Ga0070716_100147616
497 Ga0097621_100100215
498 Ga0097621_101822762
499 Ga0068871_100381287
500 Ga0075428_100165995
501 Ga0075428_100522854
502 Ga0075434_101642569
503 Ga0075435_100487501
504 Ga0105240_10064336
505 Ga0111539_10009040
506 Ga0105245_10008435
507 Ga0105245_10050028
508 Ga0105245_10093694
509 Ga0105245_10294478
510 Ga0114129_10316118
511 Ga0114129_10370645
512 Ga0105243_10124367
513 Ga0105243_10553315
514 Ga0105243_10749846
515 Ga0105243_10844694
516 Ga0105243_12215193
517 Ga0105242_10655752
518 Ga0105242_13270699
519 Ga0105248_10406763
520 Ga0105249_10102477
521 Ga0105249_10372177
522 Ga0105249_10804825
523 Ga0105249_10977176
524 Ga0105239_10465547
525 Ga0105239_11446856
526 Ga0105239_12598901
527 Ga0105246_10056193
528 Ga0105246_10592150
529 Ga0157373_11204793
530 Ga0157370_10038696
531 Ga0157374_10147999
532 Ga0157378_11880865
533 Ga0163162_11429243
534 Ga0163162_12218514
535 Ga0157372_11689417
536 Ga0157375_10796359
537 Ga0157375_10927419
538 Ga0157375_11137521
539 Ga0182008_10265833
540 Ga0157377_10990481
541 Ga0157376_10102713
542 Ga0163161_10399156
543 Ga0197907_10721795
544 Ga0206353_11289920
545 Ga0207653_10366532
546 Ga0207692_10121330
547 Ga0207688_10085658
548 Ga0207685_10472250
549 Ga0207699_10058427
550 Ga0207643_10106124
551 Ga0207705_10531292
552 Ga0207684_10240567
553 Ga0207707_10349270
554 Ga0207695_10079921
555 Ga0207693_10303216
556 Ga0207693_10416416
557 Ga0207663_10015645
558 Ga0207660_10378750
559 Ga0207662_10613435
560 Ga0207657_10068471
561 Ga0207687_10005764
562 Ga0207687_10053395
563 Ga0207664_10054291
564 Ga0207644_10097256
565 Ga0207644_10536402
566 Ga0207690_10401821
567 Ga0207690_11407034
568 Ga0207706_10065050
569 Ga0207706_10203324
570 Ga0207686_10256781
571 Ga0207669_10425550
572 Ga0207669_10708365
573 Ga0207704_10098965
574 Ga0207665_10004227
575 Ga0207691_10153028
576 Ga0207689_10325695
577 Ga0207661_10188601
578 Ga0207661_10979216
579 Ga0207679_10710672
580 Ga0207667_10351083
581 Ga0207712_10044145
582 Ga0207712_10134244
583 Ga0207668_10173423
584 Ga0207668_11369875
585 Ga0207640_10178824
586 Ga0207677_11068853
587 Ga0207678_10033805
588 Ga0207708_10229970
589 Ga0207702_10006553
590 Ga0207702_10022307
591 Ga0207702_10394941
592 Ga0207641_11716396
593 Ga0207648_10145311
594 Ga0207674_10152194
595 Ga0207675_100024563
596 Ga0207683_10004007
597 Ga0207683_10437193
598 Ga0207698_11963078
599 Ga0207428_10008468
600 Ga0268266_11695499
601 Ga0265326_10004775
602 Ga0265319_1005634
603 Ga0265319_1072331
604 Ga0265334_10002271
605 Ga0265318_10007841
606 Ga0265323_10076354
607 Ga0265322_10039522
608 Ga0265336_10022955
609 Ga0265338_10003691
610 Ga0265338_10016386
611 Ga0265338_10178914
612 Ga0265338_10237863
613 Ga0265324_10032475
614 Ga0265330_10001454
615 Ga0265332_10001859
616 Ga0265332_10366716
617 Ga0265328_10000553
618 Ga0265320_10003137
619 Ga0265325_10001515
620 Ga0265329_10001572
621 Ga0265340_10003259
622 Ga0265339_10003002
623 Ga0265331_10001988
624 Ga0265327_10003921
625 Ga0265327_10013925
626 Ga0265316_10004716
627 Ga0265316_10593272
628 Ga0307408_100015900
629 Ga0307408_100535462
630 Ga0265313_10003149
631 Ga0265314_10003611
632 Ga0265314_10096629
633 Ga0265342_10001768
634 Ga0265342_10429681
635 Ga0307405_10132517
636 Ga0307413_10156425
637 Ga0307410_10593071
638 Ga0307406_10023246
639 Ga0307406_10058228
640 Ga0307407_10099258
641 Ga0307412_10038184
642 Ga0307409_100020528
643 Ga0307409_100023081
644 Ga0307416_100002750
645 Ga0307416_100003893
646 Ga0307416_101227320
647 Ga0307415_100000030
648 Ga0307415_100720203
649 Ga0373958_0019448
650 Ga0373928_0019310
651 Ga0373934_0135735
652 Ga0373949_0188146
653 Ga0373932_0021102
654 Ga0373941_0025951
655 Ga0373956_0225074
656 Ga0373960_0011102
657 Ga0373955_1002920
658 Ga0373942_0067600
659 Ga0373962_0008053
660 Ga0373924_0065873
661 Ga0373931_0677616
662 Ga0373933_0082275
663 Ga0373937_0566052
664 Ga0395899_0006126
665 Ga0395899_0024436
666 Ga0395900_0713571
667 Ga0395898_0038076
668 Ga0395898_0141292
669 Ga0395898_0315557
670 Ga0395905_0014356
671 Ga0395905_0147876
672 Ga0395901_0007282
673 Ga0395901_0174647
674 Ga0395901_0283340
675 Ga0395901_1686802
676 Ga0439439_0026970
677 Ga0451853_2679312
678 Ga0439448_0039047
679 Ga0439448_0059050
680 Ga0439463_151643
681 Ga0439458_0143905
682 Ga0439434_0072221
683 Ga0466972_0096178
684 Ga0466965_0103751
685 Ga0466961_0675997
686 Ga0466964_0271361
687 Ga0466968_0224644
688 Ga0466960_0379650
689 Ga0451576_0046462
690 Ga0466958_0441844
691 Ga0466958_0470317
692 Ga0466958_0531416
693 Ga0466967_0554764
694 Ga0466967_1105282
695 Ga0466967_1375074
696 Ga0466967_1751955
697 Ga0495627_147537
698 Ga0495629_0454980
699 Ga0495651_0332843
700 Ga0495651_0765264
701 Ga0495653_0165326
702 Ga0495584_0045370
703 Ga0495584_0171124
704 Ga0495584_0310593
705 Ga0495584_0386300
706 Ga0495585_0058778
707 Ga0495585_0410888
708 Ga0495583_0129479
709 Ga0495608_0066869
710 Ga0495608_0647893
711 Ga0495630_0468161
712 Ga0495631_0113116
713 Ga0495663_0021110
714 Ga0495642_0210157
715 Ga0495598_0019821
716 Ga0495609_0121645
717 Ga0495621_0049382
718 Ga0495597_0181456
719 Ga0495633_0137328
720 Ga0495633_0316929
721 Ga0495656_0058907
722 Ga0495611_0040578
723 Ga0495611_0297887
724 Ga0495661_0273374
725 Ga0495657_0033172
726 Ga0495623_0559606
727 Ga0495669_0212776
728 Ga0495670_0417360
729 Ga0495649_0265249
730 Ga0495649_0476531
731 Ga0495581_0358914
732 Ga0495680_0098320
733 Ga0495675_0465194
734 Ga0495684_0208608
735 Ga0495602_0765439
736 Ga0495615_0153536
737 Ga0495615_0291215
738 Ga0495626_0226874
739 Ga0496100_0016358
740 Ga0496100_1228012
741 Ga0496100_1293031
742 Ga0496101_0000511
743 Ga0496101_0165314
744 Ga0496101_0877522
745 Ga0496102_0027411
746 Ga0496102_0194247
747 Ga0496102_0291454
748 Ga0496102_0308677
749 Ga0496102_1785098
750 Ga0496103_0011420
751 Ga0496104_0000085
752 Ga0496104_0211782
753 Ga0496105_0002537
754 Ga0496105_0040648
755 Ga0496105_0061062
756 Ga0496105_0298009
757 Ga0496105_1101377
758 Ga0496106_0119589
759 Ga0496106_0419288
760 Ga0496106_1208373
761 Ga0496106_1372172
762 Ga0496106_1542621
763 Ga0496107_0120999
764 Ga0496107_0251609
765 Ga0496108_0002785
766 Ga0496108_1296121
767 Ga0496109_0000212
768 Ga0496109_0001953
769 Ga0496109_0206093
770 Ga0496109_0525476
771 Ga0496110_0011237
772 Ga0496110_0033445
773 Ga0496110_0072436
774 Ga0496110_0074473
775 Ga0496111_0000178
776 Ga0496111_0016313
777 Ga0496111_0025431
778 Ga0496111_0190956
779 Ga0496112_0046513
780 Ga0496113_0122134
781 Ga0496113_0207590
782 Ga0496114_0000943
783 Ga0496114_0007657
784 Ga0496114_0121665
785 Ga0496114_0432579
786 Ga0496115_0026275
787 Ga0496115_0049454
788 Ga0496115_0495816
789 Ga0501036_0172683
790 Ga0501039_0167859
791 Ga0501039_0478142
792 Ga0501040_1014160
793 Ga0501041_0782093
794 Ga0501042_0584773
795 Ga0501043_0175952
796 Ga0501046_0437936
797 Ga0501048_0126214
798 Ga0501048_0159513
799 Ga0501067_0002182
800 Ga0501067_0021169
801 Ga0501068_0002363
802 Ga0501068_0215806
803 Ga0501068_0224948
804 Ga0501068_0238939
805 Ga0501069_0001361
806 Ga0501069_0015144
807 Ga0501069_0369960
808 Ga0501070_0265246
809 Ga0501070_0519856
810 Ga0501071_0130495
811 Ga0501071_0280293
812 Ga0501072_0038553
813 Ga0501072_0687292
814 Ga0501074_0094778
815 Ga0501074_0676107
816 Ga0501075_0175355
817 Ga0501075_0543498
818 Ga0501075_0549429
819 Ga0501076_0070534
820 Ga0501076_0206128
821 Ga0501077_0455256
822 Ga0501233_227611
823 Ga0501225_0316838
824 Ga0501079_0765036
825 Ga0501081_0326803
826 Ga0501081_0457706
827 Ga0501081_0494148
828 Ga0501045_0394872
829 nmdc:mga08y16_14040_c1
830 Ga0495655_0008589
831 Ga0495595_0037190
832 Ga0501084_0365873
833 Ga0501084_0517279
834 Ga0501084_0556449
835 Ga0590075_125896
836 Ga0501082_0078207
837 Ga0501082_0240080
838 Ga0530510_0013484
839 Ga0530510_0138088
840 Ga0530510_0622584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

6

140

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hac-assembly1.cif.gz_A crystal structure of [fe]-hydrogenase (hmd) holoenzyme from methanococcus aeolicus (open form) 0.4375 7 63
6hac-assembly1.cif.gz_A crystal structure of [fe]-hydrogenase (hmd) holoenzyme from methanococcus aeolicus (open form) 0.218 7 63
ID Description Score Start End Superfamily
af_Q9US28_422_583_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.9212 29 55 3.40.50.80
af_Q55G48_338_502_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.8928 29 50 3.40.50.80
af_A4HTN7_668_773_1.20.58.420 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;AHSP 0.8109 23 71 1.20.58.420
af_Q8IDK1_6_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.678 30 66 3.40.50.300
af_Q2FVI8_12_124_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5837 11 58 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A3D5YIW8-F1-model_v4 Probable membrane transporter protein 0.7695 6 85 GO:0005886
AF-A0A7X6YAK7-F1-model_v4 Probable membrane transporter protein 0.7309 1 116 GO:0005886
AF-A0A829QLV5-F1-model_v4 Probable membrane transporter protein 0.7164 2 120 GO:0005886
AF-A0A662FRF5-F1-model_v4 Probable membrane transporter protein 0.6994 5 106 GO:0005886
AF-A0A7X9KC34-F1-model_v4 deleted 0.6988 9 96

Map