F439659

General Info

Members Datasets Scaffolds Average Seq Length
419 293 386 253

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006429537
Length 293
Sequence SGTQPAESQRPQTSGAAPSAGRDAGSAAPAPKVATAPAPGAAGARPRPVLGVDIGGSGIKGAPVDLGRGDLAEERHKVLTPRPATPEAVVECVAEVVGHFAWTRPLGVTFPGVVTDGTTRTAANVDPGWIGRDTRALLADRLGLPVTVLNDADAAGVAEMAFGAGRGRRGTVIVLTLGTGIGSAVFTDGHLVPNTELGHLELDGHDAETRAAGRVKDEEGMKWAQWSRRLERYLRHVEMLFSPELFILGGGISRKAHKFLPRIEGVRAEMVPAELKNNAGIVGAAMTAAAAAR

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
3 2643221548 Streptomyces sp. Root55 Isolate Unclassified
4 2643221578 Streptomyces sp. Root63 Isolate Unclassified
5 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
6 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
7 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
8 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
9 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
10 2808606372 Agromyces sp. 23-23 Isolate Unclassified
11 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
12 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
13 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
14 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
15 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
16 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
17 2891562705 Microbispora tritici MT50 Isolate Unclassified
18 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
19 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
20 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
21 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
22 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
23 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
24 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
25 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
26 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
29 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
32 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
33 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
36 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
162 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
167 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
208 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
209 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
214 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
215 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
268 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
269 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
270 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
271 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
272 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
273 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
274 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
275 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
278 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
279 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
280 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
281 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
282 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
283 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
284 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
286 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
287 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
288 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
289 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
290 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
291 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
292 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
293 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.41
Metatranscriptomes 0.72
Isolates 7.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.06
Nodule 0
Rhizoplane 7.16
Rhizosphere 82.34
Stem 0
Stem Tuber 0
Unclassified 6.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10044297 3300001979 Bacteria 1321
2 JGI24739J22299_10023891 3300001989 Bacteria 2157
3 JGI24033J26618_1012113 3300002155 Bacteria 1036
4 JGI24751J29686_10012660 3300002459 Bacteria 1740
5 JGI25405J52794_10008275 3300003911 Bacteria 1939
6 Ga0065714_10004176 3300005288 Bacteria 6722
7 Ga0070658_10014025 3300005327 Bacteria 6433
8 Ga0070676_10061132 3300005328 Bacteria 2239
9 Ga0070690_100609674 3300005330 Bacteria 830
10 Ga0068869_100002865 3300005334 Bacteria 10466
11 Ga0070666_10024757 3300005335 Bacteria 3912
12 Ga0070682_100012976 3300005337 Bacteria 4783
13 Ga0070682_100020278 3300005337 Bacteria 3910
14 Ga0068868_100121332 3300005338 Bacteria 2132
15 Ga0070660_100188664 3300005339 Bacteria 1669
16 Ga0070689_100085191 3300005340 Bacteria 2484
17 Ga0070689_100115701 3300005340 Bacteria 2138
18 Ga0070661_100079476 3300005344 Bacteria 2420
19 Ga0070668_100084706 3300005347 Bacteria 2490
20 Ga0070668_100539904 3300005347 Bacteria 1014
21 Ga0070675_100218483 3300005354 Bacteria 1659
22 Ga0070671_100098370 3300005355 Bacteria 2454
23 Ga0070674_100370681 3300005356 Bacteria 1162
24 Ga0070673_100428770 3300005364 Bacteria 1187
25 Ga0070688_100075475 3300005365 Bacteria 2167
26 Ga0070709_10011286 3300005434 Bacteria 4973
27 Ga0070713_100124451 3300005436 Bacteria 2266
28 Ga0070710_10040394 3300005437 Bacteria 2571
29 Ga0070710_10081844 3300005437 Bacteria 1886
30 Ga0070711_100027769 3300005439 Bacteria 3718
31 Ga0070705_100019058 3300005440 Bacteria 3606
32 Ga0070700_100058021 3300005441 Bacteria 2430
33 Ga0070663_100006377 3300005455 Bacteria 7090
34 Ga0070663_100235087 3300005455 Bacteria 1444
35 Ga0070663_100263447 3300005455 Bacteria 1368
36 Ga0070678_100002160 3300005456 Bacteria 10668
37 Ga0070678_100138108 3300005456 Bacteria 1946
38 Ga0068867_100122674 3300005459 Bacteria 2010
39 Ga0068867_100355551 3300005459 Bacteria 1223
40 Ga0070684_100643510 3300005535 Bacteria 987
41 Ga0068853_100200978 3300005539 Bacteria 1814
42 Ga0070672_100339268 3300005543 Bacteria 1279
43 Ga0070686_100078908 3300005544 Bacteria 2175
44 Ga0070695_100128273 3300005545 Bacteria 1745
45 Ga0070693_100004472 3300005547 Bacteria 6616
46 Ga0070693_100074280 3300005547 Bacteria 2011
47 Ga0070665_100035295 3300005548 Bacteria 5028
48 Ga0070665_100581787 3300005548 Bacteria 1132
49 Ga0068855_100377288 3300005563 Bacteria 1557
50 Ga0068855_100384170 3300005563 Bacteria 1541
51 Ga0068855_100775763 3300005563 Bacteria 1020
52 Ga0068855_100794292 3300005563 Bacteria 1006
53 Ga0070664_100475498 3300005564 Bacteria 1149
54 Ga0068854_100157210 3300005578 Bacteria 1757
55 Ga0068856_100002291 3300005614 Bacteria 19725
56 Ga0068856_100115553 3300005614 Bacteria 2683
57 Ga0068856_100170507 3300005614 Bacteria 2188
58 Ga0068852_100007270 3300005616 Bacteria 8074
59 Ga0068852_100717122 3300005616 Bacteria 1011
60 Ga0068859_100489770 3300005617 Bacteria 1325
61 Ga0068864_100048912 3300005618 Bacteria 3635
62 Ga0068864_100102296 3300005618 Bacteria 2542
63 Ga0068851_10058592 3300005834 Bacteria 1969
64 Ga0068851_10117190 3300005834 Bacteria 1428
65 Ga0068870_10001062 3300005840 Bacteria 10890
66 Ga0068863_100009444 3300005841 Bacteria 9516
67 Ga0068858_100120669 3300005842 Bacteria 2451
68 Ga0068860_100309214 3300005843 Bacteria 1549
69 Ga0068862_100615874 3300005844 Bacteria 1044
70 Ga0081455_10009507 3300005937 Bacteria 9990
71 Ga0081540_1039772 3300005983 Bacteria 2461
72 Ga0081540_1060877 3300005983 Bacteria 1803
73 Ga0070717_10262545 3300006028 Bacteria 1528
74 Ga0075365_10103051 3300006038 Bacteria 1955
75 Ga0075364_10245264 3300006051 Bacteria 1217
76 Ga0070712_100102425 3300006175 Bacteria 2120
77 Ga0070712_100224177 3300006175 Bacteria 1490
78 Ga0068871_100046169 3300006358 Bacteria 3507
79 Ga0075428_100021064 3300006844 Bacteria 7220
80 Ga0075431_100143037 3300006847 Bacteria 2465
81 Ga0075433_10099266 3300006852 Bacteria 2577
82 Ga0075429_100058392 3300006880 Bacteria 3359
83 Ga0068865_100080728 3300006881 Bacteria 2334
84 Ga0075436_100053593 3300006914 Bacteria 2784
85 Ga0097620_100489766 3300006931 Bacteria 1325
86 Ga0105251_10022921 3300009011 Bacteria 3232
87 Ga0105250_10025842 3300009092 Bacteria 2366
88 Ga0105240_10060684 3300009093 Bacteria 4713
89 Ga0105240_10099468 3300009093 Bacteria 3540
90 Ga0105240_10125148 3300009093 Bacteria 3090
91 Ga0105240_10288193 3300009093 Bacteria 1883
92 Ga0111539_10006087 3300009094 Bacteria 15574
93 Ga0105245_10408067 3300009098 Bacteria 1359
94 Ga0105247_10017085 3300009101 Bacteria 4355
95 Ga0114129_10028367 3300009147 Bacteria 7932
96 Ga0114129_10395760 3300009147 Bacteria 1821
97 Ga0105243_10449114 3300009148 Bacteria 1209
98 Ga0105241_10003556 3300009174 Bacteria 11588
99 Ga0105241_10125533 3300009174 Bacteria 2072
100 Ga0105241_10328279 3300009174 Bacteria 1321
101 Ga0105248_10019115 3300009177 Bacteria 7577
102 Ga0105248_10364139 3300009177 Bacteria 1628
103 Ga0105237_10088021 3300009545 Bacteria 3095
104 Ga0105237_10179746 3300009545 Bacteria 2116
105 Ga0105237_10624023 3300009545 Bacteria 1085
106 Ga0105238_10068617 3300009551 Bacteria 3546
107 Ga0105238_10114222 3300009551 Bacteria 2680
108 Ga0105238_10226923 3300009551 Bacteria 1844
109 Ga0105239_10003669 3300010375 Bacteria 18745
110 Ga0105239_10084198 3300010375 Bacteria 3502
111 Ga0105246_10000494 3300011119 Bacteria 21436
112 Ga0157373_10080073 3300013100 Bacteria 2303
113 Ga0157370_10049769 3300013104 Bacteria 4009
114 Ga0157370_10086154 3300013104 Bacteria 2951
115 Ga0157369_10131685 3300013105 Bacteria 2650
116 Ga0157369_10353429 3300013105 Bacteria 1526
117 Ga0157369_10464052 3300013105 Bacteria 1311
118 Ga0163162_10024221 3300013306 Bacteria 5990
119 Ga0163163_10577170 3300014325 Bacteria 1187
120 Ga0157380_10035671 3300014326 Bacteria 3843
121 Ga0157377_10032647 3300014745 Bacteria 2836
122 Ga0206349_1860881 3300020075 Bacteria 943
123 Ga0206354_10037913 3300020081 Bacteria 1248
124 Ga0154015_1055123 3300020610 Bacteria 1460
125 Ga0213876_10134491 3300021384 Bacteria 1315
126 Ga0207656_10053582 3300025321 Bacteria 1751
127 Ga0207692_10030049 3300025898 Bacteria 2588
128 Ga0207692_10064182 3300025898 Bacteria 1911
129 Ga0207688_10008179 3300025901 Bacteria 5685
130 Ga0207680_10366023 3300025903 Bacteria 1014
131 Ga0207647_10067795 3300025904 Bacteria 2161
132 Ga0207647_10098422 3300025904 Bacteria 1738
133 Ga0207699_10060025 3300025906 Bacteria 2281
134 Ga0207643_10000624 3300025908 Bacteria 22324
135 Ga0207705_10024247 3300025909 Bacteria 4330
136 Ga0207705_10089067 3300025909 Bacteria 2258
137 Ga0207654_10003259 3300025911 Bacteria 8199
138 Ga0207654_10115294 3300025911 Bacteria 1678
139 Ga0207654_10172706 3300025911 Bacteria 1404
140 Ga0207707_10141039 3300025912 Bacteria 2107
141 Ga0207695_10069873 3300025913 Bacteria 3592
142 Ga0207695_10088968 3300025913 Bacteria 3106
143 Ga0207695_10171477 3300025913 Bacteria 2095
144 Ga0207671_10020620 3300025914 Bacteria 5013
145 Ga0207671_10449359 3300025914 Bacteria 1026
146 Ga0207671_10606016 3300025914 Bacteria 873
147 Ga0207693_10010640 3300025915 Bacteria 7464
148 Ga0207693_10187525 3300025915 Bacteria 1628
149 Ga0207662_10136254 3300025918 Bacteria 1552
150 Ga0207650_10010309 3300025925 Bacteria 6405
151 Ga0207664_10000032 3300025929 Bacteria 179232
152 Ga0207664_10123050 3300025929 Bacteria 2174
153 Ga0207644_10004835 3300025931 Bacteria 8768
154 Ga0207690_10035441 3300025932 Bacteria 3223
155 Ga0207709_10078214 3300025935 Bacteria 2123
156 Ga0207704_10174164 3300025938 Bacteria 1547
157 Ga0207691_10017959 3300025940 Bacteria 6701
158 Ga0207689_10002590 3300025942 Bacteria 16736
159 Ga0207661_10004528 3300025944 Bacteria 9737
160 Ga0207661_10313138 3300025944 Bacteria 1409
161 Ga0207679_10005352 3300025945 Bacteria 8046
162 Ga0207667_10067624 3300025949 Bacteria 3721
163 Ga0207667_10562410 3300025949 Bacteria 1153
164 Ga0207667_10710465 3300025949 Bacteria 1007
165 Ga0207651_10323527 3300025960 Bacteria 1290
166 Ga0207712_10117667 3300025961 Bacteria 2005
167 Ga0207668_10001732 3300025972 Bacteria 12780
168 Ga0207640_10106455 3300025981 Bacteria 1978
169 Ga0207703_10453559 3300026035 Bacteria 1198
170 Ga0207639_10054474 3300026041 Bacteria 3057
171 Ga0207678_10001532 3300026067 Bacteria 21216
172 Ga0207678_10022379 3300026067 Bacteria 5536
173 Ga0207678_10261278 3300026067 Bacteria 1484
174 Ga0207708_10011053 3300026075 Bacteria 6712
175 Ga0207702_10006116 3300026078 Bacteria 10431
176 Ga0207702_10012224 3300026078 Bacteria 7143
177 Ga0207702_10083016 3300026078 Bacteria 2787
178 Ga0207702_10193876 3300026078 Bacteria 1879
179 Ga0207641_10015724 3300026088 Bacteria 6200
180 Ga0207648_10080230 3300026089 Bacteria 2847
181 Ga0207676_10005145 3300026095 Bacteria 9259
182 Ga0207674_10823609 3300026116 Bacteria 895
183 Ga0207683_10001254 3300026121 Bacteria 23022
184 Ga0207683_10027374 3300026121 Bacteria 4926
185 Ga0207698_10003983 3300026142 Bacteria 8958
186 Ga0207698_10023379 3300026142 Bacteria 4316
187 Ga0207698_10223881 3300026142 Bacteria 1702
188 Ga0207428_10012770 3300027907 Bacteria 7367
189 Ga0268266_10109209 3300028379 Bacteria 2449
190 Ga0268266_10172954 3300028379 Bacteria 1961
191 Ga0307517_10001976 3300028786 Bacteria 33403
192 Ga0307509_10377440 3300031507 Bacteria 1132
193 Ga0307508_10024673 3300031616 Bacteria 5456
194 Ga0316576_10032152 3300031727 Bacteria 3728
195 Ga0316578_10024465 3300031728 Bacteria 3388
196 Ga0307516_10022807 3300031730 Bacteria 6426
197 Ga0307516_10061620 3300031730 Bacteria 3639
198 Ga0307412_10768931 3300031911 Bacteria 833
199 Ga0307416_100182610 3300032002 Bacteria 1968
200 Ga0373938_0001621 3300034957 Bacteria 3608
201 Ga0373951_0014017 3300035091 Bacteria 1803
202 Ga0316574_0056146 3300035398 Bacteria 2463
203 Ga0316584_0008677 3300036712 Bacteria 7014
204 Ga0436365_0248620 3300039437 Bacteria 1198
205 Ga0436365_0439712 3300039437 Bacteria 1368
206 Ga0451791_0839372 3300041451 Bacteria 1641
207 Ga0451837_0081633 3300041494 Bacteria 2236
208 Ga0451853_2455249 3300041512 Bacteria 2538
209 Ga0439463_020803 3300042016 Bacteria 1638
210 Ga0439459_0021328 3300042438 Bacteria 1243
211 Ga0466972_0058950 3300044658 Bacteria 1843
212 Ga0453683_0190221 3300044673 Unclassified 1302
213 Ga0466965_0113109 3300044683 Bacteria 1396
214 Ga0466966_0001029 3300044684 Bacteria 17838
215 Ga0466966_0064439 3300044684 Bacteria 2307
216 Ga0466966_0089313 3300044684 Bacteria 1914
217 Ga0466966_0096212 3300044684 Bacteria 1834
218 Ga0466966_0135186 3300044684 Bacteria 1508
219 Ga0466966_0181395 3300044684 Bacteria 1277
220 Ga0466961_0029435 3300044693 Bacteria 3530
221 Ga0466961_0068744 3300044693 Bacteria 2249
222 Ga0466961_0157876 3300044693 Bacteria 1414
223 Ga0466963_0011591 3300044694 Bacteria 5367
224 Ga0466963_0028984 3300044694 Bacteria 3559
225 Ga0466963_0032735 3300044694 Bacteria 3368
226 Ga0466963_0050867 3300044694 Bacteria 2744
227 Ga0466963_0259906 3300044694 Bacteria 1219
228 Ga0466963_0285115 3300044694 Bacteria 1161
229 Ga0466964_0079879 3300044706 Bacteria 1402
230 Ga0466971_0011940 3300044719 Bacteria 3805
231 Ga0466971_0048684 3300044719 Bacteria 1906
232 Ga0466971_0083494 3300044719 Bacteria 1458
233 Ga0466970_0005422 3300044765 Bacteria 6329
234 Ga0466970_0013892 3300044765 Bacteria 4130
235 Ga0466970_0019849 3300044765 Bacteria 3488
236 Ga0466957_0017610 3300044842 Bacteria 4188
237 Ga0466957_0123685 3300044842 Bacteria 1651
238 Ga0466960_0007772 3300044901 Bacteria 4370
239 Ga0466960_0012311 3300044901 Bacteria 3606
240 Ga0466959_0028847 3300045049 Bacteria 4112
241 Ga0466959_0058630 3300045049 Bacteria 2804
242 Ga0466959_0116979 3300045049 Bacteria 1898
243 Ga0451576_0000152 3300045051 Bacteria 176305
244 Ga0451576_0000915 3300045051 Bacteria 55897
245 Ga0466958_0005344 3300045836 Bacteria 6899
246 Ga0466958_0025840 3300045836 Bacteria 3465
247 Ga0466958_0113205 3300045836 Bacteria 1695
248 Ga0466958_0171561 3300045836 Bacteria 1373
249 Ga0466967_0000959 3300045976 Bacteria 15629
250 Ga0466967_0011982 3300045976 Bacteria 6606
251 Ga0466967_0032738 3300045976 Bacteria 4394
252 Ga0466967_0095840 3300045976 Bacteria 2705
253 Ga0466967_0147927 3300045976 Bacteria 2192
254 Ga0466967_0315449 3300045976 Bacteria 1507
255 Ga0495592_0012249 3300046454 Bacteria 6509
256 Ga0495603_0003723 3300046455 Bacteria 9072
257 Ga0495603_0003955 3300046455 Bacteria 8827
258 Ga0495603_0053194 3300046455 Bacteria 2403
259 Ga0495629_0004847 3300046459 Bacteria 10089
260 Ga0495629_0029194 3300046459 Bacteria 3912
261 Ga0495629_0267158 3300046459 Bacteria 1175
262 Ga0495638_0005478 3300046460 Bacteria 9437
263 Ga0495638_0074772 3300046460 Bacteria 2066
264 Ga0495651_0154044 3300046462 Bacteria 1653
265 Ga0495664_0009708 3300046477 Bacteria 5391
266 Ga0495594_0003669 3300046499 Bacteria 7886
267 Ga0495594_0031672 3300046499 Bacteria 2868
268 Ga0495594_0117016 3300046499 Bacteria 1505
269 Ga0495607_0186036 3300046501 Bacteria 1038
270 Ga0495606_0004127 3300046507 Bacteria 14749
271 Ga0495628_0004177 3300046516 Bacteria 12849
272 Ga0495643_0006810 3300046522 Bacteria 7469
273 Ga0495652_0008162 3300046529 Bacteria 9574
274 Ga0495640_0006365 3300046533 Bacteria 9345
275 Ga0495667_0055607 3300046559 Bacteria 2603
276 Ga0495668_0000246 3300046616 Bacteria 77015
277 Ga0495634_0012043 3300046642 Bacteria 6270
278 Ga0495611_0150556 3300046648 Bacteria 1086
279 Ga0495625_0000507 3300046660 Bacteria 57816
280 Ga0495657_0010337 3300046675 Bacteria 7026
281 Ga0495658_0063909 3300046683 Bacteria 2119
282 Ga0495613_0016010 3300046689 Bacteria 5582
283 Ga0495613_0048402 3300046689 Bacteria 3139
284 Ga0495670_0001259 3300046691 Bacteria 12383
285 Ga0495589_0050239 3300046794 Bacteria 2063
286 Ga0495600_0039297 3300046809 Bacteria 3081
287 Ga0495660_0023590 3300046810 Bacteria 3509
288 Ga0495604_0007881 3300047317 Bacteria 8435
289 Ga0495676_0003813 3300047321 Bacteria 13705
290 Ga0495676_0004491 3300047321 Bacteria 12747
291 Ga0495676_0023235 3300047321 Bacteria 5384
292 Ga0495685_000133 3300047447 Bacteria 25839
293 Ga0495685_043283 3300047447 Bacteria 1537
294 Ga0495681_0001292 3300047470 Bacteria 18958
295 Ga0495686_0092986 3300047472 Bacteria 1829
296 Ga0495614_0010243 3300048089 Bacteria 4134
297 Ga0495626_0000124 3300048091 Bacteria 99577
298 Ga0496100_0118386 3300048903 Bacteria 1850
299 Ga0496102_0208845 3300048905 Bacteria 1841
300 Ga0496102_0897145 3300048905 Bacteria 808
301 Ga0496104_0010586 3300048907 Bacteria 8238
302 Ga0496104_0055992 3300048907 Bacteria 3728
303 Ga0496105_0016664 3300048908 Bacteria 5869
304 Ga0496105_0021223 3300048908 Bacteria 5254
305 Ga0496106_0010444 3300048909 Bacteria 6857
306 Ga0496106_0093648 3300048909 Bacteria 2322
307 Ga0496107_0143129 3300048910 Bacteria 1767
308 Ga0496108_0013432 3300048911 Bacteria 6679
309 Ga0496108_0014589 3300048911 Bacteria 6413
310 Ga0496108_0202025 3300048911 Bacteria 1725
311 Ga0496109_0030242 3300048912 Bacteria 4854
312 Ga0496109_0102281 3300048912 Bacteria 2659
313 Ga0496109_0226500 3300048912 Bacteria 1758
314 Ga0496110_0010732 3300048913 Bacteria 7461
315 Ga0496110_0019170 3300048913 Bacteria 5752
316 Ga0496111_0008761 3300048914 Bacteria 6715
317 Ga0496112_0068047 3300048915 Bacteria 3516
318 Ga0496112_0196719 3300048915 Bacteria 1976
319 Ga0496113_0002068 3300048916 Bacteria 11541
320 Ga0496113_0005715 3300048916 Bacteria 7790
321 Ga0496113_0014272 3300048916 Bacteria 5415
322 Ga0496113_0403985 3300048916 Bacteria 1097
323 Ga0496114_0223753 3300048917 Bacteria 1652
324 Ga0496115_0041086 3300048918 Bacteria 3678
325 Ga0496115_0166130 3300048918 Bacteria 1825
326 Ga0501032_0470633 3300049569 Bacteria 804
327 Ga0501033_0065681 3300049570 Bacteria 2669
328 Ga0501034_0104256 3300049571 Bacteria 2829
329 Ga0501034_0151906 3300049571 Bacteria 2291
330 Ga0501036_0020930 3300049572 Bacteria 5493
331 Ga0501036_0131025 3300049572 Bacteria 2117
332 Ga0501037_0214922 3300049573 Bacteria 1355
333 Ga0501039_0054400 3300049575 Bacteria 3098
334 Ga0501040_0043731 3300049576 Bacteria 3054
335 Ga0501041_0020947 3300049577 Bacteria 3915
336 Ga0501042_0008284 3300049578 Bacteria 6852
337 Ga0501043_0010768 3300049579 Bacteria 7162
338 Ga0501046_0097723 3300049580 Bacteria 2255
339 Ga0501047_0003619 3300049581 Bacteria 14567
340 Ga0501048_0017764 3300049582 Bacteria 5234
341 Ga0501068_0176566 3300049584 Bacteria 1350
342 Ga0501074_0633096 3300049590 Bacteria 756
343 Ga0501076_0013935 3300049592 Bacteria 6039
344 Ga0501079_0079103 3300049741 Bacteria 2543
345 Ga0501081_0380283 3300049743 Bacteria 1043
346 Ga0501035_0188686 3300049822 Bacteria 1773
347 Ga0501044_0011216 3300049823 Bacteria 9717
348 Ga0501044_0114445 3300049823 Bacteria 2703
349 Ga0501044_0144846 3300049823 Bacteria 2362
350 Ga0501044_0201393 3300049823 Bacteria 1949
351 Ga0501045_0024434 3300049824 Bacteria 4338
352 Ga0501045_0245277 3300049824 Bacteria 1333
353 nmdc:mga05p37_20602_c1 3300050507 Bacteria 7979
354 nmdc:mga05p37_306516_c1 3300050507 Bacteria 1884
355 nmdc:mga09592_13639_c1 3300050508 Bacteria 6641
356 nmdc:mga09592_90730_c1 3300050508 Unclassified 2611
357 nmdc:mga0qj67_39324_c1 3300050509 Bacteria 3714
358 nmdc:mga06r32_122425_c1 3300050510 Bacteria 2567
359 nmdc:mga06r32_493561_c1 3300050510 Bacteria 1202
360 nmdc:mga08y16_45423_c1 3300050511 Bacteria 4603
361 nmdc:mga0n895_30187_c1 3300050512 Bacteria 5178
362 nmdc:mga0rr50_15471_c1 3300050513 Bacteria 5038
363 nmdc:mga08x19_18192_c1 3300050514 Bacteria 4305
364 nmdc:mga0a205_9709_c1 3300050515 Bacteria 8813
365 Ga0500610_0064828 3300053079 Bacteria 1906
366 Ga0495655_0057539 3300053083 Bacteria 1050
367 Ga0500578_0055607 3300053086 Bacteria 2532
368 Ga0500654_020334 3300053099 Bacteria 4256
369 Ga0500660_050846 3300053100 Bacteria 2051
370 Ga0500553_076256 3300053101 Bacteria 1525
371 Ga0500556_0002590 3300053104 Bacteria 5701
372 Ga0500562_004628 3300053108 Bacteria 3474
373 Ga0500652_001401 3300053131 Bacteria 7512
374 Ga0500658_0002151 3300053134 Bacteria 7660
375 Ga0500588_0008346 3300053146 Bacteria 2416
376 Ga0500600_0030231 3300053149 Bacteria 3189
377 Ga0500616_0003280 3300053153 Bacteria 12491
378 Ga0500633_0009353 3300053160 Bacteria 2573
379 Ga0500634_0005645 3300053161 Bacteria 5963
380 Ga0500587_001633 3300053739 Bacteria 3187
381 Ga0501082_0075639 3300060353 Bacteria 2901
382 Ga0466962_0013640 3300061719 Bacteria 3911
383 Ga0466962_0017551 3300061719 Bacteria 3445
384 Ga0466962_0018314 3300061719 Bacteria 3369
385 Ga0466962_0044554 3300061719 Bacteria 2122
386 Ga0530510_0180076 3300061734 Bacteria 1567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0470633 Ga0501032_0470633_95_790 224
2 3300061734 Ga0530510_0180076 Ga0530510_0180076_238_933 224
3 3300049592 Ga0501076_0013935 Ga0501076_0013935_697_1401 227
4 3300049590 Ga0501074_0633096 Ga0501074_0633096_51_743 230
5 3300048912 Ga0496109_0102281 Ga0496109_0102281_339_1106 231
6 3300044694 Ga0466963_0028984 Ga0466963_0028984_2767_3513 233
7 3300044765 Ga0466970_0019849 Ga0466970_0019849_250_1011 235
8 iso_pu_bacteria 2643221548 2643763725 235
9 iso_pu_bacteria 2643221682 2644461840 235
10 iso_pu_bacteria 2643221578 2643903299 237
11 iso_pu_bacteria 2643221673 2644404190 237
12 3300049572 Ga0501036_0131025 Ga0501036_0131025_1130_1888 238
13 3300049573 Ga0501037_0214922 Ga0501037_0214922_559_1317 238
14 3300049575 Ga0501039_0054400 Ga0501039_0054400_433_1191 238
15 3300049576 Ga0501040_0043731 Ga0501040_0043731_2273_3031 238
16 3300049577 Ga0501041_0020947 Ga0501041_0020947_1069_1827 238
17 3300049578 Ga0501042_0008284 Ga0501042_0008284_1500_2258 238
18 3300049582 Ga0501048_0017764 Ga0501048_0017764_80_838 238
19 3300049741 Ga0501079_0079103 Ga0501079_0079103_314_1072 238
20 3300049743 Ga0501081_0380283 Ga0501081_0380283_178_936 238
21 3300049824 Ga0501045_0024434 Ga0501045_0024434_658_1416 238
22 3300060353 Ga0501082_0075639 Ga0501082_0075639_192_950 238
23 iso_pu_bacteria 8001781756 8001787076 238
24 iso_pu_bacteria 2808606372 2808902246 239
25 iso_pu_bacteria 2856741275 2856742398 239
26 iso_pu_bacteria 2891395885 2891401993 239
27 iso_pu_bacteria 2891554331 2891558290 239
28 iso_pu_bacteria 2891562705 2891564560 239
29 iso_pu_bacteria 2935390628 2935391643 239
30 iso_pu_bacteria 2582581312 2585296284 240
31 iso_pu_bacteria 2616644941 2616900231 240
32 iso_pu_bacteria 2875391855 2875396374 240
33 iso_pu_bacteria 2912757875 2912762472 240
34 iso_pu_bacteria 2966598605 2966601142 240
35 iso_pu_bacteria 3006321560 3006323987 240
36 iso_pu_bacteria 8025530807 8025537615 240
37 iso_pu_bacteria 2643221601 2644017438 241
38 iso_pu_bacteria 2643221631 2644173600 241
39 3300031911 Ga0307412_10768931 Ga0307412_107689311 242
40 3300044673 Ga0453683_0190221 Ga0453683_0190221_278_1015 242
41 3300045051 Ga0451576_0000915 Ga0451576_0000915_48382_49119 242
42 3300044694 Ga0466963_0032735 Ga0466963_0032735_92_862 243
43 3300044842 Ga0466957_0123685 Ga0466957_0123685_177_947 243
44 3300045836 Ga0466958_0005344 Ga0466958_0005344_5720_6490 243
45 3300047447 Ga0495685_043283 Ga0495685_043283_424_1170 243
46 3300061719 Ga0466962_0018314 Ga0466962_0018314_1718_2488 243
47 iso_pu_bacteria 2870782633 2870783188 243
48 iso_pu_bacteria 2887478801 2887480769 243
49 iso_pu_bacteria 2946045630 2946048219 243
50 iso_pu_bacteria 3006486233 3006486451 243
51 iso_pu_bacteria 8056447290 8056448192 243
52 3300031730 Ga0307516_10061620 Ga0307516_100616202 244
53 3300041451 Ga0451791_0839372 Ga0451791_0839372_96_836 244
54 3300041494 Ga0451837_0081633 Ga0451837_0081633_606_1346 244
55 3300041512 Ga0451853_2455249 Ga0451853_2455249_1096_1836 244
56 3300046454 Ga0495592_0012249 Ga0495592_0012249_5264_6001 244
57 3300046455 Ga0495603_0003723 Ga0495603_0003723_6846_7583 244
58 3300046455 Ga0495603_0003955 Ga0495603_0003955_3708_4445 244
59 3300046459 Ga0495629_0004847 Ga0495629_0004847_5291_6028 244
60 3300046459 Ga0495629_0029194 Ga0495629_0029194_2371_3108 244
61 3300046459 Ga0495629_0267158 Ga0495629_0267158_191_928 244
62 3300046462 Ga0495651_0154044 Ga0495651_0154044_596_1333 244
63 3300046477 Ga0495664_0009708 Ga0495664_0009708_4371_5108 244
64 3300046499 Ga0495594_0003669 Ga0495594_0003669_5328_6065 244
65 3300046499 Ga0495594_0031672 Ga0495594_0031672_221_958 244
66 3300046499 Ga0495594_0117016 Ga0495594_0117016_192_929 244
67 3300046516 Ga0495628_0004177 Ga0495628_0004177_5245_5982 244
68 3300046529 Ga0495652_0008162 Ga0495652_0008162_3054_3791 244
69 3300046533 Ga0495640_0006365 Ga0495640_0006365_204_941 244
70 3300046559 Ga0495667_0055607 Ga0495667_0055607_331_1068 244
71 3300046642 Ga0495634_0012043 Ga0495634_0012043_3875_4612 244
72 3300046648 Ga0495611_0150556 Ga0495611_0150556_176_913 244
73 3300046675 Ga0495657_0010337 Ga0495657_0010337_3646_4383 244
74 3300046689 Ga0495613_0016010 Ga0495613_0016010_689_1426 244
75 3300046689 Ga0495613_0048402 Ga0495613_0048402_1623_2360 244
76 3300046809 Ga0495600_0039297 Ga0495600_0039297_596_1333 244
77 3300047317 Ga0495604_0007881 Ga0495604_0007881_7020_7757 244
78 3300047321 Ga0495676_0003813 Ga0495676_0003813_6113_6850 244
79 3300047321 Ga0495676_0004491 Ga0495676_0004491_6831_7568 244
80 3300047321 Ga0495676_0023235 Ga0495676_0023235_4370_5107 244
81 3300048089 Ga0495614_0010243 Ga0495614_0010243_1238_1975 244
82 3300048905 Ga0496102_0897145 Ga0496102_0897145_61_798 244
83 3300048909 Ga0496106_0093648 Ga0496106_0093648_1443_2180 244
84 3300028786 Ga0307517_10001976 Ga0307517_1000197614 245
85 3300031616 Ga0307508_10024673 Ga0307508_100246735 245
86 3300031728 Ga0316578_10024465 Ga0316578_100244653 245
87 3300031730 Ga0307516_10022807 Ga0307516_100228074 245
88 3300035398 Ga0316574_0056146 Ga0316574_0056146_1084_1857 245
89 3300036712 Ga0316584_0008677 Ga0316584_0008677_1085_1858 245
90 3300046460 Ga0495638_0074772 Ga0495638_0074772_911_1651 245
91 3300046501 Ga0495607_0186036 Ga0495607_0186036_49_789 245
92 3300046507 Ga0495606_0004127 Ga0495606_0004127_4755_5507 245
93 3300046522 Ga0495643_0006810 Ga0495643_0006810_1760_2500 245
94 3300046616 Ga0495668_0000246 Ga0495668_0000246_30382_31134 245
95 3300046660 Ga0495625_0000507 Ga0495625_0000507_25560_26312 245
96 3300046691 Ga0495670_0001259 Ga0495670_0001259_1699_2439 245
97 3300046794 Ga0495589_0050239 Ga0495589_0050239_471_1211 245
98 3300046810 Ga0495660_0023590 Ga0495660_0023590_1678_2418 245
99 3300047447 Ga0495685_000133 Ga0495685_000133_22117_22857 245
100 3300047470 Ga0495681_0001292 Ga0495681_0001292_15802_16542 245
101 3300047472 Ga0495686_0092986 Ga0495686_0092986_928_1668 245
102 3300048091 Ga0495626_0000124 Ga0495626_0000124_49319_50071 245
103 3300048915 Ga0496112_0196719 Ga0496112_0196719_670_1437 245
104 3300048916 Ga0496113_0002068 Ga0496113_0002068_10627_11394 245
105 3300049570 Ga0501033_0065681 Ga0501033_0065681_557_1303 245
106 3300049571 Ga0501034_0151906 Ga0501034_0151906_783_1529 245
107 3300049580 Ga0501046_0097723 Ga0501046_0097723_772_1518 245
108 3300049822 Ga0501035_0188686 Ga0501035_0188686_300_1046 245
109 3300049823 Ga0501044_0114445 Ga0501044_0114445_1119_1865 245
110 3300053083 Ga0495655_0057539 Ga0495655_0057539_119_859 245
111 3300053086 Ga0500578_0055607 Ga0500578_0055607_903_1643 245
112 3300053099 Ga0500654_020334 Ga0500654_020334_1622_2362 245
113 3300053131 Ga0500652_001401 Ga0500652_001401_2627_3367 245
114 3300053134 Ga0500658_0002151 Ga0500658_0002151_5122_5862 245
115 3300053149 Ga0500600_0030231 Ga0500600_0030231_1718_2458 245
116 3300053153 Ga0500616_0003280 Ga0500616_0003280_3471_4211 245
117 3300053160 Ga0500633_0009353 Ga0500633_0009353_270_1010 245
118 3300053161 Ga0500634_0005645 Ga0500634_0005645_3222_3962 245
119 3300053739 Ga0500587_001633 Ga0500587_001633_41_781 245
120 3300005563 Ga0068855_100384170 Ga0068855_1003841701 246
121 3300025949 Ga0207667_10562410 Ga0207667_105624102 246
122 3300031507 Ga0307509_10377440 Ga0307509_103774401 246
123 3300044694 Ga0466963_0050867 Ga0466963_0050867_1102_1854 246
124 3300044694 Ga0466963_0259906 Ga0466963_0259906_59_847 246
125 3300044842 Ga0466957_0017610 Ga0466957_0017610_849_1637 246
126 3300045976 Ga0466967_0000959 Ga0466967_0000959_683_1435 246
127 3300045976 Ga0466967_0011982 Ga0466967_0011982_4094_4846 246
128 3300046683 Ga0495658_0063909 Ga0495658_0063909_1062_1805 246
129 3300049571 Ga0501034_0104256 Ga0501034_0104256_853_1617 246
130 3300049572 Ga0501036_0020930 Ga0501036_0020930_2144_2908 246
131 3300049579 Ga0501043_0010768 Ga0501043_0010768_767_1531 246
132 3300049581 Ga0501047_0003619 Ga0501047_0003619_12628_13392 246
133 3300049584 Ga0501068_0176566 Ga0501068_0176566_120_884 246
134 3300049823 Ga0501044_0011216 Ga0501044_0011216_7329_8093 246
135 3300049823 Ga0501044_0201393 Ga0501044_0201393_80_859 246
136 3300049824 Ga0501045_0245277 Ga0501045_0245277_409_1173 246
137 3300053100 Ga0500660_050846 Ga0500660_050846_322_1065 246
138 3300053101 Ga0500553_076256 Ga0500553_076256_746_1489 246
139 3300061719 Ga0466962_0017551 Ga0466962_0017551_2448_3236 246
140 3300005288 Ga0065714_10004176 Ga0065714_100041764 247
141 3300006038 Ga0075365_10103051 Ga0075365_101030512 247
142 3300006880 Ga0075429_100058392 Ga0075429_1000583922 247
143 3300009147 Ga0114129_10395760 Ga0114129_103957602 247
144 3300025929 Ga0207664_10000032 Ga0207664_1000003235 247
145 3300032002 Ga0307416_100182610 Ga0307416_1001826102 247
146 3300044684 Ga0466966_0064439 Ga0466966_0064439_655_1413 247
147 3300044684 Ga0466966_0089313 Ga0466966_0089313_764_1522 247
148 3300044693 Ga0466961_0029435 Ga0466961_0029435_974_1732 247
149 3300044719 Ga0466971_0083494 Ga0466971_0083494_250_1008 247
150 3300044765 Ga0466970_0005422 Ga0466970_0005422_5470_6228 247
151 3300045049 Ga0466959_0028847 Ga0466959_0028847_2634_3392 247
152 3300045049 Ga0466959_0058630 Ga0466959_0058630_1259_2017 247
153 3300045051 Ga0451576_0000152 Ga0451576_0000152_123767_124564 247
154 3300045836 Ga0466958_0025840 Ga0466958_0025840_743_1501 247
155 3300050507 nmdc:mga05p37_306516_c1 nmdc:mga05p37_306516_c1_926_1705 247
156 3300050508 nmdc:mga09592_90730_c1 nmdc:mga09592_90730_c1_50_847 247
157 3300053108 Ga0500562_004628 Ga0500562_004628_1212_2042 247
158 3300061719 Ga0466962_0044554 Ga0466962_0044554_1121_1879 247
159 iso_pu_bacteria 2897561785 2897563252 247
160 3300003911 JGI25405J52794_10008275 JGI25405J52794_100082752 248
161 3300005327 Ga0070658_10014025 Ga0070658_100140252 248
162 3300005455 Ga0070663_100235087 Ga0070663_1002350871 248
163 3300005563 Ga0068855_100775763 Ga0068855_1007757631 248
164 3300005563 Ga0068855_100794292 Ga0068855_1007942921 248
165 3300005937 Ga0081455_10009507 Ga0081455_1000950712 248
166 3300009011 Ga0105251_10022921 Ga0105251_100229212 248
167 3300009093 Ga0105240_10099468 Ga0105240_100994686 248
168 3300009093 Ga0105240_10125148 Ga0105240_101251482 248
169 3300009093 Ga0105240_10288193 Ga0105240_102881931 248
170 3300009094 Ga0111539_10006087 Ga0111539_100060875 248
171 3300009098 Ga0105245_10408067 Ga0105245_104080672 248
172 3300009101 Ga0105247_10017085 Ga0105247_100170855 248
173 3300009148 Ga0105243_10449114 Ga0105243_104491141 248
174 3300009174 Ga0105241_10003556 Ga0105241_100035562 248
175 3300009174 Ga0105241_10125533 Ga0105241_101255332 248
176 3300009177 Ga0105248_10364139 Ga0105248_103641392 248
177 3300009545 Ga0105237_10179746 Ga0105237_101797462 248
178 3300009545 Ga0105237_10624023 Ga0105237_106240231 248
179 3300009551 Ga0105238_10114222 Ga0105238_101142222 248
180 3300009551 Ga0105238_10226923 Ga0105238_102269232 248
181 3300010375 Ga0105239_10084198 Ga0105239_100841985 248
182 3300011119 Ga0105246_10000494 Ga0105246_100004949 248
183 3300013100 Ga0157373_10080073 Ga0157373_100800732 248
184 3300013104 Ga0157370_10049769 Ga0157370_100497691 248
185 3300013105 Ga0157369_10464052 Ga0157369_104640522 248
186 3300014325 Ga0163163_10577170 Ga0163163_105771702 248
187 3300014745 Ga0157377_10032647 Ga0157377_100326472 248
188 3300025904 Ga0207647_10067795 Ga0207647_100677952 248
189 3300025909 Ga0207705_10089067 Ga0207705_100890672 248
190 3300025911 Ga0207654_10115294 Ga0207654_101152942 248
191 3300025913 Ga0207695_10088968 Ga0207695_100889682 248
192 3300025913 Ga0207695_10171477 Ga0207695_101714773 248
193 3300025914 Ga0207671_10449359 Ga0207671_104493591 248
194 3300025914 Ga0207671_10606016 Ga0207671_106060161 248
195 3300025949 Ga0207667_10067624 Ga0207667_100676241 248
196 3300025949 Ga0207667_10710465 Ga0207667_107104651 248
197 3300026067 Ga0207678_10261278 Ga0207678_102612781 248
198 3300026142 Ga0207698_10223881 Ga0207698_102238812 248
199 3300042016 Ga0439463_020803 Ga0439463_020803_118_864 248
200 3300042438 Ga0439459_0021328 Ga0439459_0021328_234_980 248
201 3300048905 Ga0496102_0208845 Ga0496102_0208845_170_916 248
202 3300048907 Ga0496104_0010586 Ga0496104_0010586_3837_4583 248
203 3300048908 Ga0496105_0016664 Ga0496105_0016664_50_796 248
204 3300048909 Ga0496106_0010444 Ga0496106_0010444_2074_2820 248
205 3300048911 Ga0496108_0013432 Ga0496108_0013432_3325_4071 248
206 3300048912 Ga0496109_0226500 Ga0496109_0226500_17_763 248
207 3300048913 Ga0496110_0010732 Ga0496110_0010732_3500_4246 248
208 3300048916 Ga0496113_0014272 Ga0496113_0014272_3674_4420 248
209 3300048918 Ga0496115_0166130 Ga0496115_0166130_907_1653 248
210 3300050510 nmdc:mga06r32_493561_c1 nmdc:mga06r32_493561_c1_15_761 248
211 3300050511 nmdc:mga08y16_45423_c1 nmdc:mga08y16_45423_c1_3291_4037 248
212 3300050512 nmdc:mga0n895_30187_c1 nmdc:mga0n895_30187_c1_183_929 248
213 3300050513 nmdc:mga0rr50_15471_c1 nmdc:mga0rr50_15471_c1_4108_4854 248
214 3300050514 nmdc:mga08x19_18192_c1 nmdc:mga08x19_18192_c1_3246_3992 248
215 3300050515 nmdc:mga0a205_9709_c1 nmdc:mga0a205_9709_c1_3586_4332 248
216 3300005335 Ga0070666_10024757 Ga0070666_100247572 249
217 3300005337 Ga0070682_100020278 Ga0070682_1000202782 249
218 3300005340 Ga0070689_100115701 Ga0070689_1001157012 249
219 3300005354 Ga0070675_100218483 Ga0070675_1002184832 249
220 3300005365 Ga0070688_100075475 Ga0070688_1000754752 249
221 3300005437 Ga0070710_10081844 Ga0070710_100818442 249
222 3300005439 Ga0070711_100027769 Ga0070711_1000277696 249
223 3300005440 Ga0070705_100019058 Ga0070705_1000190582 249
224 3300005441 Ga0070700_100058021 Ga0070700_1000580212 249
225 3300005456 Ga0070678_100138108 Ga0070678_1001381082 249
226 3300005459 Ga0068867_100122674 Ga0068867_1001226741 249
227 3300005535 Ga0070684_100643510 Ga0070684_1006435101 249
228 3300005544 Ga0070686_100078908 Ga0070686_1000789082 249
229 3300005547 Ga0070693_100004472 Ga0070693_10000447210 249
230 3300005548 Ga0070665_100035295 Ga0070665_1000352952 249
231 3300005614 Ga0068856_100170507 Ga0068856_1001705072 249
232 3300005618 Ga0068864_100048912 Ga0068864_1000489123 249
233 3300005834 Ga0068851_10117190 Ga0068851_101171902 249
234 3300005842 Ga0068858_100120669 Ga0068858_1001206692 249
235 3300005983 Ga0081540_1060877 Ga0081540_10608772 249
236 3300006175 Ga0070712_100102425 Ga0070712_1001024252 249
237 3300006881 Ga0068865_100080728 Ga0068865_1000807282 249
238 3300009177 Ga0105248_10019115 Ga0105248_100191153 249
239 3300009551 Ga0105238_10068617 Ga0105238_100686172 249
240 3300013104 Ga0157370_10086154 Ga0157370_100861542 249
241 3300013105 Ga0157369_10131685 Ga0157369_101316852 249
242 3300013306 Ga0163162_10024221 Ga0163162_100242213 249
243 3300014326 Ga0157380_10035671 Ga0157380_100356715 249
244 3300021384 Ga0213876_10134491 Ga0213876_101344912 249
245 3300025321 Ga0207656_10053582 Ga0207656_100535822 249
246 3300025898 Ga0207692_10064182 Ga0207692_100641822 249
247 3300025901 Ga0207688_10008179 Ga0207688_100081793 249
248 3300025915 Ga0207693_10010640 Ga0207693_100106406 249
249 3300025935 Ga0207709_10078214 Ga0207709_100782142 249
250 3300025938 Ga0207704_10174164 Ga0207704_101741642 249
251 3300025961 Ga0207712_10117667 Ga0207712_101176672 249
252 3300026041 Ga0207639_10054474 Ga0207639_100544743 249
253 3300026067 Ga0207678_10022379 Ga0207678_100223796 249
254 3300026075 Ga0207708_10011053 Ga0207708_100110532 249
255 3300026078 Ga0207702_10193876 Ga0207702_101938762 249
256 3300026121 Ga0207683_10027374 Ga0207683_100273746 249
257 3300026142 Ga0207698_10023379 Ga0207698_100233795 249
258 3300028379 Ga0268266_10172954 Ga0268266_101729542 249
259 3300031727 Ga0316576_10032152 Ga0316576_100321524 249
260 3300034957 Ga0373938_0001621 Ga0373938_0001621_1471_2241 249
261 3300035091 Ga0373951_0014017 Ga0373951_0014017_873_1643 249
262 3300039437 Ga0436365_0248620 Ga0436365_0248620_187_945 249
263 3300039437 Ga0436365_0439712 Ga0436365_0439712_96_869 249
264 3300044658 Ga0466972_0058950 Ga0466972_0058950_574_1344 249
265 3300044683 Ga0466965_0113109 Ga0466965_0113109_592_1362 249
266 3300044684 Ga0466966_0001029 Ga0466966_0001029_2812_3582 249
267 3300044684 Ga0466966_0096212 Ga0466966_0096212_462_1235 249
268 3300044684 Ga0466966_0135186 Ga0466966_0135186_199_969 249
269 3300044684 Ga0466966_0181395 Ga0466966_0181395_306_1076 249
270 3300044693 Ga0466961_0068744 Ga0466961_0068744_536_1306 249
271 3300044693 Ga0466961_0157876 Ga0466961_0157876_163_933 249
272 3300044694 Ga0466963_0285115 Ga0466963_0285115_263_1036 249
273 3300044706 Ga0466964_0079879 Ga0466964_0079879_451_1236 249
274 3300044719 Ga0466971_0011940 Ga0466971_0011940_569_1339 249
275 3300044719 Ga0466971_0048684 Ga0466971_0048684_777_1550 249
276 3300044765 Ga0466970_0013892 Ga0466970_0013892_2575_3345 249
277 3300044901 Ga0466960_0007772 Ga0466960_0007772_1015_1785 249
278 3300044901 Ga0466960_0012311 Ga0466960_0012311_1995_2765 249
279 3300045049 Ga0466959_0116979 Ga0466959_0116979_490_1260 249
280 3300045836 Ga0466958_0113205 Ga0466958_0113205_791_1561 249
281 3300045836 Ga0466958_0171561 Ga0466958_0171561_35_805 249
282 3300045976 Ga0466967_0032738 Ga0466967_0032738_2301_3071 249
283 3300045976 Ga0466967_0147927 Ga0466967_0147927_697_1467 249
284 3300045976 Ga0466967_0315449 Ga0466967_0315449_143_922 249
285 3300046455 Ga0495603_0053194 Ga0495603_0053194_74_844 249
286 3300048903 Ga0496100_0118386 Ga0496100_0118386_425_1195 249
287 3300048907 Ga0496104_0055992 Ga0496104_0055992_294_1064 249
288 3300048908 Ga0496105_0021223 Ga0496105_0021223_2611_3381 249
289 3300048910 Ga0496107_0143129 Ga0496107_0143129_869_1639 249
290 3300048911 Ga0496108_0014589 Ga0496108_0014589_4283_5053 249
291 3300048911 Ga0496108_0202025 Ga0496108_0202025_686_1483 249
292 3300048912 Ga0496109_0030242 Ga0496109_0030242_2790_3560 249
293 3300048913 Ga0496110_0019170 Ga0496110_0019170_2103_2873 249
294 3300048914 Ga0496111_0008761 Ga0496111_0008761_5151_5921 249
295 3300048915 Ga0496112_0068047 Ga0496112_0068047_2462_3232 249
296 3300048916 Ga0496113_0005715 Ga0496113_0005715_5871_6641 249
297 3300048917 Ga0496114_0223753 Ga0496114_0223753_333_1130 249
298 3300048918 Ga0496115_0041086 Ga0496115_0041086_303_1073 249
299 3300049823 Ga0501044_0144846 Ga0501044_0144846_1289_2059 249
300 3300061719 Ga0466962_0013640 Ga0466962_0013640_2371_3141 249
301 3300005616 Ga0068852_100717122 Ga0068852_1007171221 250
302 3300005983 Ga0081540_1039772 Ga0081540_10397723 250
303 3300009093 Ga0105240_10060684 Ga0105240_100606845 250
304 3300009147 Ga0114129_10028367 Ga0114129_100283672 250
305 3300009174 Ga0105241_10328279 Ga0105241_103282791 250
306 3300009545 Ga0105237_10088021 Ga0105237_100880213 250
307 3300010375 Ga0105239_10003669 Ga0105239_1000366914 250
308 3300048916 Ga0496113_0403985 Ga0496113_0403985_54_905 250
309 3300050507 nmdc:mga05p37_20602_c1 nmdc:mga05p37_20602_c1_280_1032 250
310 3300050508 nmdc:mga09592_13639_c1 nmdc:mga09592_13639_c1_5828_6580 250
311 3300050509 nmdc:mga0qj67_39324_c1 nmdc:mga0qj67_39324_c1_918_1670 250
312 3300050510 nmdc:mga06r32_122425_c1 nmdc:mga06r32_122425_c1_355_1107 250
313 3300005347 Ga0070668_100084706 Ga0070668_1000847061 251
314 3300009092 Ga0105250_10025842 Ga0105250_100258422 251
315 3300025972 Ga0207668_10001732 Ga0207668_1000173218 251
316 3300046460 Ga0495638_0005478 Ga0495638_0005478_3451_4293 251
317 3300053079 Ga0500610_0064828 Ga0500610_0064828_802_1602 251
318 3300053104 Ga0500556_0002590 Ga0500556_0002590_1133_1975 251
319 3300053146 Ga0500588_0008346 Ga0500588_0008346_575_1417 251
320 3300044694 Ga0466963_0011591 Ga0466963_0011591_406_1191 252
321 3300045976 Ga0466967_0095840 Ga0466967_0095840_1459_2244 252
322 iso_pu_bacteria 3006425503 3006429537 252
323 3300001979 JGI24740J21852_10044297 JGI24740J21852_100442972 253
324 3300001989 JGI24739J22299_10023891 JGI24739J22299_100238912 253
325 3300002155 JGI24033J26618_1012113 JGI24033J26618_10121131 253
326 3300002459 JGI24751J29686_10012660 JGI24751J29686_100126602 253
327 3300005328 Ga0070676_10061132 Ga0070676_100611322 253
328 3300005330 Ga0070690_100609674 Ga0070690_1006096741 253
329 3300005334 Ga0068869_100002865 Ga0068869_1000028656 253
330 3300005337 Ga0070682_100012976 Ga0070682_1000129762 253
331 3300005338 Ga0068868_100121332 Ga0068868_1001213322 253
332 3300005339 Ga0070660_100188664 Ga0070660_1001886642 253
333 3300005340 Ga0070689_100085191 Ga0070689_1000851912 253
334 3300005344 Ga0070661_100079476 Ga0070661_1000794761 253
335 3300005347 Ga0070668_100539904 Ga0070668_1005399041 253
336 3300005355 Ga0070671_100098370 Ga0070671_1000983701 253
337 3300005356 Ga0070674_100370681 Ga0070674_1003706812 253
338 3300005364 Ga0070673_100428770 Ga0070673_1004287702 253
339 3300005434 Ga0070709_10011286 Ga0070709_100112866 253
340 3300005436 Ga0070713_100124451 Ga0070713_1001244512 253
341 3300005437 Ga0070710_10040394 Ga0070710_100403942 253
342 3300005455 Ga0070663_100006377 Ga0070663_1000063778 253
343 3300005455 Ga0070663_100263447 Ga0070663_1002634472 253
344 3300005456 Ga0070678_100002160 Ga0070678_10000216011 253
345 3300005459 Ga0068867_100355551 Ga0068867_1003555512 253
346 3300005539 Ga0068853_100200978 Ga0068853_1002009781 253
347 3300005543 Ga0070672_100339268 Ga0070672_1003392681 253
348 3300005545 Ga0070695_100128273 Ga0070695_1001282732 253
349 3300005547 Ga0070693_100074280 Ga0070693_1000742802 253
350 3300005548 Ga0070665_100581787 Ga0070665_1005817871 253
351 3300005563 Ga0068855_100377288 Ga0068855_1003772882 253
352 3300005564 Ga0070664_100475498 Ga0070664_1004754982 253
353 3300005578 Ga0068854_100157210 Ga0068854_1001572102 253
354 3300005614 Ga0068856_100002291 Ga0068856_10000229111 253
355 3300005614 Ga0068856_100115553 Ga0068856_1001155532 253
356 3300005616 Ga0068852_100007270 Ga0068852_1000072702 253
357 3300005617 Ga0068859_100489770 Ga0068859_1004897701 253
358 3300005618 Ga0068864_100102296 Ga0068864_1001022962 253
359 3300005834 Ga0068851_10058592 Ga0068851_100585922 253
360 3300005840 Ga0068870_10001062 Ga0068870_100010622 253
361 3300005841 Ga0068863_100009444 Ga0068863_1000094446 253
362 3300005843 Ga0068860_100309214 Ga0068860_1003092142 253
363 3300005844 Ga0068862_100615874 Ga0068862_1006158741 253
364 3300006028 Ga0070717_10262545 Ga0070717_102625452 253
365 3300006051 Ga0075364_10245264 Ga0075364_102452641 253
366 3300006175 Ga0070712_100224177 Ga0070712_1002241771 253
367 3300006358 Ga0068871_100046169 Ga0068871_1000461692 253
368 3300006844 Ga0075428_100021064 Ga0075428_10002106410 253
369 3300006847 Ga0075431_100143037 Ga0075431_1001430373 253
370 3300006852 Ga0075433_10099266 Ga0075433_100992662 253
371 3300006914 Ga0075436_100053593 Ga0075436_1000535932 253
372 3300006931 Ga0097620_100489766 Ga0097620_1004897661 253
373 3300013105 Ga0157369_10353429 Ga0157369_103534291 253
374 3300020075 Ga0206349_1860881 Ga0206349_18608812 253
375 3300020081 Ga0206354_10037913 Ga0206354_100379132 253
376 3300020610 Ga0154015_1055123 Ga0154015_10551232 253
377 3300025898 Ga0207692_10030049 Ga0207692_100300492 253
378 3300025903 Ga0207680_10366023 Ga0207680_103660231 253
379 3300025904 Ga0207647_10098422 Ga0207647_100984222 253
380 3300025906 Ga0207699_10060025 Ga0207699_100600251 253
381 3300025908 Ga0207643_10000624 Ga0207643_100006246 253
382 3300025909 Ga0207705_10024247 Ga0207705_100242472 253
383 3300025911 Ga0207654_10003259 Ga0207654_100032595 253
384 3300025911 Ga0207654_10172706 Ga0207654_101727061 253
385 3300025912 Ga0207707_10141039 Ga0207707_101410392 253
386 3300025913 Ga0207695_10069873 Ga0207695_100698731 253
387 3300025914 Ga0207671_10020620 Ga0207671_100206207 253
388 3300025915 Ga0207693_10187525 Ga0207693_101875251 253
389 3300025918 Ga0207662_10136254 Ga0207662_101362541 253
390 3300025925 Ga0207650_10010309 Ga0207650_100103097 253
391 3300025929 Ga0207664_10123050 Ga0207664_101230502 253
392 3300025931 Ga0207644_10004835 Ga0207644_100048352 253
393 3300025932 Ga0207690_10035441 Ga0207690_100354412 253
394 3300025940 Ga0207691_10017959 Ga0207691_100179596 253
395 3300025942 Ga0207689_10002590 Ga0207689_1000259018 253
396 3300025944 Ga0207661_10004528 Ga0207661_100045288 253
397 3300025944 Ga0207661_10313138 Ga0207661_103131381 253
398 3300025945 Ga0207679_10005352 Ga0207679_100053525 253
399 3300025960 Ga0207651_10323527 Ga0207651_103235272 253
400 3300025981 Ga0207640_10106455 Ga0207640_101064552 253
401 3300026035 Ga0207703_10453559 Ga0207703_104535591 253
402 3300026067 Ga0207678_10001532 Ga0207678_1000153216 253
403 3300026078 Ga0207702_10006116 Ga0207702_100061162 253
404 3300026078 Ga0207702_10012224 Ga0207702_100122248 253
405 3300026078 Ga0207702_10083016 Ga0207702_100830162 253
406 3300026088 Ga0207641_10015724 Ga0207641_100157242 253
407 3300026089 Ga0207648_10080230 Ga0207648_100802302 253
408 3300026095 Ga0207676_10005145 Ga0207676_100051452 253
409 3300026116 Ga0207674_10823609 Ga0207674_108236091 253
410 3300026121 Ga0207683_10001254 Ga0207683_1000125410 253
411 3300026142 Ga0207698_10003983 Ga0207698_100039835 253
412 3300027907 Ga0207428_10012770 Ga0207428_100127707 253
413 3300028379 Ga0268266_10109209 Ga0268266_101092092 253
414 iso_pu_bacteria 2791355406 2793981274 253
415 iso_pu_bacteria 8047893842 8047896454 253
416 iso_pu_bacteria 8048127548 8048132385 253
417 iso_pu_bacteria 8048356638 8048362481 253
418 iso_pu_bacteria 8048369669 8048373463 253
419 iso_pu_bacteria 8048379754 8048384779 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00480

ROK

ROK family

49

222

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1woq-assembly2.cif.gz_B crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution 0.9671 7 248
1woq-assembly2.cif.gz_B crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. strain km at 1.8 a resolution 0.9295 7 248
5f7r-assembly1.cif.gz_A rok repressor lmo0178 from listeria monocytogenes bound to inducer 0.854 8 249
5nck-assembly1.cif.gz_B the crystal structure of n-acetylmannosamine kinase in fusobacterium nucleatum 0.8529 8 249
3lm2-assembly1.cif.gz_B crystal structure of putative kinase. (17743352) from agrobacterium tumefaciens str. c58 (dupont) at 1.70 a resolution 0.8527 7 243
ID Description Score Start End Superfamily
1woqA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9823 111 248 3.30.420.40
1woqB01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9616 7 110 3.30.420.40
1woqA02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9549 111 248 3.30.420.40
af_P9WIN1_10_122_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9374 1 110 3.30.420.40
af_P9WIN1_10_122_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.905 1 110 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7V9ITG3-F1-model_v4 ROK family protein 0.9991 106 248
AF-A0A350WP05-F1-model_v4 Polyphosphate glucokinase 0.9961 107 247 GO:0016301
AF-A0A7W0W7N7-F1-model_v4 ROK family protein 0.9959 8 245
AF-A0A524MUN7-F1-model_v4 ROK family protein 0.9959 98 244
AF-W5TSA3-F1-model_v4 Polyphosphate glucokinase (EC 2.7.1.63) 0.9947 7 248 GO:0047330

Feature Viewer

pLDDT pTM Quality
93.19 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map