F439604

General Info

Members Datasets Scaffolds Average Seq Length
419 379 838 530

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0106382|Ga0496105_0106382_369_1967
Length 524
Sequence VLAVHDLEIRVGARVLMSEVAFRVSRGDKIGLVGRNGAGKTTLTKVLAGDLLPSAGEVQRGGELGYLPQDPRSGDPEMLARTRILDARGLGTLALGMQEASLQMADDDPDVAAKAMRRYGSLTERFESLGGYAAEAEAASIAHNLSLPDRILDQPLKTLSGGQRRRIELARILFSDADTMILDEPTNHLDADSVVWLREFLKNYKGGLIVISHDVELVGETVNRVFYLDANRQVIDIYNMNWKNYQRQRVADEERRKKERVNVEKKATALQLQAARFGAKAMVARAEKMLSGLDEVRQEDRVAKLRFPKPAPCGKTPLMARGLSKSYGSLEIFTDVDLAIDRGSKVVVLGLNGAGKTTLLRMLAGVDAPDTGTIEPGHGLKIGYYAQEHENLDVSRSVLENMMSAAPDITATDARKVLGSFLFTGDDVLKPAGVLSGGEKTRLSLATLVVSSANMLLLDEPTNNLDPASREEILGALAHYEGAVVLVSHDAGAVEALNPERVLILPDGVEDIWGRDYVDLITLA

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
11 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
12 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
13 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
16 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
17 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
18 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
19 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
20 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
21 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
22 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
23 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
31 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
33 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
34 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
35 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
36 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
37 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
38 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
39 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
40 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
41 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
46 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
49 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
50 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
51 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
52 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
53 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
54 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
55 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
56 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
57 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
61 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
62 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
63 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
64 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
65 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
66 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
67 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
68 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
69 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
70 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
73 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
74 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
75 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
76 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
77 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
78 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
79 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
83 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
84 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
85 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
86 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
87 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
88 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
89 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
90 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
91 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
92 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
93 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
94 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
99 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
103 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
104 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
111 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
112 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
113 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
114 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
116 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
117 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
118 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
119 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
120 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
121 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
122 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
123 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
124 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
125 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
126 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
127 2643221546 Microbacterium sp. Root53 Isolate Unclassified
128 2643221548 Streptomyces sp. Root55 Isolate Unclassified
129 2643221549 Agromyces sp. Root1464 Isolate Unclassified
130 2643221553 Microbacterium sp. Root553 Isolate Unclassified
131 2643221566 Microbacterium sp. Root166 Isolate Unclassified
132 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
133 2643221572 Leifsonia sp. Root60 Isolate Unclassified
134 2643221578 Streptomyces sp. Root63 Isolate Unclassified
135 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
136 2643221597 Microbacterium sp. Root180 Isolate Unclassified
137 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
138 2643221615 Nocardioides sp. Root224 Isolate Unclassified
139 2643221619 Agromyces sp. Root81 Isolate Unclassified
140 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
141 2643221630 Microbacterium sp. Root322 Isolate Unclassified
142 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
143 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
144 2643221647 Streptomyces sp. Root369 Isolate Unclassified
145 2643221649 Leifsonia sp. Root4 Isolate Unclassified
146 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
147 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
148 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
149 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
150 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
151 2643221679 Angustibacter sp. Root456 Isolate Unclassified
152 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
153 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
154 2643221696 Nocardioides sp. Root140 Isolate Unclassified
155 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
156 2643221714 Streptomyces sp. Root264 Isolate Unclassified
157 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
158 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
159 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
160 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
161 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
162 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
163 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
164 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
165 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
166 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
167 2739367653 Kocuria sp. OV113 Isolate Unclassified
168 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
169 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
170 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
171 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
172 2773857759 Microbacterium sp. 1294 Isolate Unclassified
173 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
174 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
175 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
176 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
177 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
178 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
179 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
180 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
181 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
182 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
183 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
184 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
185 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
186 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
187 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
188 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
189 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
190 2808606372 Agromyces sp. 23-23 Isolate Unclassified
191 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
192 2808606448 Streptomyces sp. 193411 Isolate Unclassified
193 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
194 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
195 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
196 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
197 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
198 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
199 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
200 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
201 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
202 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
203 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
204 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
205 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
206 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
207 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
208 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
209 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
210 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
211 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
212 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
213 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
214 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
215 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
216 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
217 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
218 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
219 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
220 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
221 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
222 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
223 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
224 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
225 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
226 2857727296 Kocuria sp. R-72562 Isolate Unclassified
227 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
228 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
229 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
230 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
231 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
232 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
233 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
234 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
235 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
236 2862574272 Streptomyces sp. AcE210 Isolate Nodule
237 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
238 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
239 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
240 2867369537 Streptomyces sp. Z26 Isolate Unclassified
241 2867428634 Streptomyces sp. RP5T Isolate Unclassified
242 2867475112 Streptomyces sp. TM32 Isolate Unclassified
243 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
244 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
245 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
246 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
247 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
248 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
249 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
250 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
251 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
252 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
253 2891562705 Microbispora tritici MT50 Isolate Unclassified
254 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
255 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
256 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
257 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
258 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
259 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
260 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
261 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
262 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
263 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
264 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
265 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
266 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
267 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
268 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
269 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
270 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
271 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
272 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
273 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
274 2919069694 Microbacterium sp. 1154 Isolate Unclassified
275 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
276 2919395869 Microbacterium resistens 2980 Isolate Unclassified
277 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
278 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
279 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
280 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
281 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
282 2920879853 Kocuria salina CV6 Isolate Unclassified
283 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
284 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
285 2928153084 Leifsonia sp. 563 Isolate Unclassified
286 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
287 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
288 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
289 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
290 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
291 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
292 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
293 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
294 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
295 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
296 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
297 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
298 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
299 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
300 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
301 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
302 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
303 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
304 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
305 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
306 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
307 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
308 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
309 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
310 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
311 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
312 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
313 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
314 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
315 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
316 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
317 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
318 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
319 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
320 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
321 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
322 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
323 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
324 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
325 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
326 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
327 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
328 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
329 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
330 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
331 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
332 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
333 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
334 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
335 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
336 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
337 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
338 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
339 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
340 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
341 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
342 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
343 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
344 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
345 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
346 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
347 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
348 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
349 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
350 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
351 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
352 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
353 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
354 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
355 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
356 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
357 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
358 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
359 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
360 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
361 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
362 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
363 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
364 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
365 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
366 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
367 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
368 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
369 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
370 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
371 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
372 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
373 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
374 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
375 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
376 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
377 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
378 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
379 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 36.04
Metatranscriptomes 0.95
Isolates 63.01

Biome Distribution

Category Percentage (%)
Aerial Root 0.95
Bulb 0
Endosphere 2.39
Nodule 0.95
Rhizoplane 3.82
Rhizosphere 58.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0106382 3300048908 Bacteria 2316
2 Ga0070658_10127583 3300005327 Bacteria 2118
3 Ga0070683_100022358 3300005329 Bacteria 5651
4 Ga0070680_100002813 3300005336 Bacteria 12926
5 Ga0070674_100109138 3300005356 Bacteria 2029
6 Ga0070681_10000019 3300005458 Bacteria 124774
7 Ga0070679_100000124 3300005530 Bacteria 61752
8 Ga0070665_100002138 3300005548 Bacteria 22051
9 Ga0075365_10002589 3300006038 Bacteria 8945
10 Ga0075364_10001422 3300006051 Bacteria 12979
11 Ga0075432_10002903 3300006058 Bacteria 5763
12 Ga0075369_10001879 3300006186 Bacteria 7344
13 Ga0105244_10004227 3300009036 Bacteria 9982
14 Ga0105244_10026381 3300009036 Bacteria 3145
15 Ga0105243_10045626 3300009148 Bacteria 3445
16 Ga0105238_10154763 3300009551 Bacteria 2268
17 Ga0157373_10005927 3300013100 Bacteria 9146
18 Ga0157369_10141128 3300013105 Bacteria 2549
19 Ga0163163_10169357 3300014325 Bacteria 2230
20 Ga0207425_1002927 3300025245 Bacteria 5718
21 Ga0209129_1000067 3300025258 Bacteria 219974
22 Ga0209025_1001395 3300025294 Bacteria 32161
23 Ga0209051_1005933 3300025303 Bacteria 7009
24 Ga0207655_1005476 3300025728 Bacteria 8617
25 Ga0207655_1017639 3300025728 Bacteria 3839
26 Ga0207707_10000046 3300025912 Bacteria 119404
27 Ga0207660_10002591 3300025917 Bacteria 11856
28 Ga0207657_10080888 3300025919 Bacteria 2730
29 Ga0207652_10000476 3300025921 Bacteria 41111
30 Ga0207691_10001023 3300025940 Bacteria 27673
31 Ga0207661_10010182 3300025944 Bacteria 6761
32 Ga0207428_10074844 3300027907 Bacteria 2655
33 Ga0268266_10001498 3300028379 Bacteria 27603
34 Ga0265340_10015682 3300031247 Bacteria 3934
35 Ga0307408_100001200 3300031548 Bacteria 19575
36 Ga0307408_100019381 3300031548 Bacteria 4580
37 Ga0307408_100020533 3300031548 Bacteria 4461
38 Ga0307408_100021353 3300031548 Bacteria 4381
39 Ga0307405_10070634 3300031731 Bacteria 2243
40 Ga0307410_10044842 3300031852 Bacteria 2940
41 Ga0307407_10039497 3300031903 Bacteria 2625
42 Ga0307412_10002167 3300031911 Bacteria 10899
43 Ga0307412_10024609 3300031911 Bacteria 3718
44 Ga0307409_100010515 3300031995 Bacteria 5760
45 Ga0307416_100064992 3300032002 Bacteria 2995
46 Ga0307416_100071057 3300032002 Bacteria 2889
47 Ga0307416_100072550 3300032002 Bacteria 2866
48 Ga0307411_10028616 3300032005 Bacteria 3391
49 Ga0307411_10118529 3300032005 Bacteria 1910
50 Ga0307415_100055774 3300032126 Bacteria 2706
51 Ga0395900_0038045 3300037418 Bacteria 4960
52 Ga0395900_0188935 3300037418 Bacteria 2090
53 Ga0395898_0002818 3300037466 Bacteria 19939
54 Ga0395898_0013997 3300037466 Bacteria 8244
55 Ga0395898_0035472 3300037466 Bacteria 4958
56 Ga0395898_0105824 3300037466 Bacteria 2698
57 Ga0395901_0002057 3300038443 Bacteria 20633
58 Ga0395901_0017899 3300038443 Bacteria 7232
59 Ga0395901_0059164 3300038443 Bacteria 3986
60 Ga0395901_0114072 3300038443 Bacteria 2838
61 Ga0439436_0005502 3300041404 Bacteria 3878
62 Ga0439438_007334 3300041405 Bacteria 3778
63 Ga0439439_0001014 3300041406 Bacteria 5283
64 Ga0439461_0001064 3300041410 Bacteria 4142
65 Ga0439466_0000908 3300041411 Bacteria 11277
66 Ga0439466_0017039 3300041411 Bacteria 2619
67 Ga0439433_0002196 3300041999 Bacteria 4115
68 Ga0439442_000244 3300042002 Bacteria 13232
69 Ga0439449_0008345 3300042007 Bacteria 3939
70 Ga0439449_0010260 3300042007 Bacteria 3538
71 Ga0439452_001752 3300042010 Bacteria 8499
72 Ga0439462_0000542 3300042015 Bacteria 7467
73 Ga0450919_000580 3300042121 Bacteria 4614
74 Ga0450908_000769 3300042184 Bacteria 6137
75 Ga0439434_0000600 3300042435 Bacteria 10371
76 Ga0466966_0036626 3300044684 Bacteria 3167
77 Ga0466961_0023072 3300044693 Bacteria 4001
78 Ga0466971_0008815 3300044719 Bacteria 4403
79 Ga0466960_0020826 3300044901 Bacteria 2912
80 Ga0466959_0003490 3300045049 Bacteria 10301
81 Ga0466959_0080865 3300045049 Bacteria 2342
82 Ga0466958_0085005 3300045836 Bacteria 1951
83 Ga0466967_0119562 3300045976 Bacteria 2432
84 Ga0495653_0133209 3300046463 Bacteria 1756
85 Ga0495580_0004371 3300046472 Bacteria 11866
86 Ga0495643_0057367 3300046522 Bacteria 2075
87 Ga0495665_0000709 3300046531 Bacteria 17165
88 Ga0495665_0012359 3300046531 Bacteria 4618
89 Ga0495586_0003928 3300046535 Bacteria 7975
90 Ga0495645_0012546 3300046543 Bacteria 5973
91 Ga0495667_0025156 3300046559 Bacteria 4013
92 Ga0495667_0048216 3300046559 Bacteria 2813
93 Ga0495659_0005834 3300046664 Bacteria 3886
94 Ga0495661_0072320 3300046665 Bacteria 2012
95 Ga0495588_0001605 3300046674 Bacteria 9662
96 Ga0495588_0038853 3300046674 Bacteria 2422
97 Ga0495588_0045063 3300046674 Bacteria 2260
98 Ga0495670_0006377 3300046691 Bacteria 5795
99 Ga0495581_0055733 3300047315 Bacteria 2281
100 Ga0495636_0009199 3300047318 Bacteria 3887
101 Ga0495675_0019304 3300047444 Bacteria 4330
102 Ga0496100_0058172 3300048903 Bacteria 2535
103 Ga0496103_0007486 3300048906 Bacteria 6506
104 Ga0496103_0032157 3300048906 Bacteria 3201
105 Ga0496103_0043832 3300048906 Bacteria 2755
106 Ga0496104_0159560 3300048907 Bacteria 2163
107 Ga0496105_0011201 3300048908 Bacteria 7075
108 Ga0496106_0006850 3300048909 Bacteria 8435
109 Ga0496108_0102190 3300048911 Bacteria 2446
110 Ga0496109_0093099 3300048912 Bacteria 2788
111 Ga0496109_0155894 3300048912 Bacteria 2139
112 Ga0496109_0167947 3300048912 Bacteria 2058
113 Ga0496112_0021629 3300048915 Bacteria 6118
114 Ga0496114_0009853 3300048917 Bacteria 7594
115 Ga0496114_0100591 3300048917 Bacteria 2467
116 Ga0496116_0046614 3300048919 Bacteria 2924
117 Ga0496117_0000471 3300048920 Bacteria 66939
118 Ga0496118_0009232 3300048921 Bacteria 10016
119 Ga0496119_0002384 3300048922 Bacteria 20644
120 Ga0496119_0053568 3300048922 Bacteria 2463
121 Ga0496120_0001691 3300048923 Bacteria 25302
122 Ga0496120_0007571 3300048923 Bacteria 8056
123 Ga0496122_0000054 3300048925 Bacteria 259135
124 Ga0496122_0053861 3300048925 Bacteria 3027
125 Ga0496122_0068398 3300048925 Bacteria 2550
126 Ga0496123_0000039 3300048926 Bacteria 259107
127 Ga0496123_0003381 3300048926 Bacteria 18020
128 Ga0496124_0002245 3300048927 Bacteria 25691
129 Ga0496124_0016450 3300048927 Bacteria 7028
130 Ga0496124_0090371 3300048927 Bacteria 2498
131 Ga0496126_0003610 3300048929 Bacteria 19352
132 Ga0496126_0009632 3300048929 Bacteria 10240
133 Ga0501305_003597 3300049161 Bacteria 1766
134 Ga0501323_001480 3300049539 Bacteria 2097
135 Ga0501032_0002322 3300049569 Bacteria 14909
136 Ga0501032_0017949 3300049569 Bacteria 4963
137 Ga0501034_0000016 3300049571 Bacteria 289751
138 Ga0501037_0038366 3300049573 Bacteria 3529
139 Ga0501043_0033374 3300049579 Bacteria 4050
140 Ga0501043_0159909 3300049579 Bacteria 1760
141 Ga0501067_0001069 3300049583 Bacteria 14772
142 Ga0501070_0010595 3300049586 Bacteria 7792
143 Ga0501071_0000571 3300049587 Bacteria 19061
144 Ga0501072_0060058 3300049588 Bacteria 2998
145 Ga0501073_0067843 3300049589 Bacteria 2486
146 Ga0501080_0008109 3300049742 Bacteria 9518
147 Ga0501083_0007648 3300049744 Bacteria 7660
148 Ga0501044_0051899 3300049823 Bacteria 4228
149 Ga0501044_0070769 3300049823 Bacteria 3548
150 nmdc:mga0sz30_15552_c1 3300050516 Bacteria 3008
151 Ga0500641_0001334 3300053096 Bacteria 8775
152 Ga0500559_0000295 3300053136 Bacteria 38451
153 Ga0587091_002228 3300059511 Bacteria 2267
154 Ga0587101_001251 3300059623 Bacteria 2135
155 Ga0466962_0050000 3300061719 Bacteria 1998
156 2515850608 2515154155 Bacteria 7985436
157 2537897862 2537561592 Bacteria 4348607
158 2547411062 2547132111 Bacteria 8013147
159 2555229798 2554235227 Bacteria 3637389
160 2585307496 2582581313 Bacteria 10042643
161 2585317657 2582581314 Bacteria 11452267
162 2587862771 2585428094 Bacteria 3604039
163 2588108315 2585428157 Bacteria 3018951
164 2616693933 2616644814 Bacteria 11555299
165 2616899161 2616644941 Bacteria 8510691
166 2643733540 2643221542 Bacteria 3563959
167 2643752697 2643221546 Bacteria 2910897
168 2643762600 2643221548 Bacteria 8053412
169 2643767663 2643221549 Bacteria 4042819
170 2643785966 2643221553 Bacteria 3544260
171 2643848486 2643221566 Bacteria 3460379
172 2643849797 2643221567 Bacteria 4163945
173 2643875268 2643221572 Bacteria 3614809
174 2643897101 2643221578 Bacteria 9213798
175 2643945434 2643221587 Bacteria 7586415
176 2643995949 2643221597 Bacteria 3347721
177 2644018012 2643221601 Bacteria 7493239
178 2644089029 2643221615 Bacteria 5487866
179 2644111023 2643221619 Bacteria 4158469
180 2644135799 2643221624 Bacteria 4384879
181 2644170115 2643221630 Bacteria 3601215
182 2644180699 2643221631 Bacteria 8168043
183 2644199317 2643221635 Bacteria 2632343
184 2644270758 2643221647 Bacteria 10741251
185 2644279658 2643221649 Bacteria 3867359
186 2644318874 2643221657 Bacteria 5490246
187 2644382324 2643221669 Bacteria 3611286
188 2644408245 2643221673 Bacteria 9196637
189 2644432333 2643221677 Bacteria 7584031
190 2644435444 2643221678 Bacteria 9540101
191 2644445094 2643221679 Bacteria 3839507
192 2644457255 2643221681 Bacteria 3707866
193 2644460920 2643221682 Bacteria 6743283
194 2644532026 2643221696 Bacteria 5431823
195 2644537654 2643221697 Bacteria 3575694
196 2644630547 2643221714 Bacteria 9015452
197 2644680381 2643221724 Bacteria 3593515
198 2645719538 2643221961 Bacteria 3919167
199 2645726442 2643221962 Bacteria 3874254
200 2655032495 2654587600 Bacteria 3911798
201 2676475179 2675903058 Bacteria 6822861
202 2676493237 2675903060 Bacteria 10051191
203 2691513854 2690315906 Bacteria 4517044
204 2723642078 2721755702 Bacteria 4373124
205 2729905019 2728369276 Bacteria 5610032
206 2730229834 2728369380 Bacteria 3620317
207 2739602358 2739367653 Bacteria 2780952
208 2747952051 2747842429 Bacteria 3914386
209 2758226323 2757320536 Bacteria 3629334
210 2768646698 2767802112 Bacteria 6465194
211 2774380713 2773857758 Bacteria 3592392
212 2774384663 2773857759 Bacteria 2963774
213 2774399750 2773857763 Bacteria 4180068
214 2775656917 2775506735 Bacteria 4556596
215 2784472247 2784132109 Bacteria 3141763
216 2784587094 2784132148 Bacteria 8627943
217 2785345310 2784746763 Bacteria 9783172
218 2785367580 2784746768 Bacteria 10036182
219 2786668640 2786546132 Bacteria 10419719
220 2804844168 2802429296 Bacteria 7227771
221 2808631381 2808606306 Bacteria 3608896
222 2808831120 2808606357 Bacteria 4466944
223 2808848065 2808606359 Bacteria 9866990
224 2808852385 2808606360 Bacteria 4404006
225 2808874359 2808606365 Bacteria 4301966
226 2808879323 2808606366 Bacteria 4415912
227 2808885464 2808606368 Bacteria 3174172
228 2808891176 2808606370 Bacteria 4942454
229 2808896431 2808606371 Bacteria 4251511
230 2808902114 2808606372 Bacteria 4649509
231 2809227224 2808606447 Bacteria 3572005
232 2809230658 2808606448 Bacteria 8656184
233 2810363746 2808606700 Bacteria 3482157
234 2811847342 2808606982 Bacteria 7791042
235 2812321184 2811994871 Bacteria 4497550
236 2812322916 2811994872 Bacteria 4121241
237 2812351913 2811994878 Bacteria 5992952
238 2812359933 2811994879 Bacteria 9313447
239 2812375027 2811994882 Bacteria 4688362
240 2812482002 2811994917 Bacteria 7761064
241 2817509139 2816332305 Bacteria 2697803
242 2819427767 2818991318 Bacteria 5266538
243 2819666630 2818991458 Bacteria 4794049
244 2819691781 2818991462 Bacteria 4320267
245 2819694404 2818991463 Bacteria 7948711
246 2819729445 2818991469 Bacteria 4644110
247 2819740003 2818991472 Bacteria 10089953
248 2821269820 2821268502 Bacteria 3750023
249 2827629888 2827628540 Bacteria 6858585
250 2833710744 2833709550 Bacteria 4008291
251 2837269669 2837268691 Bacteria 7850704
252 2844842511 2844841374 Bacteria 3917147
253 2844852714 2844849076 Bacteria 4091819
254 2844855455 2844852863 Bacteria 3849151
255 2848552351 2848551377 Bacteria 3720646
256 2852633395 2852632344 Bacteria 3463163
257 2852638096 2852635781 Bacteria 8251373
258 2852645426 2852643534 Bacteria 3013378
259 2852647460 2852646457 Bacteria 3408613
260 2852665386 2852663356 Bacteria 4090475
261 2852679433 2852677369 Bacteria 3768884
262 2856744661 2856741275 Bacteria 8096094
263 2857484049 2857481737 Bacteria 4761446
264 2857721644 2857720070 Bacteria 3189373
265 2857724010 2857723135 Bacteria 4217853
266 2857728968 2857727296 Bacteria 2745552
267 2857732571 2857729791 Bacteria 4040535
268 2857735626 2857733635 Bacteria 3532004
269 2857737399 2857737099 Bacteria 3104305
270 2857742126 2857740372 Bacteria 4782044
271 2862183229 2862178590 Bacteria 8583590
272 2862289062 2862281513 Bacteria 9621493
273 2862293123 2862290372 Bacteria 7471434
274 2862390164 2862382967 Bacteria 10317375
275 2862508492 2862507626 Bacteria 9425308
276 2862583284 2862574272 Bacteria 10567477
277 2862708347 2862705112 Bacteria 6563286
278 2862996266 2862993130 Bacteria 3860849
279 2863406557 2863404153 Bacteria 9672205
280 2867370362 2867369537 Bacteria 6501581
281 2867438040 2867428634 Bacteria 9590268
282 2867476995 2867475112 Bacteria 6909112
283 2870630148 2870628048 Bacteria 3696012
284 2873157303 2873151551 Bacteria 8625867
285 2873319468 2873314349 Bacteria 8512634
286 2875393055 2875391855 Bacteria 7600475
287 2877682968 2877676314 Bacteria 9512378
288 2883825451 2883821847 Bacteria 5121194
289 2884700524 2884693830 Bacteria 11273186
290 2887444026 2887443736 Bacteria 4426037
291 2891400631 2891395885 Bacteria 9251614
292 2891562319 2891554331 Bacteria 8812224
293 2891565602 2891562705 Bacteria 8039471
294 2893684539 2893684298 Bacteria 2897960
295 2895450256 2895442618 Bacteria 11027144
296 2895661351 2895660088 Bacteria 3782833
297 2897563429 2897561785 Bacteria 3256946
298 2904432652 2904430863 Bacteria 3486923
299 2904498237 2904497146 Bacteria 4731781
300 2904512862 2904509784 Bacteria 3520416
301 2904777599 2904776348 Bacteria 4658726
302 2905930899 2905926851 Bacteria 4423176
303 2906800383 2906799679 Bacteria 4031749
304 2908675724 2908674828 Bacteria 3382763
305 2908681139 2908678064 Bacteria 3482747
306 2912721982 2912715099 Bacteria 9460473
307 2912725750 2912723979 Bacteria 8557534
308 2912759233 2912757875 Bacteria 7940295
309 2918502918 2918501144 Bacteria 8668083
310 2919034969 2919034639 Bacteria 4763403
311 2919051453 2919051321 Bacteria 4210889
312 2919058196 2919055335 Bacteria 3875751
313 2919059796 2919059106 Bacteria 4991624
314 2919072983 2919069694 Bacteria 3622919
315 2919394776 2919391150 Bacteria 4884741
316 2919398755 2919395869 Bacteria 3704152
317 2919446167 2919443155 Bacteria 4072969
318 2919450470 2919446982 Bacteria 3994487
319 2919475074 2919468124 Bacteria 9133025
320 2919524570 2919523602 Bacteria 3788128
321 2919540429 2919538618 Bacteria 4677069
322 2920882606 2920879853 Bacteria 4216831
323 2928092291 2928090899 Bacteria 3158267
324 2928122913 2928121344 Bacteria 3972376
325 2928156507 2928153084 Bacteria 4020257
326 2932428283 2932426870 Bacteria 4547726
327 2933421122 2933418574 Bacteria 4476724
328 2935394392 2935390628 Bacteria 7043367
329 2935411428 2935409751 Bacteria 4179611
330 2939601319 2939598168 Bacteria 4687164
331 2939648691 2939647034 Bacteria 4681660
332 2939675260 2939674588 Bacteria 4844420
333 2945918942 2945916053 Bacteria 4555517
334 2945920696 2945920336 Bacteria 4501603
335 2945943118 2945941187 Bacteria 4682474
336 2945959138 2945956166 Bacteria 5110334
337 2945971974 2945968032 Bacteria 4111363
338 2946004412 2946003308 Bacteria 3857229
339 2946033648 2946033335 Bacteria 3835514
340 2946039011 2946037020 Bacteria 4900426
341 2946044345 2946041624 Bacteria 4191385
342 2946051644 2946045630 Bacteria 8527308
343 2946062792 2946059875 Bacteria 4386623
344 2946065972 2946064051 Bacteria 8957905
345 2946074296 2946072368 Bacteria 8999607
346 2946080808 2946080515 Bacteria 4310960
347 2947231432 2947224130 Bacteria 9938529
348 2954000419 2953998280 Bacteria 4812144
349 2954004687 2954002825 Bacteria 9173742
350 2954388185 2954380949 Bacteria 10050426
351 2954674918 2954673503 Bacteria 9685905
352 2954689217 2954682443 Bacteria 9862841
353 2954698990 2954691527 Bacteria 10720516
354 2954703231 2954701450 Bacteria 10834262
355 2954717944 2954711539 Bacteria 10867210
356 2954727910 2954721474 Bacteria 10456478
357 2954733894 2954731030 Bacteria 10243860
358 2954746808 2954740390 Bacteria 10229294
359 2954752777 2954749733 Bacteria 10366972
360 2954765923 2954759201 Bacteria 9358192
361 2964329676 2964326757 Bacteria 3290868
362 2966604008 2966598605 Bacteria 7676064
363 2966924810 2966924647 Bacteria 3268643
364 2974296957 2974294766 Bacteria 3767688
365 2974306935 2974302888 Bacteria 4369871
366 2974326810 2974324384 Bacteria 3750535
367 2977231146 2977228692 Bacteria 3450105
368 2977239938 2977236895 Bacteria 3569373
369 2977253754 2977251589 Bacteria 2952848
370 2977266395 2977264416 Bacteria 3750737
371 2984545790 2984542743 Bacteria 3569378
372 2984554284 2984551494 Bacteria 3877562
373 2984580933 2984580707 Bacteria 3351387
374 2984594724 2984592036 Bacteria 3670284
375 2990044626 2990044586 Bacteria 6603797
376 2990066185 2990059506 Bacteria 9321252
377 2990092317 2990088156 Bacteria 6657676
378 2995465000 2995463766 Bacteria 8577691
379 2995728105 2995726249 Bacteria 3470435
380 2997458802 2997451912 Bacteria 8492419
381 2997606840 2997600082 Bacteria 9896405
382 3006323203 3006321560 Bacteria 8247479
383 3006426337 3006425503 Bacteria 6491253
384 3006486374 3006486233 Bacteria 8157040
385 3006496632 3006493962 Bacteria 8825450
386 8002812576 8002811521 Bacteria 2942897
387 8004022751 8004021418 Bacteria 4313954
388 8004029427 8004025490 Bacteria 4327753
389 8004185044 8004182704 Bacteria 3391155
390 8004214108 8004212874 Bacteria 2861420
391 8008489252 8008485437 Bacteria 7198341
392 8008561750 8008558824 Bacteria 10610750
393 8008580382 8008574985 Bacteria 7815457
394 8016257758 8016254467 Bacteria 3797036
395 8023625062 8023623736 Bacteria 8593882
396 8025418857 8025413630 Bacteria 7014048
397 8025527583 8025524527 Bacteria 7197316
398 8025535766 8025530807 Bacteria 8495698
399 8033690061 8033684223 Bacteria 6906479
400 8045830973 8045830549 Bacteria 4444727
401 8047899864 8047893842 Bacteria 11723082
402 8048130997 8048127548 Bacteria 11053136
403 8048359066 8048356638 Bacteria 11044339
404 8048376812 8048369669 Bacteria 11666822
405 8048385865 8048379754 Bacteria 11877923
406 8048411599 8048406513 Bacteria 8936924
407 8053953936 8053945823 Bacteria 8962862
408 8054110178 8054107350 Bacteria 5022511
409 8054163431 8054160619 Bacteria 7783213
410 8054612935 8054609563 Bacteria 5170090
411 8055035886 8055034563 Bacteria 3562128
412 8055038558 8055037949 Bacteria 3337834
413 8055073331 8055066027 Bacteria 9479577
414 8055174576 8055172936 Bacteria 9305943
415 8056037553 8056037122 Bacteria 3854319
416 8056451657 8056447290 Bacteria 7680491
417 8056667566 8056667051 Bacteria 6953971
418 8056833001 8056829672 Bacteria 9045328
419 8057348683 8057345674 Bacteria 4160394
420 Ga0496105_0106382
421 Ga0070658_10127583
422 Ga0070683_100022358
423 Ga0070680_100002813
424 Ga0070674_100109138
425 Ga0070681_10000019
426 Ga0070679_100000124
427 Ga0070665_100002138
428 Ga0075365_10002589
429 Ga0075364_10001422
430 Ga0075432_10002903
431 Ga0075369_10001879
432 Ga0105244_10004227
433 Ga0105244_10026381
434 Ga0105243_10045626
435 Ga0105238_10154763
436 Ga0157373_10005927
437 Ga0157369_10141128
438 Ga0163163_10169357
439 Ga0207425_1002927
440 Ga0209129_1000067
441 Ga0209025_1001395
442 Ga0209051_1005933
443 Ga0207655_1005476
444 Ga0207655_1017639
445 Ga0207707_10000046
446 Ga0207660_10002591
447 Ga0207657_10080888
448 Ga0207652_10000476
449 Ga0207691_10001023
450 Ga0207661_10010182
451 Ga0207428_10074844
452 Ga0268266_10001498
453 Ga0265340_10015682
454 Ga0307408_100001200
455 Ga0307408_100019381
456 Ga0307408_100020533
457 Ga0307408_100021353
458 Ga0307405_10070634
459 Ga0307410_10044842
460 Ga0307407_10039497
461 Ga0307412_10002167
462 Ga0307412_10024609
463 Ga0307409_100010515
464 Ga0307416_100064992
465 Ga0307416_100071057
466 Ga0307416_100072550
467 Ga0307411_10028616
468 Ga0307411_10118529
469 Ga0307415_100055774
470 Ga0395900_0038045
471 Ga0395900_0188935
472 Ga0395898_0002818
473 Ga0395898_0013997
474 Ga0395898_0035472
475 Ga0395898_0105824
476 Ga0395901_0002057
477 Ga0395901_0017899
478 Ga0395901_0059164
479 Ga0395901_0114072
480 Ga0439436_0005502
481 Ga0439438_007334
482 Ga0439439_0001014
483 Ga0439461_0001064
484 Ga0439466_0000908
485 Ga0439466_0017039
486 Ga0439433_0002196
487 Ga0439442_000244
488 Ga0439449_0008345
489 Ga0439449_0010260
490 Ga0439452_001752
491 Ga0439462_0000542
492 Ga0450919_000580
493 Ga0450908_000769
494 Ga0439434_0000600
495 Ga0466966_0036626
496 Ga0466961_0023072
497 Ga0466971_0008815
498 Ga0466960_0020826
499 Ga0466959_0003490
500 Ga0466959_0080865
501 Ga0466958_0085005
502 Ga0466967_0119562
503 Ga0495653_0133209
504 Ga0495580_0004371
505 Ga0495643_0057367
506 Ga0495665_0000709
507 Ga0495665_0012359
508 Ga0495586_0003928
509 Ga0495645_0012546
510 Ga0495667_0025156
511 Ga0495667_0048216
512 Ga0495659_0005834
513 Ga0495661_0072320
514 Ga0495588_0001605
515 Ga0495588_0038853
516 Ga0495588_0045063
517 Ga0495670_0006377
518 Ga0495581_0055733
519 Ga0495636_0009199
520 Ga0495675_0019304
521 Ga0496100_0058172
522 Ga0496103_0007486
523 Ga0496103_0032157
524 Ga0496103_0043832
525 Ga0496104_0159560
526 Ga0496105_0011201
527 Ga0496106_0006850
528 Ga0496108_0102190
529 Ga0496109_0093099
530 Ga0496109_0155894
531 Ga0496109_0167947
532 Ga0496112_0021629
533 Ga0496114_0009853
534 Ga0496114_0100591
535 Ga0496116_0046614
536 Ga0496117_0000471
537 Ga0496118_0009232
538 Ga0496119_0002384
539 Ga0496119_0053568
540 Ga0496120_0001691
541 Ga0496120_0007571
542 Ga0496122_0000054
543 Ga0496122_0053861
544 Ga0496122_0068398
545 Ga0496123_0000039
546 Ga0496123_0003381
547 Ga0496124_0002245
548 Ga0496124_0016450
549 Ga0496124_0090371
550 Ga0496126_0003610
551 Ga0496126_0009632
552 Ga0501305_003597
553 Ga0501323_001480
554 Ga0501032_0002322
555 Ga0501032_0017949
556 Ga0501034_0000016
557 Ga0501037_0038366
558 Ga0501043_0033374
559 Ga0501043_0159909
560 Ga0501067_0001069
561 Ga0501070_0010595
562 Ga0501071_0000571
563 Ga0501072_0060058
564 Ga0501073_0067843
565 Ga0501080_0008109
566 Ga0501083_0007648
567 Ga0501044_0051899
568 Ga0501044_0070769
569 nmdc:mga0sz30_15552_c1
570 Ga0500641_0001334
571 Ga0500559_0000295
572 Ga0587091_002228
573 Ga0587101_001251
574 Ga0466962_0050000
575 2515850608
576 2537897862
577 2547411062
578 2555229798
579 2585307496
580 2585317657
581 2587862771
582 2588108315
583 2616693933
584 2616899161
585 2643733540
586 2643752697
587 2643762600
588 2643767663
589 2643785966
590 2643848486
591 2643849797
592 2643875268
593 2643897101
594 2643945434
595 2643995949
596 2644018012
597 2644089029
598 2644111023
599 2644135799
600 2644170115
601 2644180699
602 2644199317
603 2644270758
604 2644279658
605 2644318874
606 2644382324
607 2644408245
608 2644432333
609 2644435444
610 2644445094
611 2644457255
612 2644460920
613 2644532026
614 2644537654
615 2644630547
616 2644680381
617 2645719538
618 2645726442
619 2655032495
620 2676475179
621 2676493237
622 2691513854
623 2723642078
624 2729905019
625 2730229834
626 2739602358
627 2747952051
628 2758226323
629 2768646698
630 2774380713
631 2774384663
632 2774399750
633 2775656917
634 2784472247
635 2784587094
636 2785345310
637 2785367580
638 2786668640
639 2804844168
640 2808631381
641 2808831120
642 2808848065
643 2808852385
644 2808874359
645 2808879323
646 2808885464
647 2808891176
648 2808896431
649 2808902114
650 2809227224
651 2809230658
652 2810363746
653 2811847342
654 2812321184
655 2812322916
656 2812351913
657 2812359933
658 2812375027
659 2812482002
660 2817509139
661 2819427767
662 2819666630
663 2819691781
664 2819694404
665 2819729445
666 2819740003
667 2821269820
668 2827629888
669 2833710744
670 2837269669
671 2844842511
672 2844852714
673 2844855455
674 2848552351
675 2852633395
676 2852638096
677 2852645426
678 2852647460
679 2852665386
680 2852679433
681 2856744661
682 2857484049
683 2857721644
684 2857724010
685 2857728968
686 2857732571
687 2857735626
688 2857737399
689 2857742126
690 2862183229
691 2862289062
692 2862293123
693 2862390164
694 2862508492
695 2862583284
696 2862708347
697 2862996266
698 2863406557
699 2867370362
700 2867438040
701 2867476995
702 2870630148
703 2873157303
704 2873319468
705 2875393055
706 2877682968
707 2883825451
708 2884700524
709 2887444026
710 2891400631
711 2891562319
712 2891565602
713 2893684539
714 2895450256
715 2895661351
716 2897563429
717 2904432652
718 2904498237
719 2904512862
720 2904777599
721 2905930899
722 2906800383
723 2908675724
724 2908681139
725 2912721982
726 2912725750
727 2912759233
728 2918502918
729 2919034969
730 2919051453
731 2919058196
732 2919059796
733 2919072983
734 2919394776
735 2919398755
736 2919446167
737 2919450470
738 2919475074
739 2919524570
740 2919540429
741 2920882606
742 2928092291
743 2928122913
744 2928156507
745 2932428283
746 2933421122
747 2935394392
748 2935411428
749 2939601319
750 2939648691
751 2939675260
752 2945918942
753 2945920696
754 2945943118
755 2945959138
756 2945971974
757 2946004412
758 2946033648
759 2946039011
760 2946044345
761 2946051644
762 2946062792
763 2946065972
764 2946074296
765 2946080808
766 2947231432
767 2954000419
768 2954004687
769 2954388185
770 2954674918
771 2954689217
772 2954698990
773 2954703231
774 2954717944
775 2954727910
776 2954733894
777 2954746808
778 2954752777
779 2954765923
780 2964329676
781 2966604008
782 2966924810
783 2974296957
784 2974306935
785 2974326810
786 2977231146
787 2977239938
788 2977253754
789 2977266395
790 2984545790
791 2984554284
792 2984580933
793 2984594724
794 2990044626
795 2990066185
796 2990092317
797 2995465000
798 2995728105
799 2997458802
800 2997606840
801 3006323203
802 3006426337
803 3006486374
804 3006496632
805 8002812576
806 8004022751
807 8004029427
808 8004185044
809 8004214108
810 8008489252
811 8008561750
812 8008580382
813 8016257758
814 8023625062
815 8025418857
816 8025527583
817 8025535766
818 8033690061
819 8045830973
820 8047899864
821 8048130997
822 8048359066
823 8048376812
824 8048385865
825 8048411599
826 8053953936
827 8054110178
828 8054163431
829 8054612935
830 8055035886
831 8055038558
832 8055073331
833 8055174576
834 8056037553
835 8056451657
836 8056667566
837 8056833001
838 8057348683

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

333

463

0.94

PF00005

ABC_tran

ABC transporter

17

187

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f04-assembly1.cif.gz_A cytochrome c-type biogenesis protein ccmabcd from e. coli in complex with heme and atp. 0.8464 322 494
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.8366 320 520
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.8302 322 512
8ce5-assembly1.cif.gz_A cytochrome c maturation complex ccmabcd, e154q, atp-bound 0.8298 322 494
3pux-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 0.8292 322 512
ID Description Score Start End Superfamily
af_O53164_14_297_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9658 14 282 3.40.50.300
af_O53164_14_297_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9133 14 282 3.40.50.300
af_O53915_4_138_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8753 136 248 3.40.50.300
af_Q19554_376_618_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8719 298 524 3.40.50.300
af_O53164_299_541_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8697 285 526 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7V9NSQ8-F1-model_v4 ABC-F family ATP-binding cassette domain-containing protein 0.9181 1 223 GO:0005524
GO:0016887
AF-A0A3B8HDA8-F1-model_v4 deleted 0.9079 361 520
AF-A0A7V9NSQ8-F1-model_v4 ABC-F family ATP-binding cassette domain-containing protein 0.8985 1 223 GO:0005524
GO:0016887
AF-A0A7V0LTM1-F1-model_v4 ABC-F family ATP-binding cassette domain-containing protein 0.8964 347 509 GO:0005524
GO:0016887
AF-A0A2D9RIA9-F1-model_v4 Energy-dependent translational throttle protein EttA 0.8953 2 253 GO:0000049
GO:0005524
GO:0006412
GO:0016887
GO:0019843
GO:0045900

Map