F439604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 419 | 379 | 838 | 530 |
Family's Representative Sequence
| Representative Sequence | 3300048908|Ga0496105_0106382|Ga0496105_0106382_369_1967 |
| Length | 524 |
| Sequence | VLAVHDLEIRVGARVLMSEVAFRVSRGDKIGLVGRNGAGKTTLTKVLAGDLLPSAGEVQRGGELGYLPQDPRSGDPEMLARTRILDARGLGTLALGMQEASLQMADDDPDVAAKAMRRYGSLTERFESLGGYAAEAEAASIAHNLSLPDRILDQPLKTLSGGQRRRIELARILFSDADTMILDEPTNHLDADSVVWLREFLKNYKGGLIVISHDVELVGETVNRVFYLDANRQVIDIYNMNWKNYQRQRVADEERRKKERVNVEKKATALQLQAARFGAKAMVARAEKMLSGLDEVRQEDRVAKLRFPKPAPCGKTPLMARGLSKSYGSLEIFTDVDLAIDRGSKVVVLGLNGAGKTTLLRMLAGVDAPDTGTIEPGHGLKIGYYAQEHENLDVSRSVLENMMSAAPDITATDARKVLGSFLFTGDDVLKPAGVLSGGEKTRLSLATLVVSSANMLLLDEPTNNLDPASREEILGALAHYEGAVVLVSHDAGAVEALNPERVLILPDGVEDIWGRDYVDLITLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 10 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 11 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 12 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 13 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 14 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 15 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 16 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 17 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 18 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 19 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 20 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 21 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 22 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 23 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 25 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 28 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 29 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 31 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 33 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 34 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 35 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 36 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 37 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 38 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 39 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 40 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 41 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 42 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 43 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 44 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 45 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 46 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 47 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 48 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 49 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 50 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 51 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 52 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 53 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 54 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 55 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 56 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 57 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 58 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 59 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 60 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 61 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 62 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 63 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 64 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 65 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 72 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 73 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 74 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 75 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 76 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 77 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 80 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 81 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 82 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 83 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 84 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 85 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 86 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 87 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 88 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 89 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 90 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 91 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 92 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 93 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 94 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 95 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 96 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 98 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 99 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 102 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 105 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 106 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 107 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 111 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 112 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 113 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 116 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 117 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 118 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 119 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 120 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 121 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 122 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 123 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 124 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 125 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 126 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 127 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 128 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 129 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 130 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 131 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 132 | 2643221567 | Phycicoccus sp. Root563 | Isolate | Unclassified |
| 133 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 134 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 135 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 136 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 137 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 138 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 139 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 140 | 2643221624 | Phycicoccus sp. Root101 | Isolate | Unclassified |
| 141 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 142 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 143 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 144 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 145 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 146 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 147 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 148 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 149 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 150 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 151 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 152 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 153 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 154 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 155 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 156 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 157 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 158 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 159 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 160 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 161 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 162 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 163 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 164 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 165 | 2728369276 | Kineococcus rhizosphaerae DSM 19711 | Isolate | Rhizosphere |
| 166 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 167 | 2739367653 | Kocuria sp. OV113 | Isolate | Unclassified |
| 168 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 169 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 170 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 171 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 172 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 173 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 174 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 175 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 176 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 177 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 178 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 179 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 180 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 181 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 182 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 183 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 184 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 185 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 186 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 187 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 188 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 189 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 190 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 191 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 192 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 193 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 194 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 195 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 196 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 197 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 198 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 199 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 200 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 201 | 2816332305 | Kocuria rhizophila FDAARGOS_302 | Isolate | Rhizosphere |
| 202 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 203 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 204 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 205 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 206 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 207 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 208 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 209 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 210 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 211 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 212 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 213 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 214 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 215 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 216 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 217 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 218 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 219 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 220 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 221 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 222 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 223 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 224 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 225 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 226 | 2857727296 | Kocuria sp. R-72562 | Isolate | Unclassified |
| 227 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 228 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 229 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 230 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 231 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 232 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 233 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 234 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 235 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 236 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 237 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 238 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 239 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 240 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 241 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 242 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 243 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 244 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 245 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 246 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 247 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 248 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 249 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 250 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 251 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 252 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 253 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 254 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 255 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 256 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 257 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 258 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 259 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 260 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 261 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 262 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 263 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 264 | 2908674828 | Curtobacterium sp. 1517 | Isolate | Rhizosphere |
| 265 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 266 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 267 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 268 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 269 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 270 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 271 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 272 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 273 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 274 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 275 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 276 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 277 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 278 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 279 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 280 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 281 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 282 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 283 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 284 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 285 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 286 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 287 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 288 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 289 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 290 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 291 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 292 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 293 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 294 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 295 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 296 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 297 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 298 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 299 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 300 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 301 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 302 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 303 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 304 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 305 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 306 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 307 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 308 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 309 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 310 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 311 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 312 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 313 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 314 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 315 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 316 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 317 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 318 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 319 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 320 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 321 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 322 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 323 | 2966924647 | Frigoribacterium sp. 2355 | Isolate | Rhizosphere |
| 324 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 325 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 326 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 327 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 328 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 329 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 330 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 331 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 332 | 2984551494 | Curtobacterium sp. SORGH_AS776 | Isolate | Aerial Root |
| 333 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 334 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 335 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 336 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 337 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 338 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 339 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 340 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 341 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 342 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 343 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 344 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 345 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 346 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 347 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 348 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 349 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 350 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 351 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 352 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 353 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 354 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 355 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 356 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 357 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 358 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 359 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 360 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 361 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 362 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 363 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 364 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 365 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 366 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 367 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 368 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 369 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 370 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 371 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 372 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 373 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 374 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 375 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 376 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 377 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 378 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 379 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 36.04 |
| Metatranscriptomes | 0.95 |
| Isolates | 63.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.95 |
| Bulb | 0 |
| Endosphere | 2.39 |
| Nodule | 0.95 |
| Rhizoplane | 3.82 |
| Rhizosphere | 58.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496105_0106382 | 3300048908 | Bacteria | 2316 |
| 2 | Ga0070658_10127583 | 3300005327 | Bacteria | 2118 |
| 3 | Ga0070683_100022358 | 3300005329 | Bacteria | 5651 |
| 4 | Ga0070680_100002813 | 3300005336 | Bacteria | 12926 |
| 5 | Ga0070674_100109138 | 3300005356 | Bacteria | 2029 |
| 6 | Ga0070681_10000019 | 3300005458 | Bacteria | 124774 |
| 7 | Ga0070679_100000124 | 3300005530 | Bacteria | 61752 |
| 8 | Ga0070665_100002138 | 3300005548 | Bacteria | 22051 |
| 9 | Ga0075365_10002589 | 3300006038 | Bacteria | 8945 |
| 10 | Ga0075364_10001422 | 3300006051 | Bacteria | 12979 |
| 11 | Ga0075432_10002903 | 3300006058 | Bacteria | 5763 |
| 12 | Ga0075369_10001879 | 3300006186 | Bacteria | 7344 |
| 13 | Ga0105244_10004227 | 3300009036 | Bacteria | 9982 |
| 14 | Ga0105244_10026381 | 3300009036 | Bacteria | 3145 |
| 15 | Ga0105243_10045626 | 3300009148 | Bacteria | 3445 |
| 16 | Ga0105238_10154763 | 3300009551 | Bacteria | 2268 |
| 17 | Ga0157373_10005927 | 3300013100 | Bacteria | 9146 |
| 18 | Ga0157369_10141128 | 3300013105 | Bacteria | 2549 |
| 19 | Ga0163163_10169357 | 3300014325 | Bacteria | 2230 |
| 20 | Ga0207425_1002927 | 3300025245 | Bacteria | 5718 |
| 21 | Ga0209129_1000067 | 3300025258 | Bacteria | 219974 |
| 22 | Ga0209025_1001395 | 3300025294 | Bacteria | 32161 |
| 23 | Ga0209051_1005933 | 3300025303 | Bacteria | 7009 |
| 24 | Ga0207655_1005476 | 3300025728 | Bacteria | 8617 |
| 25 | Ga0207655_1017639 | 3300025728 | Bacteria | 3839 |
| 26 | Ga0207707_10000046 | 3300025912 | Bacteria | 119404 |
| 27 | Ga0207660_10002591 | 3300025917 | Bacteria | 11856 |
| 28 | Ga0207657_10080888 | 3300025919 | Bacteria | 2730 |
| 29 | Ga0207652_10000476 | 3300025921 | Bacteria | 41111 |
| 30 | Ga0207691_10001023 | 3300025940 | Bacteria | 27673 |
| 31 | Ga0207661_10010182 | 3300025944 | Bacteria | 6761 |
| 32 | Ga0207428_10074844 | 3300027907 | Bacteria | 2655 |
| 33 | Ga0268266_10001498 | 3300028379 | Bacteria | 27603 |
| 34 | Ga0265340_10015682 | 3300031247 | Bacteria | 3934 |
| 35 | Ga0307408_100001200 | 3300031548 | Bacteria | 19575 |
| 36 | Ga0307408_100019381 | 3300031548 | Bacteria | 4580 |
| 37 | Ga0307408_100020533 | 3300031548 | Bacteria | 4461 |
| 38 | Ga0307408_100021353 | 3300031548 | Bacteria | 4381 |
| 39 | Ga0307405_10070634 | 3300031731 | Bacteria | 2243 |
| 40 | Ga0307410_10044842 | 3300031852 | Bacteria | 2940 |
| 41 | Ga0307407_10039497 | 3300031903 | Bacteria | 2625 |
| 42 | Ga0307412_10002167 | 3300031911 | Bacteria | 10899 |
| 43 | Ga0307412_10024609 | 3300031911 | Bacteria | 3718 |
| 44 | Ga0307409_100010515 | 3300031995 | Bacteria | 5760 |
| 45 | Ga0307416_100064992 | 3300032002 | Bacteria | 2995 |
| 46 | Ga0307416_100071057 | 3300032002 | Bacteria | 2889 |
| 47 | Ga0307416_100072550 | 3300032002 | Bacteria | 2866 |
| 48 | Ga0307411_10028616 | 3300032005 | Bacteria | 3391 |
| 49 | Ga0307411_10118529 | 3300032005 | Bacteria | 1910 |
| 50 | Ga0307415_100055774 | 3300032126 | Bacteria | 2706 |
| 51 | Ga0395900_0038045 | 3300037418 | Bacteria | 4960 |
| 52 | Ga0395900_0188935 | 3300037418 | Bacteria | 2090 |
| 53 | Ga0395898_0002818 | 3300037466 | Bacteria | 19939 |
| 54 | Ga0395898_0013997 | 3300037466 | Bacteria | 8244 |
| 55 | Ga0395898_0035472 | 3300037466 | Bacteria | 4958 |
| 56 | Ga0395898_0105824 | 3300037466 | Bacteria | 2698 |
| 57 | Ga0395901_0002057 | 3300038443 | Bacteria | 20633 |
| 58 | Ga0395901_0017899 | 3300038443 | Bacteria | 7232 |
| 59 | Ga0395901_0059164 | 3300038443 | Bacteria | 3986 |
| 60 | Ga0395901_0114072 | 3300038443 | Bacteria | 2838 |
| 61 | Ga0439436_0005502 | 3300041404 | Bacteria | 3878 |
| 62 | Ga0439438_007334 | 3300041405 | Bacteria | 3778 |
| 63 | Ga0439439_0001014 | 3300041406 | Bacteria | 5283 |
| 64 | Ga0439461_0001064 | 3300041410 | Bacteria | 4142 |
| 65 | Ga0439466_0000908 | 3300041411 | Bacteria | 11277 |
| 66 | Ga0439466_0017039 | 3300041411 | Bacteria | 2619 |
| 67 | Ga0439433_0002196 | 3300041999 | Bacteria | 4115 |
| 68 | Ga0439442_000244 | 3300042002 | Bacteria | 13232 |
| 69 | Ga0439449_0008345 | 3300042007 | Bacteria | 3939 |
| 70 | Ga0439449_0010260 | 3300042007 | Bacteria | 3538 |
| 71 | Ga0439452_001752 | 3300042010 | Bacteria | 8499 |
| 72 | Ga0439462_0000542 | 3300042015 | Bacteria | 7467 |
| 73 | Ga0450919_000580 | 3300042121 | Bacteria | 4614 |
| 74 | Ga0450908_000769 | 3300042184 | Bacteria | 6137 |
| 75 | Ga0439434_0000600 | 3300042435 | Bacteria | 10371 |
| 76 | Ga0466966_0036626 | 3300044684 | Bacteria | 3167 |
| 77 | Ga0466961_0023072 | 3300044693 | Bacteria | 4001 |
| 78 | Ga0466971_0008815 | 3300044719 | Bacteria | 4403 |
| 79 | Ga0466960_0020826 | 3300044901 | Bacteria | 2912 |
| 80 | Ga0466959_0003490 | 3300045049 | Bacteria | 10301 |
| 81 | Ga0466959_0080865 | 3300045049 | Bacteria | 2342 |
| 82 | Ga0466958_0085005 | 3300045836 | Bacteria | 1951 |
| 83 | Ga0466967_0119562 | 3300045976 | Bacteria | 2432 |
| 84 | Ga0495653_0133209 | 3300046463 | Bacteria | 1756 |
| 85 | Ga0495580_0004371 | 3300046472 | Bacteria | 11866 |
| 86 | Ga0495643_0057367 | 3300046522 | Bacteria | 2075 |
| 87 | Ga0495665_0000709 | 3300046531 | Bacteria | 17165 |
| 88 | Ga0495665_0012359 | 3300046531 | Bacteria | 4618 |
| 89 | Ga0495586_0003928 | 3300046535 | Bacteria | 7975 |
| 90 | Ga0495645_0012546 | 3300046543 | Bacteria | 5973 |
| 91 | Ga0495667_0025156 | 3300046559 | Bacteria | 4013 |
| 92 | Ga0495667_0048216 | 3300046559 | Bacteria | 2813 |
| 93 | Ga0495659_0005834 | 3300046664 | Bacteria | 3886 |
| 94 | Ga0495661_0072320 | 3300046665 | Bacteria | 2012 |
| 95 | Ga0495588_0001605 | 3300046674 | Bacteria | 9662 |
| 96 | Ga0495588_0038853 | 3300046674 | Bacteria | 2422 |
| 97 | Ga0495588_0045063 | 3300046674 | Bacteria | 2260 |
| 98 | Ga0495670_0006377 | 3300046691 | Bacteria | 5795 |
| 99 | Ga0495581_0055733 | 3300047315 | Bacteria | 2281 |
| 100 | Ga0495636_0009199 | 3300047318 | Bacteria | 3887 |
| 101 | Ga0495675_0019304 | 3300047444 | Bacteria | 4330 |
| 102 | Ga0496100_0058172 | 3300048903 | Bacteria | 2535 |
| 103 | Ga0496103_0007486 | 3300048906 | Bacteria | 6506 |
| 104 | Ga0496103_0032157 | 3300048906 | Bacteria | 3201 |
| 105 | Ga0496103_0043832 | 3300048906 | Bacteria | 2755 |
| 106 | Ga0496104_0159560 | 3300048907 | Bacteria | 2163 |
| 107 | Ga0496105_0011201 | 3300048908 | Bacteria | 7075 |
| 108 | Ga0496106_0006850 | 3300048909 | Bacteria | 8435 |
| 109 | Ga0496108_0102190 | 3300048911 | Bacteria | 2446 |
| 110 | Ga0496109_0093099 | 3300048912 | Bacteria | 2788 |
| 111 | Ga0496109_0155894 | 3300048912 | Bacteria | 2139 |
| 112 | Ga0496109_0167947 | 3300048912 | Bacteria | 2058 |
| 113 | Ga0496112_0021629 | 3300048915 | Bacteria | 6118 |
| 114 | Ga0496114_0009853 | 3300048917 | Bacteria | 7594 |
| 115 | Ga0496114_0100591 | 3300048917 | Bacteria | 2467 |
| 116 | Ga0496116_0046614 | 3300048919 | Bacteria | 2924 |
| 117 | Ga0496117_0000471 | 3300048920 | Bacteria | 66939 |
| 118 | Ga0496118_0009232 | 3300048921 | Bacteria | 10016 |
| 119 | Ga0496119_0002384 | 3300048922 | Bacteria | 20644 |
| 120 | Ga0496119_0053568 | 3300048922 | Bacteria | 2463 |
| 121 | Ga0496120_0001691 | 3300048923 | Bacteria | 25302 |
| 122 | Ga0496120_0007571 | 3300048923 | Bacteria | 8056 |
| 123 | Ga0496122_0000054 | 3300048925 | Bacteria | 259135 |
| 124 | Ga0496122_0053861 | 3300048925 | Bacteria | 3027 |
| 125 | Ga0496122_0068398 | 3300048925 | Bacteria | 2550 |
| 126 | Ga0496123_0000039 | 3300048926 | Bacteria | 259107 |
| 127 | Ga0496123_0003381 | 3300048926 | Bacteria | 18020 |
| 128 | Ga0496124_0002245 | 3300048927 | Bacteria | 25691 |
| 129 | Ga0496124_0016450 | 3300048927 | Bacteria | 7028 |
| 130 | Ga0496124_0090371 | 3300048927 | Bacteria | 2498 |
| 131 | Ga0496126_0003610 | 3300048929 | Bacteria | 19352 |
| 132 | Ga0496126_0009632 | 3300048929 | Bacteria | 10240 |
| 133 | Ga0501305_003597 | 3300049161 | Bacteria | 1766 |
| 134 | Ga0501323_001480 | 3300049539 | Bacteria | 2097 |
| 135 | Ga0501032_0002322 | 3300049569 | Bacteria | 14909 |
| 136 | Ga0501032_0017949 | 3300049569 | Bacteria | 4963 |
| 137 | Ga0501034_0000016 | 3300049571 | Bacteria | 289751 |
| 138 | Ga0501037_0038366 | 3300049573 | Bacteria | 3529 |
| 139 | Ga0501043_0033374 | 3300049579 | Bacteria | 4050 |
| 140 | Ga0501043_0159909 | 3300049579 | Bacteria | 1760 |
| 141 | Ga0501067_0001069 | 3300049583 | Bacteria | 14772 |
| 142 | Ga0501070_0010595 | 3300049586 | Bacteria | 7792 |
| 143 | Ga0501071_0000571 | 3300049587 | Bacteria | 19061 |
| 144 | Ga0501072_0060058 | 3300049588 | Bacteria | 2998 |
| 145 | Ga0501073_0067843 | 3300049589 | Bacteria | 2486 |
| 146 | Ga0501080_0008109 | 3300049742 | Bacteria | 9518 |
| 147 | Ga0501083_0007648 | 3300049744 | Bacteria | 7660 |
| 148 | Ga0501044_0051899 | 3300049823 | Bacteria | 4228 |
| 149 | Ga0501044_0070769 | 3300049823 | Bacteria | 3548 |
| 150 | nmdc:mga0sz30_15552_c1 | 3300050516 | Bacteria | 3008 |
| 151 | Ga0500641_0001334 | 3300053096 | Bacteria | 8775 |
| 152 | Ga0500559_0000295 | 3300053136 | Bacteria | 38451 |
| 153 | Ga0587091_002228 | 3300059511 | Bacteria | 2267 |
| 154 | Ga0587101_001251 | 3300059623 | Bacteria | 2135 |
| 155 | Ga0466962_0050000 | 3300061719 | Bacteria | 1998 |
| 156 | 2515850608 | 2515154155 | Bacteria | 7985436 |
| 157 | 2537897862 | 2537561592 | Bacteria | 4348607 |
| 158 | 2547411062 | 2547132111 | Bacteria | 8013147 |
| 159 | 2555229798 | 2554235227 | Bacteria | 3637389 |
| 160 | 2585307496 | 2582581313 | Bacteria | 10042643 |
| 161 | 2585317657 | 2582581314 | Bacteria | 11452267 |
| 162 | 2587862771 | 2585428094 | Bacteria | 3604039 |
| 163 | 2588108315 | 2585428157 | Bacteria | 3018951 |
| 164 | 2616693933 | 2616644814 | Bacteria | 11555299 |
| 165 | 2616899161 | 2616644941 | Bacteria | 8510691 |
| 166 | 2643733540 | 2643221542 | Bacteria | 3563959 |
| 167 | 2643752697 | 2643221546 | Bacteria | 2910897 |
| 168 | 2643762600 | 2643221548 | Bacteria | 8053412 |
| 169 | 2643767663 | 2643221549 | Bacteria | 4042819 |
| 170 | 2643785966 | 2643221553 | Bacteria | 3544260 |
| 171 | 2643848486 | 2643221566 | Bacteria | 3460379 |
| 172 | 2643849797 | 2643221567 | Bacteria | 4163945 |
| 173 | 2643875268 | 2643221572 | Bacteria | 3614809 |
| 174 | 2643897101 | 2643221578 | Bacteria | 9213798 |
| 175 | 2643945434 | 2643221587 | Bacteria | 7586415 |
| 176 | 2643995949 | 2643221597 | Bacteria | 3347721 |
| 177 | 2644018012 | 2643221601 | Bacteria | 7493239 |
| 178 | 2644089029 | 2643221615 | Bacteria | 5487866 |
| 179 | 2644111023 | 2643221619 | Bacteria | 4158469 |
| 180 | 2644135799 | 2643221624 | Bacteria | 4384879 |
| 181 | 2644170115 | 2643221630 | Bacteria | 3601215 |
| 182 | 2644180699 | 2643221631 | Bacteria | 8168043 |
| 183 | 2644199317 | 2643221635 | Bacteria | 2632343 |
| 184 | 2644270758 | 2643221647 | Bacteria | 10741251 |
| 185 | 2644279658 | 2643221649 | Bacteria | 3867359 |
| 186 | 2644318874 | 2643221657 | Bacteria | 5490246 |
| 187 | 2644382324 | 2643221669 | Bacteria | 3611286 |
| 188 | 2644408245 | 2643221673 | Bacteria | 9196637 |
| 189 | 2644432333 | 2643221677 | Bacteria | 7584031 |
| 190 | 2644435444 | 2643221678 | Bacteria | 9540101 |
| 191 | 2644445094 | 2643221679 | Bacteria | 3839507 |
| 192 | 2644457255 | 2643221681 | Bacteria | 3707866 |
| 193 | 2644460920 | 2643221682 | Bacteria | 6743283 |
| 194 | 2644532026 | 2643221696 | Bacteria | 5431823 |
| 195 | 2644537654 | 2643221697 | Bacteria | 3575694 |
| 196 | 2644630547 | 2643221714 | Bacteria | 9015452 |
| 197 | 2644680381 | 2643221724 | Bacteria | 3593515 |
| 198 | 2645719538 | 2643221961 | Bacteria | 3919167 |
| 199 | 2645726442 | 2643221962 | Bacteria | 3874254 |
| 200 | 2655032495 | 2654587600 | Bacteria | 3911798 |
| 201 | 2676475179 | 2675903058 | Bacteria | 6822861 |
| 202 | 2676493237 | 2675903060 | Bacteria | 10051191 |
| 203 | 2691513854 | 2690315906 | Bacteria | 4517044 |
| 204 | 2723642078 | 2721755702 | Bacteria | 4373124 |
| 205 | 2729905019 | 2728369276 | Bacteria | 5610032 |
| 206 | 2730229834 | 2728369380 | Bacteria | 3620317 |
| 207 | 2739602358 | 2739367653 | Bacteria | 2780952 |
| 208 | 2747952051 | 2747842429 | Bacteria | 3914386 |
| 209 | 2758226323 | 2757320536 | Bacteria | 3629334 |
| 210 | 2768646698 | 2767802112 | Bacteria | 6465194 |
| 211 | 2774380713 | 2773857758 | Bacteria | 3592392 |
| 212 | 2774384663 | 2773857759 | Bacteria | 2963774 |
| 213 | 2774399750 | 2773857763 | Bacteria | 4180068 |
| 214 | 2775656917 | 2775506735 | Bacteria | 4556596 |
| 215 | 2784472247 | 2784132109 | Bacteria | 3141763 |
| 216 | 2784587094 | 2784132148 | Bacteria | 8627943 |
| 217 | 2785345310 | 2784746763 | Bacteria | 9783172 |
| 218 | 2785367580 | 2784746768 | Bacteria | 10036182 |
| 219 | 2786668640 | 2786546132 | Bacteria | 10419719 |
| 220 | 2804844168 | 2802429296 | Bacteria | 7227771 |
| 221 | 2808631381 | 2808606306 | Bacteria | 3608896 |
| 222 | 2808831120 | 2808606357 | Bacteria | 4466944 |
| 223 | 2808848065 | 2808606359 | Bacteria | 9866990 |
| 224 | 2808852385 | 2808606360 | Bacteria | 4404006 |
| 225 | 2808874359 | 2808606365 | Bacteria | 4301966 |
| 226 | 2808879323 | 2808606366 | Bacteria | 4415912 |
| 227 | 2808885464 | 2808606368 | Bacteria | 3174172 |
| 228 | 2808891176 | 2808606370 | Bacteria | 4942454 |
| 229 | 2808896431 | 2808606371 | Bacteria | 4251511 |
| 230 | 2808902114 | 2808606372 | Bacteria | 4649509 |
| 231 | 2809227224 | 2808606447 | Bacteria | 3572005 |
| 232 | 2809230658 | 2808606448 | Bacteria | 8656184 |
| 233 | 2810363746 | 2808606700 | Bacteria | 3482157 |
| 234 | 2811847342 | 2808606982 | Bacteria | 7791042 |
| 235 | 2812321184 | 2811994871 | Bacteria | 4497550 |
| 236 | 2812322916 | 2811994872 | Bacteria | 4121241 |
| 237 | 2812351913 | 2811994878 | Bacteria | 5992952 |
| 238 | 2812359933 | 2811994879 | Bacteria | 9313447 |
| 239 | 2812375027 | 2811994882 | Bacteria | 4688362 |
| 240 | 2812482002 | 2811994917 | Bacteria | 7761064 |
| 241 | 2817509139 | 2816332305 | Bacteria | 2697803 |
| 242 | 2819427767 | 2818991318 | Bacteria | 5266538 |
| 243 | 2819666630 | 2818991458 | Bacteria | 4794049 |
| 244 | 2819691781 | 2818991462 | Bacteria | 4320267 |
| 245 | 2819694404 | 2818991463 | Bacteria | 7948711 |
| 246 | 2819729445 | 2818991469 | Bacteria | 4644110 |
| 247 | 2819740003 | 2818991472 | Bacteria | 10089953 |
| 248 | 2821269820 | 2821268502 | Bacteria | 3750023 |
| 249 | 2827629888 | 2827628540 | Bacteria | 6858585 |
| 250 | 2833710744 | 2833709550 | Bacteria | 4008291 |
| 251 | 2837269669 | 2837268691 | Bacteria | 7850704 |
| 252 | 2844842511 | 2844841374 | Bacteria | 3917147 |
| 253 | 2844852714 | 2844849076 | Bacteria | 4091819 |
| 254 | 2844855455 | 2844852863 | Bacteria | 3849151 |
| 255 | 2848552351 | 2848551377 | Bacteria | 3720646 |
| 256 | 2852633395 | 2852632344 | Bacteria | 3463163 |
| 257 | 2852638096 | 2852635781 | Bacteria | 8251373 |
| 258 | 2852645426 | 2852643534 | Bacteria | 3013378 |
| 259 | 2852647460 | 2852646457 | Bacteria | 3408613 |
| 260 | 2852665386 | 2852663356 | Bacteria | 4090475 |
| 261 | 2852679433 | 2852677369 | Bacteria | 3768884 |
| 262 | 2856744661 | 2856741275 | Bacteria | 8096094 |
| 263 | 2857484049 | 2857481737 | Bacteria | 4761446 |
| 264 | 2857721644 | 2857720070 | Bacteria | 3189373 |
| 265 | 2857724010 | 2857723135 | Bacteria | 4217853 |
| 266 | 2857728968 | 2857727296 | Bacteria | 2745552 |
| 267 | 2857732571 | 2857729791 | Bacteria | 4040535 |
| 268 | 2857735626 | 2857733635 | Bacteria | 3532004 |
| 269 | 2857737399 | 2857737099 | Bacteria | 3104305 |
| 270 | 2857742126 | 2857740372 | Bacteria | 4782044 |
| 271 | 2862183229 | 2862178590 | Bacteria | 8583590 |
| 272 | 2862289062 | 2862281513 | Bacteria | 9621493 |
| 273 | 2862293123 | 2862290372 | Bacteria | 7471434 |
| 274 | 2862390164 | 2862382967 | Bacteria | 10317375 |
| 275 | 2862508492 | 2862507626 | Bacteria | 9425308 |
| 276 | 2862583284 | 2862574272 | Bacteria | 10567477 |
| 277 | 2862708347 | 2862705112 | Bacteria | 6563286 |
| 278 | 2862996266 | 2862993130 | Bacteria | 3860849 |
| 279 | 2863406557 | 2863404153 | Bacteria | 9672205 |
| 280 | 2867370362 | 2867369537 | Bacteria | 6501581 |
| 281 | 2867438040 | 2867428634 | Bacteria | 9590268 |
| 282 | 2867476995 | 2867475112 | Bacteria | 6909112 |
| 283 | 2870630148 | 2870628048 | Bacteria | 3696012 |
| 284 | 2873157303 | 2873151551 | Bacteria | 8625867 |
| 285 | 2873319468 | 2873314349 | Bacteria | 8512634 |
| 286 | 2875393055 | 2875391855 | Bacteria | 7600475 |
| 287 | 2877682968 | 2877676314 | Bacteria | 9512378 |
| 288 | 2883825451 | 2883821847 | Bacteria | 5121194 |
| 289 | 2884700524 | 2884693830 | Bacteria | 11273186 |
| 290 | 2887444026 | 2887443736 | Bacteria | 4426037 |
| 291 | 2891400631 | 2891395885 | Bacteria | 9251614 |
| 292 | 2891562319 | 2891554331 | Bacteria | 8812224 |
| 293 | 2891565602 | 2891562705 | Bacteria | 8039471 |
| 294 | 2893684539 | 2893684298 | Bacteria | 2897960 |
| 295 | 2895450256 | 2895442618 | Bacteria | 11027144 |
| 296 | 2895661351 | 2895660088 | Bacteria | 3782833 |
| 297 | 2897563429 | 2897561785 | Bacteria | 3256946 |
| 298 | 2904432652 | 2904430863 | Bacteria | 3486923 |
| 299 | 2904498237 | 2904497146 | Bacteria | 4731781 |
| 300 | 2904512862 | 2904509784 | Bacteria | 3520416 |
| 301 | 2904777599 | 2904776348 | Bacteria | 4658726 |
| 302 | 2905930899 | 2905926851 | Bacteria | 4423176 |
| 303 | 2906800383 | 2906799679 | Bacteria | 4031749 |
| 304 | 2908675724 | 2908674828 | Bacteria | 3382763 |
| 305 | 2908681139 | 2908678064 | Bacteria | 3482747 |
| 306 | 2912721982 | 2912715099 | Bacteria | 9460473 |
| 307 | 2912725750 | 2912723979 | Bacteria | 8557534 |
| 308 | 2912759233 | 2912757875 | Bacteria | 7940295 |
| 309 | 2918502918 | 2918501144 | Bacteria | 8668083 |
| 310 | 2919034969 | 2919034639 | Bacteria | 4763403 |
| 311 | 2919051453 | 2919051321 | Bacteria | 4210889 |
| 312 | 2919058196 | 2919055335 | Bacteria | 3875751 |
| 313 | 2919059796 | 2919059106 | Bacteria | 4991624 |
| 314 | 2919072983 | 2919069694 | Bacteria | 3622919 |
| 315 | 2919394776 | 2919391150 | Bacteria | 4884741 |
| 316 | 2919398755 | 2919395869 | Bacteria | 3704152 |
| 317 | 2919446167 | 2919443155 | Bacteria | 4072969 |
| 318 | 2919450470 | 2919446982 | Bacteria | 3994487 |
| 319 | 2919475074 | 2919468124 | Bacteria | 9133025 |
| 320 | 2919524570 | 2919523602 | Bacteria | 3788128 |
| 321 | 2919540429 | 2919538618 | Bacteria | 4677069 |
| 322 | 2920882606 | 2920879853 | Bacteria | 4216831 |
| 323 | 2928092291 | 2928090899 | Bacteria | 3158267 |
| 324 | 2928122913 | 2928121344 | Bacteria | 3972376 |
| 325 | 2928156507 | 2928153084 | Bacteria | 4020257 |
| 326 | 2932428283 | 2932426870 | Bacteria | 4547726 |
| 327 | 2933421122 | 2933418574 | Bacteria | 4476724 |
| 328 | 2935394392 | 2935390628 | Bacteria | 7043367 |
| 329 | 2935411428 | 2935409751 | Bacteria | 4179611 |
| 330 | 2939601319 | 2939598168 | Bacteria | 4687164 |
| 331 | 2939648691 | 2939647034 | Bacteria | 4681660 |
| 332 | 2939675260 | 2939674588 | Bacteria | 4844420 |
| 333 | 2945918942 | 2945916053 | Bacteria | 4555517 |
| 334 | 2945920696 | 2945920336 | Bacteria | 4501603 |
| 335 | 2945943118 | 2945941187 | Bacteria | 4682474 |
| 336 | 2945959138 | 2945956166 | Bacteria | 5110334 |
| 337 | 2945971974 | 2945968032 | Bacteria | 4111363 |
| 338 | 2946004412 | 2946003308 | Bacteria | 3857229 |
| 339 | 2946033648 | 2946033335 | Bacteria | 3835514 |
| 340 | 2946039011 | 2946037020 | Bacteria | 4900426 |
| 341 | 2946044345 | 2946041624 | Bacteria | 4191385 |
| 342 | 2946051644 | 2946045630 | Bacteria | 8527308 |
| 343 | 2946062792 | 2946059875 | Bacteria | 4386623 |
| 344 | 2946065972 | 2946064051 | Bacteria | 8957905 |
| 345 | 2946074296 | 2946072368 | Bacteria | 8999607 |
| 346 | 2946080808 | 2946080515 | Bacteria | 4310960 |
| 347 | 2947231432 | 2947224130 | Bacteria | 9938529 |
| 348 | 2954000419 | 2953998280 | Bacteria | 4812144 |
| 349 | 2954004687 | 2954002825 | Bacteria | 9173742 |
| 350 | 2954388185 | 2954380949 | Bacteria | 10050426 |
| 351 | 2954674918 | 2954673503 | Bacteria | 9685905 |
| 352 | 2954689217 | 2954682443 | Bacteria | 9862841 |
| 353 | 2954698990 | 2954691527 | Bacteria | 10720516 |
| 354 | 2954703231 | 2954701450 | Bacteria | 10834262 |
| 355 | 2954717944 | 2954711539 | Bacteria | 10867210 |
| 356 | 2954727910 | 2954721474 | Bacteria | 10456478 |
| 357 | 2954733894 | 2954731030 | Bacteria | 10243860 |
| 358 | 2954746808 | 2954740390 | Bacteria | 10229294 |
| 359 | 2954752777 | 2954749733 | Bacteria | 10366972 |
| 360 | 2954765923 | 2954759201 | Bacteria | 9358192 |
| 361 | 2964329676 | 2964326757 | Bacteria | 3290868 |
| 362 | 2966604008 | 2966598605 | Bacteria | 7676064 |
| 363 | 2966924810 | 2966924647 | Bacteria | 3268643 |
| 364 | 2974296957 | 2974294766 | Bacteria | 3767688 |
| 365 | 2974306935 | 2974302888 | Bacteria | 4369871 |
| 366 | 2974326810 | 2974324384 | Bacteria | 3750535 |
| 367 | 2977231146 | 2977228692 | Bacteria | 3450105 |
| 368 | 2977239938 | 2977236895 | Bacteria | 3569373 |
| 369 | 2977253754 | 2977251589 | Bacteria | 2952848 |
| 370 | 2977266395 | 2977264416 | Bacteria | 3750737 |
| 371 | 2984545790 | 2984542743 | Bacteria | 3569378 |
| 372 | 2984554284 | 2984551494 | Bacteria | 3877562 |
| 373 | 2984580933 | 2984580707 | Bacteria | 3351387 |
| 374 | 2984594724 | 2984592036 | Bacteria | 3670284 |
| 375 | 2990044626 | 2990044586 | Bacteria | 6603797 |
| 376 | 2990066185 | 2990059506 | Bacteria | 9321252 |
| 377 | 2990092317 | 2990088156 | Bacteria | 6657676 |
| 378 | 2995465000 | 2995463766 | Bacteria | 8577691 |
| 379 | 2995728105 | 2995726249 | Bacteria | 3470435 |
| 380 | 2997458802 | 2997451912 | Bacteria | 8492419 |
| 381 | 2997606840 | 2997600082 | Bacteria | 9896405 |
| 382 | 3006323203 | 3006321560 | Bacteria | 8247479 |
| 383 | 3006426337 | 3006425503 | Bacteria | 6491253 |
| 384 | 3006486374 | 3006486233 | Bacteria | 8157040 |
| 385 | 3006496632 | 3006493962 | Bacteria | 8825450 |
| 386 | 8002812576 | 8002811521 | Bacteria | 2942897 |
| 387 | 8004022751 | 8004021418 | Bacteria | 4313954 |
| 388 | 8004029427 | 8004025490 | Bacteria | 4327753 |
| 389 | 8004185044 | 8004182704 | Bacteria | 3391155 |
| 390 | 8004214108 | 8004212874 | Bacteria | 2861420 |
| 391 | 8008489252 | 8008485437 | Bacteria | 7198341 |
| 392 | 8008561750 | 8008558824 | Bacteria | 10610750 |
| 393 | 8008580382 | 8008574985 | Bacteria | 7815457 |
| 394 | 8016257758 | 8016254467 | Bacteria | 3797036 |
| 395 | 8023625062 | 8023623736 | Bacteria | 8593882 |
| 396 | 8025418857 | 8025413630 | Bacteria | 7014048 |
| 397 | 8025527583 | 8025524527 | Bacteria | 7197316 |
| 398 | 8025535766 | 8025530807 | Bacteria | 8495698 |
| 399 | 8033690061 | 8033684223 | Bacteria | 6906479 |
| 400 | 8045830973 | 8045830549 | Bacteria | 4444727 |
| 401 | 8047899864 | 8047893842 | Bacteria | 11723082 |
| 402 | 8048130997 | 8048127548 | Bacteria | 11053136 |
| 403 | 8048359066 | 8048356638 | Bacteria | 11044339 |
| 404 | 8048376812 | 8048369669 | Bacteria | 11666822 |
| 405 | 8048385865 | 8048379754 | Bacteria | 11877923 |
| 406 | 8048411599 | 8048406513 | Bacteria | 8936924 |
| 407 | 8053953936 | 8053945823 | Bacteria | 8962862 |
| 408 | 8054110178 | 8054107350 | Bacteria | 5022511 |
| 409 | 8054163431 | 8054160619 | Bacteria | 7783213 |
| 410 | 8054612935 | 8054609563 | Bacteria | 5170090 |
| 411 | 8055035886 | 8055034563 | Bacteria | 3562128 |
| 412 | 8055038558 | 8055037949 | Bacteria | 3337834 |
| 413 | 8055073331 | 8055066027 | Bacteria | 9479577 |
| 414 | 8055174576 | 8055172936 | Bacteria | 9305943 |
| 415 | 8056037553 | 8056037122 | Bacteria | 3854319 |
| 416 | 8056451657 | 8056447290 | Bacteria | 7680491 |
| 417 | 8056667566 | 8056667051 | Bacteria | 6953971 |
| 418 | 8056833001 | 8056829672 | Bacteria | 9045328 |
| 419 | 8057348683 | 8057345674 | Bacteria | 4160394 |
| 420 | Ga0496105_0106382 | |||
| 421 | Ga0070658_10127583 | |||
| 422 | Ga0070683_100022358 | |||
| 423 | Ga0070680_100002813 | |||
| 424 | Ga0070674_100109138 | |||
| 425 | Ga0070681_10000019 | |||
| 426 | Ga0070679_100000124 | |||
| 427 | Ga0070665_100002138 | |||
| 428 | Ga0075365_10002589 | |||
| 429 | Ga0075364_10001422 | |||
| 430 | Ga0075432_10002903 | |||
| 431 | Ga0075369_10001879 | |||
| 432 | Ga0105244_10004227 | |||
| 433 | Ga0105244_10026381 | |||
| 434 | Ga0105243_10045626 | |||
| 435 | Ga0105238_10154763 | |||
| 436 | Ga0157373_10005927 | |||
| 437 | Ga0157369_10141128 | |||
| 438 | Ga0163163_10169357 | |||
| 439 | Ga0207425_1002927 | |||
| 440 | Ga0209129_1000067 | |||
| 441 | Ga0209025_1001395 | |||
| 442 | Ga0209051_1005933 | |||
| 443 | Ga0207655_1005476 | |||
| 444 | Ga0207655_1017639 | |||
| 445 | Ga0207707_10000046 | |||
| 446 | Ga0207660_10002591 | |||
| 447 | Ga0207657_10080888 | |||
| 448 | Ga0207652_10000476 | |||
| 449 | Ga0207691_10001023 | |||
| 450 | Ga0207661_10010182 | |||
| 451 | Ga0207428_10074844 | |||
| 452 | Ga0268266_10001498 | |||
| 453 | Ga0265340_10015682 | |||
| 454 | Ga0307408_100001200 | |||
| 455 | Ga0307408_100019381 | |||
| 456 | Ga0307408_100020533 | |||
| 457 | Ga0307408_100021353 | |||
| 458 | Ga0307405_10070634 | |||
| 459 | Ga0307410_10044842 | |||
| 460 | Ga0307407_10039497 | |||
| 461 | Ga0307412_10002167 | |||
| 462 | Ga0307412_10024609 | |||
| 463 | Ga0307409_100010515 | |||
| 464 | Ga0307416_100064992 | |||
| 465 | Ga0307416_100071057 | |||
| 466 | Ga0307416_100072550 | |||
| 467 | Ga0307411_10028616 | |||
| 468 | Ga0307411_10118529 | |||
| 469 | Ga0307415_100055774 | |||
| 470 | Ga0395900_0038045 | |||
| 471 | Ga0395900_0188935 | |||
| 472 | Ga0395898_0002818 | |||
| 473 | Ga0395898_0013997 | |||
| 474 | Ga0395898_0035472 | |||
| 475 | Ga0395898_0105824 | |||
| 476 | Ga0395901_0002057 | |||
| 477 | Ga0395901_0017899 | |||
| 478 | Ga0395901_0059164 | |||
| 479 | Ga0395901_0114072 | |||
| 480 | Ga0439436_0005502 | |||
| 481 | Ga0439438_007334 | |||
| 482 | Ga0439439_0001014 | |||
| 483 | Ga0439461_0001064 | |||
| 484 | Ga0439466_0000908 | |||
| 485 | Ga0439466_0017039 | |||
| 486 | Ga0439433_0002196 | |||
| 487 | Ga0439442_000244 | |||
| 488 | Ga0439449_0008345 | |||
| 489 | Ga0439449_0010260 | |||
| 490 | Ga0439452_001752 | |||
| 491 | Ga0439462_0000542 | |||
| 492 | Ga0450919_000580 | |||
| 493 | Ga0450908_000769 | |||
| 494 | Ga0439434_0000600 | |||
| 495 | Ga0466966_0036626 | |||
| 496 | Ga0466961_0023072 | |||
| 497 | Ga0466971_0008815 | |||
| 498 | Ga0466960_0020826 | |||
| 499 | Ga0466959_0003490 | |||
| 500 | Ga0466959_0080865 | |||
| 501 | Ga0466958_0085005 | |||
| 502 | Ga0466967_0119562 | |||
| 503 | Ga0495653_0133209 | |||
| 504 | Ga0495580_0004371 | |||
| 505 | Ga0495643_0057367 | |||
| 506 | Ga0495665_0000709 | |||
| 507 | Ga0495665_0012359 | |||
| 508 | Ga0495586_0003928 | |||
| 509 | Ga0495645_0012546 | |||
| 510 | Ga0495667_0025156 | |||
| 511 | Ga0495667_0048216 | |||
| 512 | Ga0495659_0005834 | |||
| 513 | Ga0495661_0072320 | |||
| 514 | Ga0495588_0001605 | |||
| 515 | Ga0495588_0038853 | |||
| 516 | Ga0495588_0045063 | |||
| 517 | Ga0495670_0006377 | |||
| 518 | Ga0495581_0055733 | |||
| 519 | Ga0495636_0009199 | |||
| 520 | Ga0495675_0019304 | |||
| 521 | Ga0496100_0058172 | |||
| 522 | Ga0496103_0007486 | |||
| 523 | Ga0496103_0032157 | |||
| 524 | Ga0496103_0043832 | |||
| 525 | Ga0496104_0159560 | |||
| 526 | Ga0496105_0011201 | |||
| 527 | Ga0496106_0006850 | |||
| 528 | Ga0496108_0102190 | |||
| 529 | Ga0496109_0093099 | |||
| 530 | Ga0496109_0155894 | |||
| 531 | Ga0496109_0167947 | |||
| 532 | Ga0496112_0021629 | |||
| 533 | Ga0496114_0009853 | |||
| 534 | Ga0496114_0100591 | |||
| 535 | Ga0496116_0046614 | |||
| 536 | Ga0496117_0000471 | |||
| 537 | Ga0496118_0009232 | |||
| 538 | Ga0496119_0002384 | |||
| 539 | Ga0496119_0053568 | |||
| 540 | Ga0496120_0001691 | |||
| 541 | Ga0496120_0007571 | |||
| 542 | Ga0496122_0000054 | |||
| 543 | Ga0496122_0053861 | |||
| 544 | Ga0496122_0068398 | |||
| 545 | Ga0496123_0000039 | |||
| 546 | Ga0496123_0003381 | |||
| 547 | Ga0496124_0002245 | |||
| 548 | Ga0496124_0016450 | |||
| 549 | Ga0496124_0090371 | |||
| 550 | Ga0496126_0003610 | |||
| 551 | Ga0496126_0009632 | |||
| 552 | Ga0501305_003597 | |||
| 553 | Ga0501323_001480 | |||
| 554 | Ga0501032_0002322 | |||
| 555 | Ga0501032_0017949 | |||
| 556 | Ga0501034_0000016 | |||
| 557 | Ga0501037_0038366 | |||
| 558 | Ga0501043_0033374 | |||
| 559 | Ga0501043_0159909 | |||
| 560 | Ga0501067_0001069 | |||
| 561 | Ga0501070_0010595 | |||
| 562 | Ga0501071_0000571 | |||
| 563 | Ga0501072_0060058 | |||
| 564 | Ga0501073_0067843 | |||
| 565 | Ga0501080_0008109 | |||
| 566 | Ga0501083_0007648 | |||
| 567 | Ga0501044_0051899 | |||
| 568 | Ga0501044_0070769 | |||
| 569 | nmdc:mga0sz30_15552_c1 | |||
| 570 | Ga0500641_0001334 | |||
| 571 | Ga0500559_0000295 | |||
| 572 | Ga0587091_002228 | |||
| 573 | Ga0587101_001251 | |||
| 574 | Ga0466962_0050000 | |||
| 575 | 2515850608 | |||
| 576 | 2537897862 | |||
| 577 | 2547411062 | |||
| 578 | 2555229798 | |||
| 579 | 2585307496 | |||
| 580 | 2585317657 | |||
| 581 | 2587862771 | |||
| 582 | 2588108315 | |||
| 583 | 2616693933 | |||
| 584 | 2616899161 | |||
| 585 | 2643733540 | |||
| 586 | 2643752697 | |||
| 587 | 2643762600 | |||
| 588 | 2643767663 | |||
| 589 | 2643785966 | |||
| 590 | 2643848486 | |||
| 591 | 2643849797 | |||
| 592 | 2643875268 | |||
| 593 | 2643897101 | |||
| 594 | 2643945434 | |||
| 595 | 2643995949 | |||
| 596 | 2644018012 | |||
| 597 | 2644089029 | |||
| 598 | 2644111023 | |||
| 599 | 2644135799 | |||
| 600 | 2644170115 | |||
| 601 | 2644180699 | |||
| 602 | 2644199317 | |||
| 603 | 2644270758 | |||
| 604 | 2644279658 | |||
| 605 | 2644318874 | |||
| 606 | 2644382324 | |||
| 607 | 2644408245 | |||
| 608 | 2644432333 | |||
| 609 | 2644435444 | |||
| 610 | 2644445094 | |||
| 611 | 2644457255 | |||
| 612 | 2644460920 | |||
| 613 | 2644532026 | |||
| 614 | 2644537654 | |||
| 615 | 2644630547 | |||
| 616 | 2644680381 | |||
| 617 | 2645719538 | |||
| 618 | 2645726442 | |||
| 619 | 2655032495 | |||
| 620 | 2676475179 | |||
| 621 | 2676493237 | |||
| 622 | 2691513854 | |||
| 623 | 2723642078 | |||
| 624 | 2729905019 | |||
| 625 | 2730229834 | |||
| 626 | 2739602358 | |||
| 627 | 2747952051 | |||
| 628 | 2758226323 | |||
| 629 | 2768646698 | |||
| 630 | 2774380713 | |||
| 631 | 2774384663 | |||
| 632 | 2774399750 | |||
| 633 | 2775656917 | |||
| 634 | 2784472247 | |||
| 635 | 2784587094 | |||
| 636 | 2785345310 | |||
| 637 | 2785367580 | |||
| 638 | 2786668640 | |||
| 639 | 2804844168 | |||
| 640 | 2808631381 | |||
| 641 | 2808831120 | |||
| 642 | 2808848065 | |||
| 643 | 2808852385 | |||
| 644 | 2808874359 | |||
| 645 | 2808879323 | |||
| 646 | 2808885464 | |||
| 647 | 2808891176 | |||
| 648 | 2808896431 | |||
| 649 | 2808902114 | |||
| 650 | 2809227224 | |||
| 651 | 2809230658 | |||
| 652 | 2810363746 | |||
| 653 | 2811847342 | |||
| 654 | 2812321184 | |||
| 655 | 2812322916 | |||
| 656 | 2812351913 | |||
| 657 | 2812359933 | |||
| 658 | 2812375027 | |||
| 659 | 2812482002 | |||
| 660 | 2817509139 | |||
| 661 | 2819427767 | |||
| 662 | 2819666630 | |||
| 663 | 2819691781 | |||
| 664 | 2819694404 | |||
| 665 | 2819729445 | |||
| 666 | 2819740003 | |||
| 667 | 2821269820 | |||
| 668 | 2827629888 | |||
| 669 | 2833710744 | |||
| 670 | 2837269669 | |||
| 671 | 2844842511 | |||
| 672 | 2844852714 | |||
| 673 | 2844855455 | |||
| 674 | 2848552351 | |||
| 675 | 2852633395 | |||
| 676 | 2852638096 | |||
| 677 | 2852645426 | |||
| 678 | 2852647460 | |||
| 679 | 2852665386 | |||
| 680 | 2852679433 | |||
| 681 | 2856744661 | |||
| 682 | 2857484049 | |||
| 683 | 2857721644 | |||
| 684 | 2857724010 | |||
| 685 | 2857728968 | |||
| 686 | 2857732571 | |||
| 687 | 2857735626 | |||
| 688 | 2857737399 | |||
| 689 | 2857742126 | |||
| 690 | 2862183229 | |||
| 691 | 2862289062 | |||
| 692 | 2862293123 | |||
| 693 | 2862390164 | |||
| 694 | 2862508492 | |||
| 695 | 2862583284 | |||
| 696 | 2862708347 | |||
| 697 | 2862996266 | |||
| 698 | 2863406557 | |||
| 699 | 2867370362 | |||
| 700 | 2867438040 | |||
| 701 | 2867476995 | |||
| 702 | 2870630148 | |||
| 703 | 2873157303 | |||
| 704 | 2873319468 | |||
| 705 | 2875393055 | |||
| 706 | 2877682968 | |||
| 707 | 2883825451 | |||
| 708 | 2884700524 | |||
| 709 | 2887444026 | |||
| 710 | 2891400631 | |||
| 711 | 2891562319 | |||
| 712 | 2891565602 | |||
| 713 | 2893684539 | |||
| 714 | 2895450256 | |||
| 715 | 2895661351 | |||
| 716 | 2897563429 | |||
| 717 | 2904432652 | |||
| 718 | 2904498237 | |||
| 719 | 2904512862 | |||
| 720 | 2904777599 | |||
| 721 | 2905930899 | |||
| 722 | 2906800383 | |||
| 723 | 2908675724 | |||
| 724 | 2908681139 | |||
| 725 | 2912721982 | |||
| 726 | 2912725750 | |||
| 727 | 2912759233 | |||
| 728 | 2918502918 | |||
| 729 | 2919034969 | |||
| 730 | 2919051453 | |||
| 731 | 2919058196 | |||
| 732 | 2919059796 | |||
| 733 | 2919072983 | |||
| 734 | 2919394776 | |||
| 735 | 2919398755 | |||
| 736 | 2919446167 | |||
| 737 | 2919450470 | |||
| 738 | 2919475074 | |||
| 739 | 2919524570 | |||
| 740 | 2919540429 | |||
| 741 | 2920882606 | |||
| 742 | 2928092291 | |||
| 743 | 2928122913 | |||
| 744 | 2928156507 | |||
| 745 | 2932428283 | |||
| 746 | 2933421122 | |||
| 747 | 2935394392 | |||
| 748 | 2935411428 | |||
| 749 | 2939601319 | |||
| 750 | 2939648691 | |||
| 751 | 2939675260 | |||
| 752 | 2945918942 | |||
| 753 | 2945920696 | |||
| 754 | 2945943118 | |||
| 755 | 2945959138 | |||
| 756 | 2945971974 | |||
| 757 | 2946004412 | |||
| 758 | 2946033648 | |||
| 759 | 2946039011 | |||
| 760 | 2946044345 | |||
| 761 | 2946051644 | |||
| 762 | 2946062792 | |||
| 763 | 2946065972 | |||
| 764 | 2946074296 | |||
| 765 | 2946080808 | |||
| 766 | 2947231432 | |||
| 767 | 2954000419 | |||
| 768 | 2954004687 | |||
| 769 | 2954388185 | |||
| 770 | 2954674918 | |||
| 771 | 2954689217 | |||
| 772 | 2954698990 | |||
| 773 | 2954703231 | |||
| 774 | 2954717944 | |||
| 775 | 2954727910 | |||
| 776 | 2954733894 | |||
| 777 | 2954746808 | |||
| 778 | 2954752777 | |||
| 779 | 2954765923 | |||
| 780 | 2964329676 | |||
| 781 | 2966604008 | |||
| 782 | 2966924810 | |||
| 783 | 2974296957 | |||
| 784 | 2974306935 | |||
| 785 | 2974326810 | |||
| 786 | 2977231146 | |||
| 787 | 2977239938 | |||
| 788 | 2977253754 | |||
| 789 | 2977266395 | |||
| 790 | 2984545790 | |||
| 791 | 2984554284 | |||
| 792 | 2984580933 | |||
| 793 | 2984594724 | |||
| 794 | 2990044626 | |||
| 795 | 2990066185 | |||
| 796 | 2990092317 | |||
| 797 | 2995465000 | |||
| 798 | 2995728105 | |||
| 799 | 2997458802 | |||
| 800 | 2997606840 | |||
| 801 | 3006323203 | |||
| 802 | 3006426337 | |||
| 803 | 3006486374 | |||
| 804 | 3006496632 | |||
| 805 | 8002812576 | |||
| 806 | 8004022751 | |||
| 807 | 8004029427 | |||
| 808 | 8004185044 | |||
| 809 | 8004214108 | |||
| 810 | 8008489252 | |||
| 811 | 8008561750 | |||
| 812 | 8008580382 | |||
| 813 | 8016257758 | |||
| 814 | 8023625062 | |||
| 815 | 8025418857 | |||
| 816 | 8025527583 | |||
| 817 | 8025535766 | |||
| 818 | 8033690061 | |||
| 819 | 8045830973 | |||
| 820 | 8047899864 | |||
| 821 | 8048130997 | |||
| 822 | 8048359066 | |||
| 823 | 8048376812 | |||
| 824 | 8048385865 | |||
| 825 | 8048411599 | |||
| 826 | 8053953936 | |||
| 827 | 8054110178 | |||
| 828 | 8054163431 | |||
| 829 | 8054612935 | |||
| 830 | 8055035886 | |||
| 831 | 8055038558 | |||
| 832 | 8055073331 | |||
| 833 | 8055174576 | |||
| 834 | 8056037553 | |||
| 835 | 8056451657 | |||
| 836 | 8056667566 | |||
| 837 | 8056833001 | |||
| 838 | 8057348683 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7f04-assembly1.cif.gz_A | cytochrome c-type biogenesis protein ccmabcd from e. coli in complex with heme and atp. | 0.8464 | 322 | 494 |
| 7ahd-assembly1.cif.gz_D | opua (e190q) occluded | 0.8366 | 320 | 520 |
| 3puy-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state | 0.8302 | 322 | 512 |
| 8ce5-assembly1.cif.gz_A | cytochrome c maturation complex ccmabcd, e154q, atp-bound | 0.8298 | 322 | 494 |
| 3pux-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 | 0.8292 | 322 | 512 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53164_14_297_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9658 | 14 | 282 | 3.40.50.300 |
| af_O53164_14_297_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9133 | 14 | 282 | 3.40.50.300 |
| af_O53915_4_138_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8753 | 136 | 248 | 3.40.50.300 |
| af_Q19554_376_618_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8719 | 298 | 524 | 3.40.50.300 |
| af_O53164_299_541_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8697 | 285 | 526 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9NSQ8-F1-model_v4 | ABC-F family ATP-binding cassette domain-containing protein | 0.9181 | 1 | 223 |
GO:0005524
GO:0016887 |
| AF-A0A3B8HDA8-F1-model_v4 | deleted | 0.9079 | 361 | 520 |
|
| AF-A0A7V9NSQ8-F1-model_v4 | ABC-F family ATP-binding cassette domain-containing protein | 0.8985 | 1 | 223 |
GO:0005524
GO:0016887 |
| AF-A0A7V0LTM1-F1-model_v4 | ABC-F family ATP-binding cassette domain-containing protein | 0.8964 | 347 | 509 |
GO:0005524
GO:0016887 |
| AF-A0A2D9RIA9-F1-model_v4 | Energy-dependent translational throttle protein EttA | 0.8953 | 2 | 253 |
GO:0000049
GO:0005524 GO:0006412 GO:0016887 GO:0019843 GO:0045900 |