F439562

General Info

Members Datasets Scaffolds Average Seq Length
419 247 838 298

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0126932|Ga0395900_0126932_33_1109
Length 346
Sequence VLADLLGSEDREGCNDLGKQCDHEDLERRLVSRSTPEGATAVAVAESDFSLASRRRPRWSRHRIAGATAPYALLAPAAAVIGAVLGYPLYLIARLSFEKYGLFELIRHKGTWIGLDNYTQIIHDSQFWRVLLRTVTFTVVNVSLTMVLGTAIALLLVRLGLFMRYLLTGALVFVWATPVVVAVDVWRWIVDPQFGIANWALTKLHIGDFVRHDWFVNPWSGFAVITALVVWGAIPFVAITVFAGLSQVPEELIEAAQIDGARPWNVFREVTLPLLKPIFVILTSLSIIWDFQVFNQIWIMLDQRPSPDYFTMSVYSFVESFRISEYGLGSAIFVYVRQMVKAGEVQ

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
124 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
125 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
138 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
156 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
159 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
160 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
218 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
219 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
246 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
247 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 5.25
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0126932 3300037418 Bacteria 2616
2 JGI25407J50210_10004477 3300003373 Bacteria 3399
3 JGI25405J52794_10004198 3300003911 Bacteria 2563
4 Ga0070658_10137560 3300005327 Bacteria 2039
5 Ga0070690_100016817 3300005330 Bacteria 4391
6 Ga0070666_10045509 3300005335 Bacteria 2942
7 Ga0070680_100033990 3300005336 Bacteria 4112
8 Ga0070682_100002923 3300005337 Bacteria 9475
9 Ga0068868_100008674 3300005338 Bacteria 7280
10 Ga0068868_100097538 3300005338 Bacteria 2375
11 Ga0070660_100004664 3300005339 Bacteria 9489
12 Ga0070689_100003436 3300005340 Bacteria 10539
13 Ga0070691_10014934 3300005341 Bacteria 3566
14 Ga0070687_100021659 3300005343 Bacteria 3026
15 Ga0070692_10004041 3300005345 Bacteria 6064
16 Ga0070692_10124434 3300005345 Bacteria 1442
17 Ga0070668_100092453 3300005347 Bacteria 2386
18 Ga0070671_100190586 3300005355 Bacteria 1738
19 Ga0070674_100005139 3300005356 Bacteria 7527
20 Ga0070674_100026293 3300005356 Bacteria 3799
21 Ga0070673_100010779 3300005364 Bacteria 6205
22 Ga0070688_100015012 3300005365 Bacteria 4397
23 Ga0070709_10020704 3300005434 Bacteria 3822
24 Ga0070709_10077226 3300005434 Bacteria 2164
25 Ga0070714_100044582 3300005435 Bacteria 3755
26 Ga0070714_100078992 3300005435 Bacteria 2860
27 Ga0070714_100079158 3300005435 Bacteria 2857
28 Ga0070714_100137096 3300005435 Bacteria 2193
29 Ga0070714_100296692 3300005435 Bacteria 1505
30 Ga0070713_100269152 3300005436 Bacteria 1560
31 Ga0070710_10006511 3300005437 Bacteria 5614
32 Ga0070710_10026659 3300005437 Bacteria 3073
33 Ga0070701_10001025 3300005438 Bacteria 10175
34 Ga0070711_100009875 3300005439 Bacteria 5887
35 Ga0070711_100012596 3300005439 Bacteria 5288
36 Ga0070705_100005715 3300005440 Bacteria 6074
37 Ga0070705_100035654 3300005440 Bacteria 2790
38 Ga0070705_100054453 3300005440 Bacteria 2347
39 Ga0070705_100085103 3300005440 Bacteria 1953
40 Ga0070700_100005425 3300005441 Bacteria 6752
41 Ga0070694_100025681 3300005444 Bacteria 3811
42 Ga0070694_100079979 3300005444 Bacteria 2270
43 Ga0070708_100006601 3300005445 Bacteria 9236
44 Ga0070708_100015189 3300005445 Bacteria 6350
45 Ga0070708_100027358 3300005445 Bacteria 4892
46 Ga0070708_100083003 3300005445 Bacteria 2903
47 Ga0070708_100113191 3300005445 Unclassified 2496
48 Ga0070663_100027525 3300005455 Bacteria 3862
49 Ga0070678_100011596 3300005456 Bacteria 5444
50 Ga0070678_100011739 3300005456 Bacteria 5417
51 Ga0070662_100178825 3300005457 Bacteria 1671
52 Ga0070662_100219971 3300005457 Bacteria 1515
53 Ga0068867_100004039 3300005459 Bacteria 10323
54 Ga0070706_100001012 3300005467 Bacteria 30500
55 Ga0070706_100008083 3300005467 Bacteria 9810
56 Ga0070706_100044834 3300005467 Bacteria 4085
57 Ga0070706_100468648 3300005467 Unclassified 1172
58 Ga0070707_100000555 3300005468 Bacteria 37476
59 Ga0070707_100061570 3300005468 Bacteria 3600
60 Ga0070707_100143753 3300005468 Bacteria 2321
61 Ga0070698_100014317 3300005471 Bacteria 8382
62 Ga0070698_100023215 3300005471 Bacteria 6484
63 Ga0070698_100035504 3300005471 Bacteria 5155
64 Ga0070699_100013925 3300005518 Bacteria 6917
65 Ga0070699_100042606 3300005518 Bacteria 3929
66 Ga0070699_100200882 3300005518 Bacteria 1772
67 Ga0070679_100106894 3300005530 Bacteria 2784
68 Ga0070697_100032687 3300005536 Bacteria 4188
69 Ga0070697_100074955 3300005536 Bacteria 2780
70 Ga0070697_100190212 3300005536 Bacteria 1742
71 Ga0070672_100159275 3300005543 Bacteria 1872
72 Ga0070696_100003163 3300005546 Bacteria 10963
73 Ga0070696_100241066 3300005546 Bacteria 1364
74 Ga0070693_100005399 3300005547 Bacteria 6132
75 Ga0070704_100013553 3300005549 Bacteria 5062
76 Ga0070704_100072414 3300005549 Bacteria 2507
77 Ga0068855_100067493 3300005563 Bacteria 4166
78 Ga0068855_100092595 3300005563 Bacteria 3486
79 Ga0068856_100014205 3300005614 Bacteria 7697
80 Ga0070702_100016026 3300005615 Bacteria 3839
81 Ga0068852_100009238 3300005616 Bacteria 7305
82 Ga0068866_10001538 3300005718 Bacteria 9797
83 Ga0068861_100291443 3300005719 Bacteria 1409
84 Ga0081455_10001095 3300005937 Bacteria 33996
85 Ga0081455_10039025 3300005937 Bacteria 4201
86 Ga0081455_10061430 3300005937 Bacteria 3161
87 Ga0081538_10000290 3300005981 Bacteria 57591
88 Ga0081540_1005151 3300005983 Bacteria 9786
89 Ga0070717_10051160 3300006028 Bacteria 3399
90 Ga0075432_10011824 3300006058 Bacteria 2967
91 Ga0070715_10007970 3300006163 Bacteria 3671
92 Ga0070715_10036151 3300006163 Bacteria 2036
93 Ga0070716_100016041 3300006173 Bacteria 3861
94 Ga0070712_100006792 3300006175 Bacteria 7120
95 Ga0070712_100008572 3300006175 Bacteria 6434
96 Ga0070712_100022479 3300006175 Bacteria 4155
97 Ga0070712_100187937 3300006175 Bacteria 1614
98 Ga0068871_100005748 3300006358 Bacteria 8705
99 Ga0068871_100039756 3300006358 Bacteria 3766
100 Ga0075428_100019610 3300006844 Bacteria 7482
101 Ga0075428_100159890 3300006844 Bacteria 2445
102 Ga0075428_100176508 3300006844 Bacteria 2313
103 Ga0075431_100058491 3300006847 Bacteria 3979
104 Ga0075431_100189283 3300006847 Bacteria 2109
105 Ga0075431_100335707 3300006847 Bacteria 1522
106 Ga0075433_10103635 3300006852 Bacteria 2520
107 Ga0075434_100061838 3300006871 Bacteria 3726
108 Ga0075434_100232692 3300006871 Bacteria 1862
109 Ga0075434_100307017 3300006871 Bacteria 1607
110 Ga0075429_100055316 3300006880 Bacteria 3453
111 Ga0068865_100007746 3300006881 Bacteria 6621
112 Ga0068865_100221424 3300006881 Bacteria 1480
113 Ga0075436_100046239 3300006914 Bacteria 3002
114 Ga0075435_100090913 3300007076 Bacteria 2518
115 Ga0075435_100286850 3300007076 Bacteria 1406
116 Ga0105240_10269618 3300009093 Unclassified 1960
117 Ga0111539_10009854 3300009094 Bacteria 12056
118 Ga0111539_10055916 3300009094 Bacteria 4691
119 Ga0105245_10040412 3300009098 Bacteria 4155
120 Ga0105245_10150647 3300009098 Bacteria 2199
121 Ga0114129_10023253 3300009147 Bacteria 8791
122 Ga0114129_10059410 3300009147 Bacteria 5345
123 Ga0114129_10089665 3300009147 Bacteria 4263
124 Ga0114129_10828288 3300009147 Unclassified 1178
125 Ga0105243_10009550 3300009148 Bacteria 7385
126 Ga0105241_10009560 3300009174 Bacteria 7127
127 Ga0105241_10018056 3300009174 Bacteria 5185
128 Ga0105242_10003117 3300009176 Bacteria 12934
129 Ga0105242_10386485 3300009176 Bacteria 1302
130 Ga0105248_10018884 3300009177 Bacteria 7623
131 Ga0105237_10056783 3300009545 Bacteria 3917
132 Ga0105238_10039088 3300009551 Bacteria 4813
133 Ga0105249_10004585 3300009553 Bacteria 11943
134 Ga0105249_10051204 3300009553 Bacteria 3766
135 Ga0105239_10014371 3300010375 Bacteria 8785
136 Ga0157374_10002122 3300013296 Bacteria 16690
137 Ga0163162_10012727 3300013306 Bacteria 8217
138 Ga0157372_10530628 3300013307 Bacteria 1372
139 Ga0157380_10017492 3300014326 Bacteria 5306
140 Ga0182008_10037730 3300014497 Bacteria 2417
141 Ga0157377_10009614 3300014745 Bacteria 4754
142 Ga0157376_10008815 3300014969 Bacteria 7298
143 Ga0157376_10765708 3300014969 Bacteria 976
144 Ga0182006_1019773 3300015261 Bacteria 2831
145 Ga0182007_10012957 3300015262 Bacteria 3194
146 Ga0163161_10154422 3300017792 Bacteria 1746
147 Ga0207653_10020760 3300025885 Bacteria 2081
148 Ga0207692_10005418 3300025898 Bacteria 5110
149 Ga0207692_10052629 3300025898 Bacteria 2070
150 Ga0207642_10001340 3300025899 Bacteria 7625
151 Ga0207699_10047233 3300025906 Bacteria 2523
152 Ga0207699_10060512 3300025906 Bacteria 2274
153 Ga0207684_10004072 3300025910 Bacteria 13947
154 Ga0207684_10073158 3300025910 Bacteria 2911
155 Ga0207684_10094732 3300025910 Bacteria 2547
156 Ga0207654_10048265 3300025911 Bacteria 2436
157 Ga0207671_10070962 3300025914 Bacteria 2597
158 Ga0207693_10001615 3300025915 Bacteria 19912
159 Ga0207693_10019747 3300025915 Bacteria 5357
160 Ga0207693_10029554 3300025915 Bacteria 4327
161 Ga0207663_10228464 3300025916 Bacteria 1358
162 Ga0207660_10022469 3300025917 Bacteria 4250
163 Ga0207662_10035473 3300025918 Bacteria 2913
164 Ga0207657_10048015 3300025919 Bacteria 3729
165 Ga0207646_10003077 3300025922 Bacteria 19179
166 Ga0207646_10017429 3300025922 Bacteria 6723
167 Ga0207646_10044156 3300025922 Bacteria 4000
168 Ga0207646_10170085 3300025922 Bacteria 1968
169 Ga0207664_10053377 3300025929 Bacteria 3199
170 Ga0207664_10088923 3300025929 Bacteria 2528
171 Ga0207664_10097287 3300025929 Bacteria 2424
172 Ga0207644_10010013 3300025931 Bacteria 6241
173 Ga0207690_10144438 3300025932 Bacteria 1757
174 Ga0207706_10178294 3300025933 Bacteria 1866
175 Ga0207706_10281171 3300025933 Bacteria 1451
176 Ga0207686_10000935 3300025934 Bacteria 17459
177 Ga0207709_10000846 3300025935 Bacteria 23440
178 Ga0207669_10017577 3300025937 Bacteria 3673
179 Ga0207665_10028684 3300025939 Bacteria 3678
180 Ga0207665_10031797 3300025939 Bacteria 3493
181 Ga0207665_10077910 3300025939 Bacteria 2276
182 Ga0207691_10009101 3300025940 Bacteria 9530
183 Ga0207691_10193185 3300025940 Bacteria 1775
184 Ga0207711_10010153 3300025941 Bacteria 7818
185 Ga0207651_10089963 3300025960 Bacteria 2243
186 Ga0207712_10004666 3300025961 Bacteria 8660
187 Ga0207640_10114519 3300025981 Bacteria 1919
188 Ga0207639_10021310 3300026041 Bacteria 4653
189 Ga0207708_10004143 3300026075 Bacteria 10666
190 Ga0207702_10015563 3300026078 Bacteria 6295
191 Ga0207648_10002386 3300026089 Bacteria 20220
192 Ga0207675_100117397 3300026118 Bacteria 2516
193 Ga0207683_10000699 3300026121 Bacteria 30634
194 Ga0207683_10010861 3300026121 Bacteria 7766
195 Ga0207683_10033890 3300026121 Bacteria 4437
196 Ga0207428_10021744 3300027907 Bacteria 5426
197 Ga0207428_10022533 3300027907 Bacteria 5313
198 Ga0268266_10006426 3300028379 Bacteria 10766
199 Ga0265337_1013189 3300028556 Bacteria 2784
200 Ga0265318_10010032 3300028577 Bacteria 4142
201 Ga0265322_10003153 3300028654 Bacteria 5020
202 Ga0265338_10020050 3300028800 Bacteria 7051
203 Ga0265338_10036263 3300028800 Bacteria 4722
204 Ga0265320_10022824 3300031240 Bacteria 3341
205 Ga0265325_10153201 3300031241 Bacteria 1089
206 Ga0265340_10016337 3300031247 Bacteria 3845
207 Ga0265339_10002166 3300031249 Bacteria 14244
208 Ga0265339_10003979 3300031249 Bacteria 10206
209 Ga0265327_10014936 3300031251 Bacteria 5052
210 Ga0265316_10115195 3300031344 Bacteria 2032
211 Ga0265314_10004523 3300031711 Bacteria 12859
212 Ga0265314_10008670 3300031711 Bacteria 8696
213 Ga0265314_10020491 3300031711 Bacteria 5104
214 Ga0265342_10028328 3300031712 Bacteria 3492
215 Ga0265342_10189871 3300031712 Bacteria 1122
216 Ga0307406_10052685 3300031901 Bacteria 2589
217 Ga0307416_100341987 3300032002 Bacteria 1509
218 Ga0373930_0004566 3300034816 Bacteria 2262
219 Ga0373948_0001364 3300034817 Bacteria 3360
220 Ga0373951_0004676 3300035091 Bacteria 3240
221 Ga0373952_0003812 3300035092 Bacteria 2732
222 Ga0373932_0009291 3300035112 Bacteria 2362
223 Ga0373942_0005712 3300035207 Bacteria 2883
224 Ga0373961_0002368 3300035241 Bacteria 4917
225 Ga0373931_0004018 3300035691 Bacteria 6663
226 Ga0373937_0000364 3300036401 Bacteria 42155
227 Ga0395899_0002773 3300037312 Bacteria 14135
228 Ga0395899_0007674 3300037312 Bacteria 8319
229 Ga0395899_0015554 3300037312 Bacteria 5802
230 Ga0395899_0019839 3300037312 Bacteria 5101
231 Ga0395899_0051485 3300037312 Bacteria 3056
232 Ga0395900_0002588 3300037418 Bacteria 19786
233 Ga0395900_0002780 3300037418 Bacteria 19127
234 Ga0395900_0009795 3300037418 Bacteria 9819
235 Ga0395900_0024880 3300037418 Bacteria 6127
236 Ga0395900_0028288 3300037418 Bacteria 5742
237 Ga0395900_0056132 3300037418 Bacteria 4054
238 Ga0395900_0056253 3300037418 Bacteria 4050
239 Ga0395900_0061571 3300037418 Bacteria 3858
240 Ga0395900_0133458 3300037418 Bacteria 2543
241 Ga0395900_0241424 3300037418 Bacteria 1812
242 Ga0395898_0014303 3300037466 Bacteria 8155
243 Ga0395898_0022467 3300037466 Bacteria 6388
244 Ga0395898_0036343 3300037466 Bacteria 4890
245 Ga0395898_0064656 3300037466 Bacteria 3548
246 Ga0395898_0081867 3300037466 Bacteria 3112
247 Ga0395898_0143405 3300037466 Bacteria 2286
248 Ga0395898_0161309 3300037466 Bacteria 2144
249 Ga0395898_0217926 3300037466 Bacteria 1821
250 Ga0395905_0001294 3300037471 Bacteria 30743
251 Ga0395905_0002972 3300037471 Bacteria 18423
252 Ga0395905_0003235 3300037471 Bacteria 17515
253 Ga0395905_0005622 3300037471 Bacteria 12758
254 Ga0395905_0026122 3300037471 Bacteria 5507
255 Ga0395905_0027213 3300037471 Bacteria 5392
256 Ga0395905_0047230 3300037471 Bacteria 4036
257 Ga0395905_0104552 3300037471 Unclassified 2658
258 Ga0395905_0200106 3300037471 Bacteria 1873
259 Ga0395901_0002205 3300038443 Bacteria 19868
260 Ga0395901_0002502 3300038443 Bacteria 18607
261 Ga0395901_0002634 3300038443 Bacteria 18147
262 Ga0395901_0019699 3300038443 Bacteria 6897
263 Ga0395901_0028318 3300038443 Bacteria 5761
264 Ga0395901_0033048 3300038443 Bacteria 5338
265 Ga0395901_0048743 3300038443 Bacteria 4399
266 Ga0395901_0067735 3300038443 Bacteria 3718
267 Ga0395901_0100466 3300038443 Bacteria 3034
268 Ga0395901_0175673 3300038443 Unclassified 2247
269 Ga0395901_0178873 3300038443 Bacteria 2225
270 Ga0395901_0262616 3300038443 Bacteria 1797
271 Ga0395901_0401941 3300038443 Bacteria 1407
272 Ga0395901_0435667 3300038443 Bacteria 1342
273 Ga0439466_0087585 3300041411 Bacteria 978
274 Ga0451795_0375466 3300041456 Bacteria 1277
275 Ga0451853_1591041 3300041512 Unclassified 2311
276 Ga0439455_0037844 3300042012 Bacteria 1225
277 Ga0439446_0014927 3300042156 Bacteria 2149
278 Ga0439446_0098929 3300042156 Bacteria 920
279 Ga0450893_0014826 3300042532 Bacteria 1310
280 Ga0453683_0185189 3300044673 Bacteria 1321
281 Ga0466966_0053195 3300044684 Bacteria 2569
282 Ga0466963_0010107 3300044694 Bacteria 5707
283 Ga0466964_0132049 3300044706 Bacteria 1138
284 Ga0466960_0030293 3300044901 Bacteria 2489
285 Ga0451576_0012434 3300045051 Bacteria 9560
286 Ga0466967_0060595 3300045976 Bacteria 3354
287 Ga0466967_0157902 3300045976 Bacteria 2126
288 Ga0495592_0000050 3300046454 Bacteria 111971
289 Ga0495592_0005364 3300046454 Bacteria 9464
290 Ga0495651_0000004 3300046462 Bacteria 177080
291 Ga0495651_0175896 3300046462 Bacteria 1519
292 Ga0495653_0000918 3300046463 Bacteria 22803
293 Ga0495664_0088140 3300046477 Bacteria 1865
294 Ga0495608_0023767 3300046511 Bacteria 4195
295 Ga0495618_0002772 3300046514 Bacteria 11140
296 Ga0495628_0001466 3300046516 Bacteria 21651
297 Ga0495628_0016703 3300046516 Bacteria 6119
298 Ga0495630_0016043 3300046517 Bacteria 5475
299 Ga0495631_0068423 3300046518 Unclassified 1536
300 Ga0495644_0038962 3300046523 Bacteria 1792
301 Ga0495663_0029858 3300046525 Bacteria 1612
302 Ga0495652_0000047 3300046529 Bacteria 121525
303 Ga0495586_0008813 3300046535 Bacteria 5374
304 Ga0495587_0000103 3300046536 Bacteria 64471
305 Ga0495587_0023663 3300046536 Bacteria 3773
306 Ga0495645_0000028 3300046543 Bacteria 113461
307 Ga0495645_0026475 3300046543 Bacteria 4209
308 Ga0495656_0044459 3300046615 Bacteria 1870
309 Ga0495657_0026379 3300046675 Bacteria 4114
310 Ga0495599_0000059 3300046678 Bacteria 75747
311 Ga0495599_0007088 3300046678 Bacteria 6786
312 Ga0495623_0000082 3300046679 Bacteria 56315
313 Ga0495646_0001107 3300046680 Bacteria 15705
314 Ga0495604_0000489 3300047317 Bacteria 34803
315 Ga0495674_0080822 3300047319 Bacteria 2789
316 Ga0495680_0008086 3300047322 Bacteria 9590
317 Ga0495675_0000020 3300047444 Bacteria 111526
318 Ga0495602_0002220 3300048088 Bacteria 19610
319 Ga0496100_0020775 3300048903 Bacteria 3943
320 Ga0496100_0077533 3300048903 Bacteria 2234
321 Ga0496101_0019841 3300048904 Bacteria 4596
322 Ga0496103_0005371 3300048906 Bacteria 7674
323 Ga0496104_0068064 3300048907 Bacteria 3383
324 Ga0496105_0007136 3300048908 Bacteria 8618
325 Ga0496107_0004412 3300048910 Bacteria 9530
326 Ga0496107_0017142 3300048910 Bacteria 5094
327 Ga0496108_0008971 3300048911 Bacteria 8106
328 Ga0496108_0032854 3300048911 Bacteria 4310
329 Ga0496109_0024800 3300048912 Bacteria 5335
330 Ga0496109_0123451 3300048912 Bacteria 2413
331 Ga0496109_0132959 3300048912 Bacteria 2323
332 Ga0496111_0058530 3300048914 Bacteria 2790
333 Ga0496112_0004413 3300048915 Bacteria 11909
334 Ga0496112_0033133 3300048915 Bacteria 5019
335 Ga0496112_0331950 3300048915 Bacteria 1464
336 Ga0496113_0013041 3300048916 Bacteria 5610
337 Ga0496114_0009217 3300048917 Bacteria 7827
338 Ga0496114_0117545 3300048917 Bacteria 2284
339 Ga0496115_0005145 3300048918 Bacteria 9513
340 Ga0501031_0005206 3300049568 Bacteria 8476
341 Ga0501032_0026808 3300049569 Bacteria 3961
342 Ga0501033_0013910 3300049570 Bacteria 6124
343 Ga0501036_0006204 3300049572 Bacteria 9699
344 Ga0501036_0071039 3300049572 Bacteria 2943
345 Ga0501037_0006232 3300049573 Bacteria 8722
346 Ga0501037_0012717 3300049573 Bacteria 6200
347 Ga0501038_0263085 3300049574 Bacteria 1362
348 Ga0501039_0013127 3300049575 Bacteria 6333
349 Ga0501039_0034136 3300049575 Bacteria 3925
350 Ga0501040_0018358 3300049576 Bacteria 4642
351 Ga0501041_0043738 3300049577 Bacteria 2722
352 Ga0501043_0008576 3300049579 Bacteria 8058
353 Ga0501046_0000786 3300049580 Bacteria 30692
354 Ga0501046_0016331 3300049580 Bacteria 6220
355 Ga0501046_0030586 3300049580 Bacteria 4369
356 Ga0501047_0034285 3300049581 Bacteria 4901
357 Ga0501047_0064243 3300049581 Bacteria 3540
358 Ga0501048_0001256 3300049582 Bacteria 19159
359 Ga0501048_0019701 3300049582 Bacteria 4947
360 Ga0501048_0024022 3300049582 Bacteria 4452
361 Ga0501068_0000312 3300049584 Bacteria 24322
362 Ga0501069_0002072 3300049585 Bacteria 10088
363 Ga0501070_0009723 3300049586 Bacteria 8132
364 Ga0501073_0022777 3300049589 Bacteria 4506
365 Ga0501074_0080522 3300049590 Bacteria 2336
366 Ga0501074_0101679 3300049590 Bacteria 2057
367 Ga0501074_0224901 3300049590 Bacteria 1336
368 Ga0501075_0013513 3300049591 Bacteria 5828
369 Ga0501077_0015134 3300049593 Bacteria 4850
370 Ga0501077_0050680 3300049593 Bacteria 2638
371 Ga0501079_0003092 3300049741 Bacteria 12183
372 Ga0501080_0007079 3300049742 Bacteria 10131
373 Ga0501081_0001718 3300049743 Bacteria 13595
374 Ga0501083_0005423 3300049744 Bacteria 9033
375 Ga0501035_0012427 3300049822 Bacteria 7870
376 Ga0501035_0093060 3300049822 Bacteria 2652
377 Ga0501035_0216789 3300049822 Bacteria 1636
378 Ga0501044_0065962 3300049823 Bacteria 3691
379 Ga0501044_0156747 3300049823 Bacteria 2256
380 Ga0501045_0002214 3300049824 Bacteria 13191
381 nmdc:mga03683_69246_c1 3300050489 Bacteria 1505
382 nmdc:mga0yw44_193190_c1 3300050492 Bacteria 1343
383 nmdc:mga05p37_36558_c1 3300050507 Bacteria 6024
384 nmdc:mga05p37_372209_c1 3300050507 Bacteria 1676
385 nmdc:mga05p37_42135_c1 3300050507 Bacteria 5609
386 nmdc:mga05p37_58101_c1 3300050507 Bacteria 4764
387 nmdc:mga05p37_660311_c1 3300050507 Unclassified 1169
388 nmdc:mga09592_59166_c1 3300050508 Bacteria 3239
389 nmdc:mga0qj67_445673_c1 3300050509 Bacteria 1043
390 nmdc:mga06r32_100716_c1 3300050510 Bacteria 2834
391 nmdc:mga06r32_13549_c1 3300050510 Bacteria 7389
392 nmdc:mga08y16_20188_c1 3300050511 Bacteria 7032
393 nmdc:mga08y16_52483_c1 3300050511 Bacteria 4266
394 nmdc:mga0n895_155304_c1 3300050512 Bacteria 2319
395 nmdc:mga0n895_463_c1 3300050512 Bacteria 27175
396 nmdc:mga0n895_54363_c1 3300050512 Bacteria 3938
397 nmdc:mga0n895_65348_c1 3300050512 Bacteria 3601
398 nmdc:mga0rr50_110887_c1 3300050513 Bacteria 2171
399 nmdc:mga08x19_11697_c1 3300050514 Bacteria 5286
400 nmdc:mga08x19_163492_c1 3300050514 Bacteria 1513
401 nmdc:mga08x19_48707_c1 3300050514 Bacteria 2715
402 nmdc:mga0a205_304036_c1 3300050515 Bacteria 1467
403 nmdc:mga0a205_3324_c1 3300050515 Bacteria 14321
404 nmdc:mga0a205_38220_c1 3300050515 Bacteria 4617
405 nmdc:mga0a205_50148_c1 3300050515 Bacteria 4029
406 Ga0495601_0001606 3300053077 Bacteria 12464
407 Ga0495595_0006237 3300053084 Bacteria 4853
408 Ga0495595_0024023 3300053084 Bacteria 2689
409 Ga0495619_0003277 3300053085 Bacteria 10468
410 Ga0495619_0132176 3300053085 Bacteria 1715
411 Ga0501084_0007630 3300054114 Bacteria 8920
412 Ga0501084_0045290 3300054114 Bacteria 3684
413 Ga0501084_0266700 3300054114 Bacteria 1445
414 Ga0501082_0016349 3300060353 Bacteria 6387
415 Ga0501082_0021305 3300060353 Bacteria 5591
416 Ga0530510_0104965 3300061734 Bacteria 2068
417 2644017588 2643221601 Bacteria 7493239
418 2644173452 2643221631 Bacteria 8168043
419 8001784599 8001781756 Bacteria 9586736
420 Ga0395900_0126932
421 JGI25407J50210_10004477
422 JGI25405J52794_10004198
423 Ga0070658_10137560
424 Ga0070690_100016817
425 Ga0070666_10045509
426 Ga0070680_100033990
427 Ga0070682_100002923
428 Ga0068868_100008674
429 Ga0068868_100097538
430 Ga0070660_100004664
431 Ga0070689_100003436
432 Ga0070691_10014934
433 Ga0070687_100021659
434 Ga0070692_10004041
435 Ga0070692_10124434
436 Ga0070668_100092453
437 Ga0070671_100190586
438 Ga0070674_100005139
439 Ga0070674_100026293
440 Ga0070673_100010779
441 Ga0070688_100015012
442 Ga0070709_10020704
443 Ga0070709_10077226
444 Ga0070714_100044582
445 Ga0070714_100078992
446 Ga0070714_100079158
447 Ga0070714_100137096
448 Ga0070714_100296692
449 Ga0070713_100269152
450 Ga0070710_10006511
451 Ga0070710_10026659
452 Ga0070701_10001025
453 Ga0070711_100009875
454 Ga0070711_100012596
455 Ga0070705_100005715
456 Ga0070705_100035654
457 Ga0070705_100054453
458 Ga0070705_100085103
459 Ga0070700_100005425
460 Ga0070694_100025681
461 Ga0070694_100079979
462 Ga0070708_100006601
463 Ga0070708_100015189
464 Ga0070708_100027358
465 Ga0070708_100083003
466 Ga0070708_100113191
467 Ga0070663_100027525
468 Ga0070678_100011596
469 Ga0070678_100011739
470 Ga0070662_100178825
471 Ga0070662_100219971
472 Ga0068867_100004039
473 Ga0070706_100001012
474 Ga0070706_100008083
475 Ga0070706_100044834
476 Ga0070706_100468648
477 Ga0070707_100000555
478 Ga0070707_100061570
479 Ga0070707_100143753
480 Ga0070698_100014317
481 Ga0070698_100023215
482 Ga0070698_100035504
483 Ga0070699_100013925
484 Ga0070699_100042606
485 Ga0070699_100200882
486 Ga0070679_100106894
487 Ga0070697_100032687
488 Ga0070697_100074955
489 Ga0070697_100190212
490 Ga0070672_100159275
491 Ga0070696_100003163
492 Ga0070696_100241066
493 Ga0070693_100005399
494 Ga0070704_100013553
495 Ga0070704_100072414
496 Ga0068855_100067493
497 Ga0068855_100092595
498 Ga0068856_100014205
499 Ga0070702_100016026
500 Ga0068852_100009238
501 Ga0068866_10001538
502 Ga0068861_100291443
503 Ga0081455_10001095
504 Ga0081455_10039025
505 Ga0081455_10061430
506 Ga0081538_10000290
507 Ga0081540_1005151
508 Ga0070717_10051160
509 Ga0075432_10011824
510 Ga0070715_10007970
511 Ga0070715_10036151
512 Ga0070716_100016041
513 Ga0070712_100006792
514 Ga0070712_100008572
515 Ga0070712_100022479
516 Ga0070712_100187937
517 Ga0068871_100005748
518 Ga0068871_100039756
519 Ga0075428_100019610
520 Ga0075428_100159890
521 Ga0075428_100176508
522 Ga0075431_100058491
523 Ga0075431_100189283
524 Ga0075431_100335707
525 Ga0075433_10103635
526 Ga0075434_100061838
527 Ga0075434_100232692
528 Ga0075434_100307017
529 Ga0075429_100055316
530 Ga0068865_100007746
531 Ga0068865_100221424
532 Ga0075436_100046239
533 Ga0075435_100090913
534 Ga0075435_100286850
535 Ga0105240_10269618
536 Ga0111539_10009854
537 Ga0111539_10055916
538 Ga0105245_10040412
539 Ga0105245_10150647
540 Ga0114129_10023253
541 Ga0114129_10059410
542 Ga0114129_10089665
543 Ga0114129_10828288
544 Ga0105243_10009550
545 Ga0105241_10009560
546 Ga0105241_10018056
547 Ga0105242_10003117
548 Ga0105242_10386485
549 Ga0105248_10018884
550 Ga0105237_10056783
551 Ga0105238_10039088
552 Ga0105249_10004585
553 Ga0105249_10051204
554 Ga0105239_10014371
555 Ga0157374_10002122
556 Ga0163162_10012727
557 Ga0157372_10530628
558 Ga0157380_10017492
559 Ga0182008_10037730
560 Ga0157377_10009614
561 Ga0157376_10008815
562 Ga0157376_10765708
563 Ga0182006_1019773
564 Ga0182007_10012957
565 Ga0163161_10154422
566 Ga0207653_10020760
567 Ga0207692_10005418
568 Ga0207692_10052629
569 Ga0207642_10001340
570 Ga0207699_10047233
571 Ga0207699_10060512
572 Ga0207684_10004072
573 Ga0207684_10073158
574 Ga0207684_10094732
575 Ga0207654_10048265
576 Ga0207671_10070962
577 Ga0207693_10001615
578 Ga0207693_10019747
579 Ga0207693_10029554
580 Ga0207663_10228464
581 Ga0207660_10022469
582 Ga0207662_10035473
583 Ga0207657_10048015
584 Ga0207646_10003077
585 Ga0207646_10017429
586 Ga0207646_10044156
587 Ga0207646_10170085
588 Ga0207664_10053377
589 Ga0207664_10088923
590 Ga0207664_10097287
591 Ga0207644_10010013
592 Ga0207690_10144438
593 Ga0207706_10178294
594 Ga0207706_10281171
595 Ga0207686_10000935
596 Ga0207709_10000846
597 Ga0207669_10017577
598 Ga0207665_10028684
599 Ga0207665_10031797
600 Ga0207665_10077910
601 Ga0207691_10009101
602 Ga0207691_10193185
603 Ga0207711_10010153
604 Ga0207651_10089963
605 Ga0207712_10004666
606 Ga0207640_10114519
607 Ga0207639_10021310
608 Ga0207708_10004143
609 Ga0207702_10015563
610 Ga0207648_10002386
611 Ga0207675_100117397
612 Ga0207683_10000699
613 Ga0207683_10010861
614 Ga0207683_10033890
615 Ga0207428_10021744
616 Ga0207428_10022533
617 Ga0268266_10006426
618 Ga0265337_1013189
619 Ga0265318_10010032
620 Ga0265322_10003153
621 Ga0265338_10020050
622 Ga0265338_10036263
623 Ga0265320_10022824
624 Ga0265325_10153201
625 Ga0265340_10016337
626 Ga0265339_10002166
627 Ga0265339_10003979
628 Ga0265327_10014936
629 Ga0265316_10115195
630 Ga0265314_10004523
631 Ga0265314_10008670
632 Ga0265314_10020491
633 Ga0265342_10028328
634 Ga0265342_10189871
635 Ga0307406_10052685
636 Ga0307416_100341987
637 Ga0373930_0004566
638 Ga0373948_0001364
639 Ga0373951_0004676
640 Ga0373952_0003812
641 Ga0373932_0009291
642 Ga0373942_0005712
643 Ga0373961_0002368
644 Ga0373931_0004018
645 Ga0373937_0000364
646 Ga0395899_0002773
647 Ga0395899_0007674
648 Ga0395899_0015554
649 Ga0395899_0019839
650 Ga0395899_0051485
651 Ga0395900_0002588
652 Ga0395900_0002780
653 Ga0395900_0009795
654 Ga0395900_0024880
655 Ga0395900_0028288
656 Ga0395900_0056132
657 Ga0395900_0056253
658 Ga0395900_0061571
659 Ga0395900_0133458
660 Ga0395900_0241424
661 Ga0395898_0014303
662 Ga0395898_0022467
663 Ga0395898_0036343
664 Ga0395898_0064656
665 Ga0395898_0081867
666 Ga0395898_0143405
667 Ga0395898_0161309
668 Ga0395898_0217926
669 Ga0395905_0001294
670 Ga0395905_0002972
671 Ga0395905_0003235
672 Ga0395905_0005622
673 Ga0395905_0026122
674 Ga0395905_0027213
675 Ga0395905_0047230
676 Ga0395905_0104552
677 Ga0395905_0200106
678 Ga0395901_0002205
679 Ga0395901_0002502
680 Ga0395901_0002634
681 Ga0395901_0019699
682 Ga0395901_0028318
683 Ga0395901_0033048
684 Ga0395901_0048743
685 Ga0395901_0067735
686 Ga0395901_0100466
687 Ga0395901_0175673
688 Ga0395901_0178873
689 Ga0395901_0262616
690 Ga0395901_0401941
691 Ga0395901_0435667
692 Ga0439466_0087585
693 Ga0451795_0375466
694 Ga0451853_1591041
695 Ga0439455_0037844
696 Ga0439446_0014927
697 Ga0439446_0098929
698 Ga0450893_0014826
699 Ga0453683_0185189
700 Ga0466966_0053195
701 Ga0466963_0010107
702 Ga0466964_0132049
703 Ga0466960_0030293
704 Ga0451576_0012434
705 Ga0466967_0060595
706 Ga0466967_0157902
707 Ga0495592_0000050
708 Ga0495592_0005364
709 Ga0495651_0000004
710 Ga0495651_0175896
711 Ga0495653_0000918
712 Ga0495664_0088140
713 Ga0495608_0023767
714 Ga0495618_0002772
715 Ga0495628_0001466
716 Ga0495628_0016703
717 Ga0495630_0016043
718 Ga0495631_0068423
719 Ga0495644_0038962
720 Ga0495663_0029858
721 Ga0495652_0000047
722 Ga0495586_0008813
723 Ga0495587_0000103
724 Ga0495587_0023663
725 Ga0495645_0000028
726 Ga0495645_0026475
727 Ga0495656_0044459
728 Ga0495657_0026379
729 Ga0495599_0000059
730 Ga0495599_0007088
731 Ga0495623_0000082
732 Ga0495646_0001107
733 Ga0495604_0000489
734 Ga0495674_0080822
735 Ga0495680_0008086
736 Ga0495675_0000020
737 Ga0495602_0002220
738 Ga0496100_0020775
739 Ga0496100_0077533
740 Ga0496101_0019841
741 Ga0496103_0005371
742 Ga0496104_0068064
743 Ga0496105_0007136
744 Ga0496107_0004412
745 Ga0496107_0017142
746 Ga0496108_0008971
747 Ga0496108_0032854
748 Ga0496109_0024800
749 Ga0496109_0123451
750 Ga0496109_0132959
751 Ga0496111_0058530
752 Ga0496112_0004413
753 Ga0496112_0033133
754 Ga0496112_0331950
755 Ga0496113_0013041
756 Ga0496114_0009217
757 Ga0496114_0117545
758 Ga0496115_0005145
759 Ga0501031_0005206
760 Ga0501032_0026808
761 Ga0501033_0013910
762 Ga0501036_0006204
763 Ga0501036_0071039
764 Ga0501037_0006232
765 Ga0501037_0012717
766 Ga0501038_0263085
767 Ga0501039_0013127
768 Ga0501039_0034136
769 Ga0501040_0018358
770 Ga0501041_0043738
771 Ga0501043_0008576
772 Ga0501046_0000786
773 Ga0501046_0016331
774 Ga0501046_0030586
775 Ga0501047_0034285
776 Ga0501047_0064243
777 Ga0501048_0001256
778 Ga0501048_0019701
779 Ga0501048_0024022
780 Ga0501068_0000312
781 Ga0501069_0002072
782 Ga0501070_0009723
783 Ga0501073_0022777
784 Ga0501074_0080522
785 Ga0501074_0101679
786 Ga0501074_0224901
787 Ga0501075_0013513
788 Ga0501077_0015134
789 Ga0501077_0050680
790 Ga0501079_0003092
791 Ga0501080_0007079
792 Ga0501081_0001718
793 Ga0501083_0005423
794 Ga0501035_0012427
795 Ga0501035_0093060
796 Ga0501035_0216789
797 Ga0501044_0065962
798 Ga0501044_0156747
799 Ga0501045_0002214
800 nmdc:mga03683_69246_c1
801 nmdc:mga0yw44_193190_c1
802 nmdc:mga05p37_36558_c1
803 nmdc:mga05p37_372209_c1
804 nmdc:mga05p37_42135_c1
805 nmdc:mga05p37_58101_c1
806 nmdc:mga05p37_660311_c1
807 nmdc:mga09592_59166_c1
808 nmdc:mga0qj67_445673_c1
809 nmdc:mga06r32_100716_c1
810 nmdc:mga06r32_13549_c1
811 nmdc:mga08y16_20188_c1
812 nmdc:mga08y16_52483_c1
813 nmdc:mga0n895_155304_c1
814 nmdc:mga0n895_463_c1
815 nmdc:mga0n895_54363_c1
816 nmdc:mga0n895_65348_c1
817 nmdc:mga0rr50_110887_c1
818 nmdc:mga08x19_11697_c1
819 nmdc:mga08x19_163492_c1
820 nmdc:mga08x19_48707_c1
821 nmdc:mga0a205_304036_c1
822 nmdc:mga0a205_3324_c1
823 nmdc:mga0a205_38220_c1
824 nmdc:mga0a205_50148_c1
825 Ga0495601_0001606
826 Ga0495595_0006237
827 Ga0495595_0024023
828 Ga0495619_0003277
829 Ga0495619_0132176
830 Ga0501084_0007630
831 Ga0501084_0045290
832 Ga0501084_0266700
833 Ga0501082_0016349
834 Ga0501082_0021305
835 Ga0530510_0104965
836 2644017588
837 2644173452
838 8001784599

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

145

292

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9277 20 305
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9185 21 305
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.9149 20 304
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9149 20 305
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.9018 17 307
ID Description Score Start End Superfamily
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9435 68 309 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9358 68 309 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9337 68 311 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9276 68 309 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9274 17 304 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1Q7DLD3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9854 27 313 GO:0005886
GO:0055085
AF-A0A6G3A8A5-F1-model_v4 ABC transporter permease subunit 0.9809 43 314 GO:0005886
GO:0055085
AF-A0A6I6SIL2-F1-model_v4 ABC transporter permease subunit 0.9774 27 314 GO:0005886
GO:0055085
AF-A0A536NKV5-F1-model_v4 Sugar ABC transporter permease 0.9772 81 314 GO:0005886
GO:0055085
AF-C7QDV6-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9716 25 314 GO:0005886
GO:0055085

Map