F439544

General Info

Members Datasets Scaffolds Average Seq Length
419 213 838 270

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100560486|Ga0207675_1005604861
Length 293
Sequence MSPRGTGPIHDMPSNDPTALAQELMAAYANRQAIAVPPSARGEGFDLATAYAVEAELARLRRESGHTTVGRKVGFANKAMWRVLKLDTLVWAHMYDDTVHFAERGAAALSVARMYSPKIEPEVVFKLKRPLGAGDLEPAAVLDAVEWLALGFEIIDCVFPDWKFQPADFVASFGLHAALVVGEPRAVDPAIVPALVEQLPRFKLRLMKGGELVEEGSGKNSLRSPALCLGELAAAIARQPDGAPLAAGELISTGTLTTSYPIAAGETWSAEVDGIELASLAVKFRGSSLKSEV

Samples

Sample ID Description Type Environment
1 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
98 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0.72
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 2.39
Rhizosphere 97.14
Stem 0
Stem Tuber 0
Unclassified 20.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207675_100560486 3300026118 Bacteria 1142
2 LJNas_1000118 3300000546 Bacteria 12408
3 JGI25406J46586_10001039 3300003203 Bacteria 12978
4 Ga0065712_10067782 3300005290 Bacteria 36753
5 Ga0065712_10078347 3300005290 Bacteria 3360
6 Ga0065712_10098722 3300005290 Bacteria 2111
7 Ga0065712_10100182 3300005290 Bacteria 2069
8 Ga0065715_10003137 3300005293 Bacteria 7678
9 Ga0065715_10010236 3300005293 Bacteria 3189
10 Ga0065715_10143763 3300005293 Bacteria 1816
11 Ga0065715_10166022 3300005293 Bacteria 1586
12 Ga0065707_10154707 3300005295 Unclassified 1601
13 Ga0070658_10030932 3300005327 Bacteria 4300
14 Ga0070676_10204348 3300005328 Bacteria 1297
15 Ga0070676_10207559 3300005328 Unclassified 1287
16 Ga0070676_10268898 3300005328 Unclassified 1144
17 Ga0070683_100004316 3300005329 Bacteria 11686
18 Ga0070690_100017603 3300005330 Bacteria 4301
19 Ga0070690_100058761 3300005330 Bacteria 2470
20 Ga0070670_100002118 3300005331 Bacteria 16294
21 Ga0070670_100010939 3300005331 Bacteria 7751
22 Ga0070670_100165306 3300005331 Bacteria 1918
23 Ga0070670_100207365 3300005331 Unclassified 1704
24 Ga0070670_100352978 3300005331 Bacteria 1292
25 Ga0070670_100438834 3300005331 Bacteria 1156
26 Ga0070677_10052314 3300005333 Bacteria 1657
27 Ga0068869_100019201 3300005334 Bacteria 4665
28 Ga0068869_100146525 3300005334 Bacteria 1828
29 Ga0070666_10028523 3300005335 Bacteria 3663
30 Ga0070666_10345676 3300005335 Bacteria 1064
31 Ga0070680_100104153 3300005336 Bacteria 2358
32 Ga0068868_100205732 3300005338 Bacteria 1643
33 Ga0068868_100518444 3300005338 Bacteria 1046
34 Ga0068868_100649881 3300005338 Bacteria 939
35 Ga0070689_100031034 3300005340 Bacteria 4060
36 Ga0070689_100233524 3300005340 Bacteria 1513
37 Ga0070691_10121829 3300005341 Bacteria 1314
38 Ga0070687_100008758 3300005343 Bacteria 4300
39 Ga0070661_100011821 3300005344 Bacteria 6089
40 Ga0070692_10125521 3300005345 Bacteria 1437
41 Ga0070668_100346529 3300005347 Bacteria 1256
42 Ga0070668_100489648 3300005347 Unclassified 1063
43 Ga0070669_100131150 3300005353 Unclassified 1923
44 Ga0070669_100144705 3300005353 Bacteria 1836
45 Ga0070669_100195792 3300005353 Bacteria 1588
46 Ga0070675_100026000 3300005354 Bacteria 4695
47 Ga0070675_100106252 3300005354 Bacteria 2370
48 Ga0070675_100126313 3300005354 Bacteria 2176
49 Ga0070675_100194419 3300005354 Bacteria 1759
50 Ga0070675_100241149 3300005354 Bacteria 1580
51 Ga0070675_100244893 3300005354 Bacteria 1567
52 Ga0070671_100049320 3300005355 Bacteria 3503
53 Ga0070671_100357653 3300005355 Unclassified 1246
54 Ga0070674_100004225 3300005356 Bacteria 8162
55 Ga0070674_100006052 3300005356 Bacteria 7037
56 Ga0070674_100101492 3300005356 Bacteria 2097
57 Ga0070674_100264497 3300005356 Bacteria 1357
58 Ga0070673_100006751 3300005364 Bacteria 7489
59 Ga0070673_100031585 3300005364 Unclassified 3976
60 Ga0070688_100027441 3300005365 Bacteria 3393
61 Ga0070688_100056437 3300005365 Bacteria 2466
62 Ga0070667_100029210 3300005367 Bacteria 4593
63 Ga0070667_100193401 3300005367 Bacteria 1803
64 Ga0070703_10085342 3300005406 Unclassified 1084
65 Ga0070709_10169343 3300005434 Bacteria 1525
66 Ga0070710_10034267 3300005437 Bacteria 2762
67 Ga0070705_100013391 3300005440 Unclassified 4194
68 Ga0070700_100400289 3300005441 Bacteria 1032
69 Ga0070694_100000989 3300005444 Bacteria 16124
70 Ga0070694_100308319 3300005444 Bacteria 1215
71 Ga0070708_100589948 3300005445 Bacteria 1048
72 Ga0070663_100561596 3300005455 Bacteria 955
73 Ga0070662_100120733 3300005457 Unclassified 2008
74 Ga0070662_100167473 3300005457 Bacteria 1723
75 Ga0070662_100207934 3300005457 Bacteria 1556
76 Ga0070662_100229955 3300005457 Unclassified 1483
77 Ga0070681_10002644 3300005458 Bacteria 16449
78 Ga0070681_10223111 3300005458 Unclassified 1800
79 Ga0070681_10242774 3300005458 Bacteria 1715
80 Ga0070681_10332892 3300005458 Unclassified 1428
81 Ga0068867_100090065 3300005459 Bacteria 2327
82 Ga0070685_10133383 3300005466 Bacteria 1555
83 Ga0070685_10164495 3300005466 Unclassified 1417
84 Ga0070685_10212274 3300005466 Bacteria 1264
85 Ga0070706_100127760 3300005467 Archaea 2371
86 Ga0070707_100044683 3300005468 Bacteria 4241
87 Ga0070707_100161546 3300005468 Bacteria 2183
88 Ga0070698_100002865 3300005471 Bacteria 18987
89 Ga0070698_100037639 3300005471 Bacteria 4987
90 Ga0070699_100201583 3300005518 Bacteria 1769
91 Ga0070679_100028578 3300005530 Bacteria 5499
92 Ga0070679_100055098 3300005530 Bacteria 3960
93 Ga0070679_100058962 3300005530 Bacteria 3826
94 Ga0068853_100263665 3300005539 Bacteria 1585
95 Ga0068853_100480580 3300005539 Unclassified 1171
96 Ga0070672_100008702 3300005543 Bacteria 6963
97 Ga0070672_100018260 3300005543 Bacteria 5065
98 Ga0070672_100296984 3300005543 Bacteria 1369
99 Ga0070686_100002239 3300005544 Bacteria 10666
100 Ga0070686_100080694 3300005544 Unclassified 2153
101 Ga0070695_100026902 3300005545 Bacteria 3560
102 Ga0070695_100061879 3300005545 Bacteria 2429
103 Ga0070695_100136833 3300005545 Bacteria 1694
104 Ga0070696_100098018 3300005546 Bacteria 2097
105 Ga0070696_100237857 3300005546 Bacteria 1372
106 Ga0070693_100012026 3300005547 Bacteria 4369
107 Ga0070665_100224893 3300005548 Unclassified 1877
108 Ga0070704_100423858 3300005549 Unclassified 1140
109 Ga0068855_100015410 3300005563 Bacteria 9202
110 Ga0068855_100409026 3300005563 Bacteria 1486
111 Ga0070664_100038477 3300005564 Bacteria 4026
112 Ga0070664_100240824 3300005564 Unclassified 1624
113 Ga0068857_100073436 3300005577 Bacteria 3048
114 Ga0068857_100094945 3300005577 Bacteria 2671
115 Ga0068854_100001201 3300005578 Bacteria 15533
116 Ga0068854_100021686 3300005578 Bacteria 4362
117 Ga0068854_100430422 3300005578 Unclassified 1098
118 Ga0070702_100076553 3300005615 Bacteria 1991
119 Ga0068852_100230326 3300005616 Bacteria 1766
120 Ga0068859_100001935 3300005617 Bacteria 21120
121 Ga0068859_100050279 3300005617 Unclassified 4188
122 Ga0068864_100127528 3300005618 Unclassified 2282
123 Ga0068864_100196905 3300005618 Bacteria 1849
124 Ga0068864_100257630 3300005618 Bacteria 1622
125 Ga0068861_100269086 3300005719 Bacteria 1462
126 Ga0068861_100685926 3300005719 Bacteria 950
127 Ga0068870_10033934 3300005840 Bacteria 2608
128 Ga0068870_10073818 3300005840 Bacteria 1867
129 Ga0068870_10291264 3300005840 Unclassified 1027
130 Ga0068870_10318615 3300005840 Unclassified 987
131 Ga0068863_100037754 3300005841 Bacteria 4597
132 Ga0068863_100147694 3300005841 Bacteria 2249
133 Ga0068863_100212752 3300005841 Unclassified 1862
134 Ga0068858_100022817 3300005842 Bacteria 5837
135 Ga0068858_100085449 3300005842 Bacteria 2935
136 Ga0068858_100146198 3300005842 Unclassified 2220
137 Ga0068860_100500302 3300005843 Bacteria 1213
138 Ga0068862_100137115 3300005844 Bacteria 2169
139 Ga0068862_100224146 3300005844 Bacteria 1703
140 Ga0068862_100488957 3300005844 Bacteria 1166
141 Ga0081539_10000029 3300005985 Bacteria 322399
142 Ga0081539_10000532 3300005985 Bacteria 79140
143 Ga0075364_10167544 3300006051 Bacteria 1484
144 Ga0097621_100202009 3300006237 Unclassified 1726
145 Ga0068871_100147259 3300006358 Unclassified 2006
146 Ga0075428_100007215 3300006844 Bacteria 12310
147 Ga0075430_100243805 3300006846 Bacteria 1489
148 Ga0075431_100008225 3300006847 Bacteria 10427
149 Ga0075431_100039310 3300006847 Bacteria 4874
150 Ga0075431_100114956 3300006847 Bacteria 2778
151 Ga0075433_10012261 3300006852 Bacteria 6912
152 Ga0075433_10244895 3300006852 Unclassified 1591
153 Ga0075434_100000448 3300006871 Bacteria 30710
154 Ga0075434_100003479 3300006871 Bacteria 14078
155 Ga0075434_100030121 3300006871 Bacteria 5343
156 Ga0075434_100115936 3300006871 Bacteria 2691
157 Ga0075434_100214788 3300006871 Unclassified 1943
158 Ga0075434_100506595 3300006871 Unclassified 1228
159 Ga0068865_100098570 3300006881 Unclassified 2135
160 Ga0075436_100000366 3300006914 Bacteria 28897
161 Ga0097620_100001935 3300006931 Bacteria 21120
162 Ga0097620_100050279 3300006931 Unclassified 4188
163 Ga0075435_100000119 3300007076 Bacteria 44181
164 Ga0075435_100007592 3300007076 Bacteria 7742
165 Ga0105240_10035981 3300009093 Bacteria 6374
166 Ga0105240_10334362 3300009093 Bacteria 1722
167 Ga0105240_10387543 3300009093 Unclassified 1577
168 Ga0111539_10000606 3300009094 Bacteria 46395
169 Ga0111539_10001398 3300009094 Bacteria 32123
170 Ga0111539_10029582 3300009094 Bacteria 6668
171 Ga0111539_10043321 3300009094 Bacteria 5396
172 Ga0111539_10198221 3300009094 Bacteria 2342
173 Ga0111539_10390750 3300009094 Bacteria 1620
174 Ga0111539_10504191 3300009094 Bacteria 1410
175 Ga0111539_10686830 3300009094 Bacteria 1192
176 Ga0105245_10209396 3300009098 Unclassified 1876
177 Ga0114129_10003631 3300009147 Bacteria 21708
178 Ga0114129_10039418 3300009147 Bacteria 6660
179 Ga0114129_10317169 3300009147 Bacteria 2073
180 Ga0114129_10394079 3300009147 Unclassified 1826
181 Ga0114129_10464444 3300009147 Bacteria 1658
182 Ga0114129_10563374 3300009147 Bacteria 1480
183 Ga0114129_10646175 3300009147 Unclassified 1366
184 Ga0105242_10041013 3300009176 Bacteria 3731
185 Ga0105248_10003668 3300009177 Bacteria 17020
186 Ga0105248_10021994 3300009177 Bacteria 7066
187 Ga0105248_10024702 3300009177 Bacteria 6683
188 Ga0105248_10061006 3300009177 Bacteria 4233
189 Ga0105248_10081222 3300009177 Bacteria 3644
190 Ga0105248_10130362 3300009177 Bacteria 2837
191 Ga0105249_10220785 3300009553 Bacteria 1865
192 Ga0105246_10190418 3300011119 Unclassified 1587
193 Ga0157374_10421596 3300013296 Bacteria 1333
194 Ga0157375_10457690 3300013308 Bacteria 1441
195 Ga0157375_10640647 3300013308 Bacteria 1219
196 Ga0163163_10000089 3300014325 Bacteria 100404
197 Ga0163163_10002280 3300014325 Bacteria 16180
198 Ga0163163_10110498 3300014325 Bacteria 2777
199 Ga0163163_10128699 3300014325 Unclassified 2571
200 Ga0157380_10185161 3300014326 Unclassified 1833
201 Ga0157380_10305935 3300014326 Bacteria 1467
202 Ga0157380_10405357 3300014326 Bacteria 1295
203 Ga0157377_10009729 3300014745 Bacteria 4730
204 Ga0157377_10073987 3300014745 Unclassified 1976
205 Ga0157379_10344766 3300014968 Bacteria 1363
206 Ga0157376_10135044 3300014969 Bacteria 2207
207 Ga0157376_10347210 3300014969 Unclassified 1419
208 Ga0157376_10806745 3300014969 Unclassified 951
209 Ga0224572_1004800 3300024225 Unclassified 2378
210 Ga0228598_1001734 3300024227 Bacteria 4770
211 Ga0207682_10017615 3300025893 Bacteria 2789
212 Ga0207692_10027276 3300025898 Bacteria 2689
213 Ga0207642_10125188 3300025899 Bacteria 1332
214 Ga0207688_10068218 3300025901 Unclassified 2013
215 Ga0207680_10022643 3300025903 Bacteria 3421
216 Ga0207643_10039832 3300025908 Unclassified 2643
217 Ga0207684_10604796 3300025910 Unclassified 936
218 Ga0207707_10031773 3300025912 Bacteria 4621
219 Ga0207707_10187040 3300025912 Bacteria 1807
220 Ga0207707_10204476 3300025912 Unclassified 1721
221 Ga0207707_10312413 3300025912 Unclassified 1358
222 Ga0207695_10097754 3300025913 Bacteria 2936
223 Ga0207695_10272925 3300025913 Unclassified 1586
224 Ga0207662_10002086 3300025918 Bacteria 9927
225 Ga0207662_10005555 3300025918 Bacteria 6735
226 Ga0207662_10114686 3300025918 Bacteria 1683
227 Ga0207657_10009849 3300025919 Bacteria 9570
228 Ga0207657_10187303 3300025919 Bacteria 1671
229 Ga0207652_10038815 3300025921 Bacteria 4038
230 Ga0207646_10222401 3300025922 Bacteria 1705
231 Ga0207681_10038968 3300025923 Bacteria 3152
232 Ga0207681_10065169 3300025923 Bacteria 2517
233 Ga0207681_10122351 3300025923 Bacteria 1910
234 Ga0207650_10007680 3300025925 Bacteria 7346
235 Ga0207650_10187260 3300025925 Bacteria 1652
236 Ga0207659_10001588 3300025926 Bacteria 13483
237 Ga0207659_10020456 3300025926 Bacteria 4376
238 Ga0207659_10021159 3300025926 Bacteria 4313
239 Ga0207659_10097169 3300025926 Bacteria 2212
240 Ga0207659_10151988 3300025926 Unclassified 1809
241 Ga0207659_10382037 3300025926 Bacteria 1175
242 Ga0207644_10012322 3300025931 Bacteria 5677
243 Ga0207644_10309974 3300025931 Bacteria 1274
244 Ga0207690_10041123 3300025932 Bacteria 3028
245 Ga0207706_10079395 3300025933 Bacteria 2886
246 Ga0207706_10203826 3300025933 Unclassified 1735
247 Ga0207706_10261147 3300025933 Bacteria 1512
248 Ga0207670_10045615 3300025936 Bacteria 2907
249 Ga0207669_10051176 3300025937 Unclassified 2473
250 Ga0207669_10066142 3300025937 Unclassified 2246
251 Ga0207691_10019097 3300025940 Bacteria 6491
252 Ga0207691_10022960 3300025940 Bacteria 5876
253 Ga0207691_10042096 3300025940 Unclassified 4212
254 Ga0207691_10054859 3300025940 Bacteria 3634
255 Ga0207691_10258073 3300025940 Bacteria 1503
256 Ga0207711_10030065 3300025941 Bacteria 4581
257 Ga0207711_10037392 3300025941 Bacteria 4122
258 Ga0207711_10050036 3300025941 Bacteria 3578
259 Ga0207689_10017484 3300025942 Bacteria 6067
260 Ga0207689_10035953 3300025942 Bacteria 4112
261 Ga0207679_10413945 3300025945 Bacteria 1188
262 Ga0207667_10071385 3300025949 Bacteria 3610
263 Ga0207651_10001010 3300025960 Bacteria 12446
264 Ga0207712_10021690 3300025961 Bacteria 4219
265 Ga0207712_10292642 3300025961 Bacteria 1333
266 Ga0207668_10311924 3300025972 Bacteria 1302
267 Ga0207668_10324442 3300025972 Bacteria 1279
268 Ga0207640_10002665 3300025981 Bacteria 9545
269 Ga0207640_10127630 3300025981 Bacteria 1833
270 Ga0207640_10131729 3300025981 Bacteria 1809
271 Ga0207658_10098887 3300025986 Unclassified 2281
272 Ga0207658_10142474 3300025986 Bacteria 1942
273 Ga0207703_10368570 3300026035 Bacteria 1326
274 Ga0207639_10214588 3300026041 Bacteria 1659
275 Ga0207678_10101726 3300026067 Bacteria 2453
276 Ga0207708_10019869 3300026075 Bacteria 5064
277 Ga0207641_10063525 3300026088 Bacteria 3154
278 Ga0207641_10075706 3300026088 Unclassified 2907
279 Ga0207648_10101367 3300026089 Bacteria 2523
280 Ga0207648_10164117 3300026089 Bacteria 1962
281 Ga0207676_10242139 3300026095 Bacteria 1619
282 Ga0207674_10073078 3300026116 Bacteria 3444
283 Ga0207674_10129960 3300026116 Bacteria 2483
284 Ga0207674_10355113 3300026116 Bacteria 1417
285 Ga0207674_10384828 3300026116 Bacteria 1356
286 Ga0207675_100043615 3300026118 Bacteria 4189
287 Ga0207675_100060308 3300026118 Bacteria 3541
288 Ga0207675_100125454 3300026118 Unclassified 2432
289 Ga0207675_100180094 3300026118 Bacteria 2023
290 Ga0207675_100422645 3300026118 Bacteria 1316
291 Ga0207683_10399342 3300026121 Bacteria 1265
292 Ga0207428_10093627 3300027907 Bacteria 2330
293 Ga0207428_10130369 3300027907 Unclassified 1924
294 Ga0207428_10199162 3300027907 Bacteria 1507
295 Ga0265356_1006597 3300028017 Unclassified 1352
296 Ga0268265_10109246 3300028380 Bacteria 2254
297 Ga0268265_10340562 3300028380 Unclassified 1365
298 Ga0268265_10383459 3300028380 Bacteria 1294
299 Ga0268264_10477031 3300028381 Bacteria 1213
300 Ga0268264_10740251 3300028381 Bacteria 979
301 Ga0265762_1000009 3300030760 Bacteria 22710
302 Ga0265760_10006452 3300031090 Bacteria 3354
303 Ga0265760_10041275 3300031090 Bacteria 1375
304 Ga0307405_10043618 3300031731 Bacteria 2738
305 Ga0307405_10043932 3300031731 Unclassified 2730
306 Ga0307413_10000467 3300031824 Bacteria 13161
307 Ga0307410_10073782 3300031852 Bacteria 2374
308 Ga0307410_10179456 3300031852 Unclassified 1602
309 Ga0307407_10001768 3300031903 Bacteria 8065
310 Ga0307407_10082026 3300031903 Bacteria 1953
311 Ga0307412_10018929 3300031911 Bacteria 4157
312 Ga0307412_10033481 3300031911 Bacteria 3267
313 Ga0307412_10134707 3300031911 Bacteria 1800
314 Ga0307409_100004969 3300031995 Bacteria 7570
315 Ga0307409_100091873 3300031995 Unclassified 2489
316 Ga0307409_100139280 3300031995 Unclassified 2088
317 Ga0307409_100529294 3300031995 Bacteria 1153
318 Ga0307416_100002563 3300032002 Bacteria 10490
319 Ga0307416_100445556 3300032002 Bacteria 1346
320 Ga0307416_100518088 3300032002 Bacteria 1260
321 Ga0307414_10179915 3300032004 Bacteria 1700
322 Ga0307414_10416305 3300032004 Bacteria 1171
323 Ga0307411_10005172 3300032005 Bacteria 6379
324 Ga0307411_10014401 3300032005 Bacteria 4398
325 Ga0307411_10020459 3300032005 Bacteria 3850
326 Ga0307411_10057719 3300032005 Bacteria 2566
327 Ga0307411_10146040 3300032005 Unclassified 1751
328 Ga0307415_100041006 3300032126 Bacteria 3071
329 Ga0373934_0011978 3300035086 Bacteria 3271
330 Ga0373944_0097550 3300035089 Bacteria 989
331 Ga0373954_0047555 3300035118 Bacteria 2008
332 Ga0373954_0106590 3300035118 Bacteria 1354
333 Ga0373956_0004259 3300035119 Bacteria 5748
334 Ga0373956_0199445 3300035119 Bacteria 948
335 Ga0373943_0012853 3300035170 Unclassified 3774
336 Ga0373955_0003917 3300035172 Bacteria 6566
337 Ga0373955_0293502 3300035172 Bacteria 980
338 Ga0373935_0056214 3300035692 Bacteria 2509
339 Ga0373947_0046644 3300035725 Bacteria 2595
340 Ga0373937_0000343 3300036401 Bacteria 43972
341 Ga0373937_0053076 3300036401 Unclassified 3718
342 Ga0373937_0528446 3300036401 Bacteria 1121
343 Ga0373925_0203713 3300037068 Bacteria 1574
344 Ga0373925_0289183 3300037068 Bacteria 1321
345 Ga0436364_0401306 3300037853 Bacteria 3518
346 Ga0451576_0077154 3300045051 Bacteria 3467
347 Ga0451576_0201345 3300045051 Unclassified 2080
348 Ga0451576_0313552 3300045051 Bacteria 1641
349 Ga0466967_0623012 3300045976 Bacteria 1066
350 Ga0495603_0025365 3300046455 Bacteria 3585
351 Ga0495651_0060181 3300046462 Bacteria 2910
352 Ga0495580_0173814 3300046472 Bacteria 1488
353 Ga0495582_0046437 3300046473 Bacteria 2392
354 Ga0495628_0082775 3300046516 Bacteria 2493
355 Ga0495652_0110968 3300046529 Unclassified 2206
356 Ga0495640_0053896 3300046533 Bacteria 2757
357 Ga0495622_0073584 3300046557 Bacteria 1576
358 Ga0495633_0082704 3300046558 Bacteria 1494
359 Ga0495599_0185758 3300046678 Unclassified 1280
360 Ga0495658_0090625 3300046683 Bacteria 1810
361 Ga0495658_0109676 3300046683 Unclassified 1658
362 Ga0495669_0012808 3300046684 Bacteria 3570
363 Ga0495636_0124009 3300047318 Unclassified 1145
364 Ga0495674_0002261 3300047319 Bacteria 18920
365 Ga0495674_0109500 3300047319 Bacteria 2343
366 Ga0496105_0085307 3300048908 Bacteria 2609
367 Ga0496108_0011500 3300048911 Bacteria 7192
368 Ga0496108_0260440 3300048911 Unclassified 1509
369 Ga0496109_0005454 3300048912 Bacteria 10637
370 Ga0496109_0011341 3300048912 Bacteria 7657
371 Ga0496110_0009501 3300048913 Bacteria 7869
372 Ga0496112_0005039 3300048915 Bacteria 11341
373 Ga0496112_0192899 3300048915 Bacteria 1998
374 Ga0496113_0040910 3300048916 Bacteria 3418
375 Ga0496113_0065676 3300048916 Bacteria 2747
376 Ga0501036_0241827 3300049572 Unclassified 1514
377 Ga0501040_0120583 3300049576 Unclassified 1840
378 Ga0501041_0031107 3300049577 Bacteria 3222
379 Ga0501042_0077268 3300049578 Bacteria 2383
380 Ga0501046_0044303 3300049580 Bacteria 3539
381 Ga0501048_0064818 3300049582 Unclassified 2584
382 Ga0501067_0113676 3300049583 Unclassified 1506
383 Ga0501071_0115675 3300049587 Bacteria 1985
384 Ga0501074_0237212 3300049590 Bacteria 1298
385 Ga0501077_0281647 3300049593 Unclassified 1058
386 Ga0501079_0104330 3300049741 Unclassified 2199
387 Ga0501079_0298706 3300049741 Unclassified 1260
388 Ga0501080_0276238 3300049742 Bacteria 1528
389 Ga0501081_0162205 3300049743 Bacteria 1611
390 nmdc:mga05p37_124314_c1 3300050507 Bacteria 3169
391 nmdc:mga05p37_272017_c1 3300050507 Bacteria 2024
392 nmdc:mga05p37_4962_c1 3300050507 Bacteria 15588
393 nmdc:mga05p37_819665_c1 3300050507 Unclassified 1015
394 nmdc:mga0qj67_347739_c1 3300050509 Unclassified 1199
395 nmdc:mga06r32_25693_c1 3300050510 Bacteria 5482
396 nmdc:mga06r32_513521_c1 3300050510 Bacteria 1174
397 nmdc:mga06r32_6704_c1 3300050510 Bacteria 10348
398 nmdc:mga08y16_16112_c1 3300050511 Bacteria 7861
399 nmdc:mga08y16_22143_c1 3300050511 Bacteria 6709
400 nmdc:mga08y16_23993_c1 3300050511 Bacteria 6442
401 nmdc:mga0n895_24599_c1 3300050512 Bacteria 5677
402 nmdc:mga0n895_255_c1 3300050512 Bacteria 34281
403 nmdc:mga0n895_354816_c1 3300050512 Bacteria 1485
404 nmdc:mga0n895_37915_c1 3300050512 Bacteria 4666
405 nmdc:mga0n895_486587_c1 3300050512 Unclassified 1244
406 nmdc:mga0n895_601_c1 3300050512 Bacteria 24893
407 nmdc:mga0rr50_1856_c1 3300050513 Bacteria 11715
408 nmdc:mga0rr50_21_c1 3300050513 Bacteria 125964
409 nmdc:mga0rr50_8170_c1 3300050513 Bacteria 6497
410 nmdc:mga08x19_279_c1 3300050514 Bacteria 38642
411 nmdc:mga0a205_263455_c1 3300050515 Archaea 1601
412 nmdc:mga0a205_466559_c1 3300050515 Bacteria 1122
413 nmdc:mga0a205_59593_c1 3300050515 Bacteria 3687
414 nmdc:mga0a205_89676_c1 3300050515 Bacteria 2972
415 Ga0495601_0122614 3300053077 Bacteria 1689
416 Ga0495619_0112358 3300053085 Bacteria 1863
417 Ga0501084_0035181 3300054114 Bacteria 4187
418 Ga0590077_006576 3300059426 Bacteria 2379
419 Ga0501082_0050011 3300060353 Bacteria 3605
420 Ga0207675_100560486
421 LJNas_1000118
422 JGI25406J46586_10001039
423 Ga0065712_10067782
424 Ga0065712_10078347
425 Ga0065712_10098722
426 Ga0065712_10100182
427 Ga0065715_10003137
428 Ga0065715_10010236
429 Ga0065715_10143763
430 Ga0065715_10166022
431 Ga0065707_10154707
432 Ga0070658_10030932
433 Ga0070676_10204348
434 Ga0070676_10207559
435 Ga0070676_10268898
436 Ga0070683_100004316
437 Ga0070690_100017603
438 Ga0070690_100058761
439 Ga0070670_100002118
440 Ga0070670_100010939
441 Ga0070670_100165306
442 Ga0070670_100207365
443 Ga0070670_100352978
444 Ga0070670_100438834
445 Ga0070677_10052314
446 Ga0068869_100019201
447 Ga0068869_100146525
448 Ga0070666_10028523
449 Ga0070666_10345676
450 Ga0070680_100104153
451 Ga0068868_100205732
452 Ga0068868_100518444
453 Ga0068868_100649881
454 Ga0070689_100031034
455 Ga0070689_100233524
456 Ga0070691_10121829
457 Ga0070687_100008758
458 Ga0070661_100011821
459 Ga0070692_10125521
460 Ga0070668_100346529
461 Ga0070668_100489648
462 Ga0070669_100131150
463 Ga0070669_100144705
464 Ga0070669_100195792
465 Ga0070675_100026000
466 Ga0070675_100106252
467 Ga0070675_100126313
468 Ga0070675_100194419
469 Ga0070675_100241149
470 Ga0070675_100244893
471 Ga0070671_100049320
472 Ga0070671_100357653
473 Ga0070674_100004225
474 Ga0070674_100006052
475 Ga0070674_100101492
476 Ga0070674_100264497
477 Ga0070673_100006751
478 Ga0070673_100031585
479 Ga0070688_100027441
480 Ga0070688_100056437
481 Ga0070667_100029210
482 Ga0070667_100193401
483 Ga0070703_10085342
484 Ga0070709_10169343
485 Ga0070710_10034267
486 Ga0070705_100013391
487 Ga0070700_100400289
488 Ga0070694_100000989
489 Ga0070694_100308319
490 Ga0070708_100589948
491 Ga0070663_100561596
492 Ga0070662_100120733
493 Ga0070662_100167473
494 Ga0070662_100207934
495 Ga0070662_100229955
496 Ga0070681_10002644
497 Ga0070681_10223111
498 Ga0070681_10242774
499 Ga0070681_10332892
500 Ga0068867_100090065
501 Ga0070685_10133383
502 Ga0070685_10164495
503 Ga0070685_10212274
504 Ga0070706_100127760
505 Ga0070707_100044683
506 Ga0070707_100161546
507 Ga0070698_100002865
508 Ga0070698_100037639
509 Ga0070699_100201583
510 Ga0070679_100028578
511 Ga0070679_100055098
512 Ga0070679_100058962
513 Ga0068853_100263665
514 Ga0068853_100480580
515 Ga0070672_100008702
516 Ga0070672_100018260
517 Ga0070672_100296984
518 Ga0070686_100002239
519 Ga0070686_100080694
520 Ga0070695_100026902
521 Ga0070695_100061879
522 Ga0070695_100136833
523 Ga0070696_100098018
524 Ga0070696_100237857
525 Ga0070693_100012026
526 Ga0070665_100224893
527 Ga0070704_100423858
528 Ga0068855_100015410
529 Ga0068855_100409026
530 Ga0070664_100038477
531 Ga0070664_100240824
532 Ga0068857_100073436
533 Ga0068857_100094945
534 Ga0068854_100001201
535 Ga0068854_100021686
536 Ga0068854_100430422
537 Ga0070702_100076553
538 Ga0068852_100230326
539 Ga0068859_100001935
540 Ga0068859_100050279
541 Ga0068864_100127528
542 Ga0068864_100196905
543 Ga0068864_100257630
544 Ga0068861_100269086
545 Ga0068861_100685926
546 Ga0068870_10033934
547 Ga0068870_10073818
548 Ga0068870_10291264
549 Ga0068870_10318615
550 Ga0068863_100037754
551 Ga0068863_100147694
552 Ga0068863_100212752
553 Ga0068858_100022817
554 Ga0068858_100085449
555 Ga0068858_100146198
556 Ga0068860_100500302
557 Ga0068862_100137115
558 Ga0068862_100224146
559 Ga0068862_100488957
560 Ga0081539_10000029
561 Ga0081539_10000532
562 Ga0075364_10167544
563 Ga0097621_100202009
564 Ga0068871_100147259
565 Ga0075428_100007215
566 Ga0075430_100243805
567 Ga0075431_100008225
568 Ga0075431_100039310
569 Ga0075431_100114956
570 Ga0075433_10012261
571 Ga0075433_10244895
572 Ga0075434_100000448
573 Ga0075434_100003479
574 Ga0075434_100030121
575 Ga0075434_100115936
576 Ga0075434_100214788
577 Ga0075434_100506595
578 Ga0068865_100098570
579 Ga0075436_100000366
580 Ga0097620_100001935
581 Ga0097620_100050279
582 Ga0075435_100000119
583 Ga0075435_100007592
584 Ga0105240_10035981
585 Ga0105240_10334362
586 Ga0105240_10387543
587 Ga0111539_10000606
588 Ga0111539_10001398
589 Ga0111539_10029582
590 Ga0111539_10043321
591 Ga0111539_10198221
592 Ga0111539_10390750
593 Ga0111539_10504191
594 Ga0111539_10686830
595 Ga0105245_10209396
596 Ga0114129_10003631
597 Ga0114129_10039418
598 Ga0114129_10317169
599 Ga0114129_10394079
600 Ga0114129_10464444
601 Ga0114129_10563374
602 Ga0114129_10646175
603 Ga0105242_10041013
604 Ga0105248_10003668
605 Ga0105248_10021994
606 Ga0105248_10024702
607 Ga0105248_10061006
608 Ga0105248_10081222
609 Ga0105248_10130362
610 Ga0105249_10220785
611 Ga0105246_10190418
612 Ga0157374_10421596
613 Ga0157375_10457690
614 Ga0157375_10640647
615 Ga0163163_10000089
616 Ga0163163_10002280
617 Ga0163163_10110498
618 Ga0163163_10128699
619 Ga0157380_10185161
620 Ga0157380_10305935
621 Ga0157380_10405357
622 Ga0157377_10009729
623 Ga0157377_10073987
624 Ga0157379_10344766
625 Ga0157376_10135044
626 Ga0157376_10347210
627 Ga0157376_10806745
628 Ga0224572_1004800
629 Ga0228598_1001734
630 Ga0207682_10017615
631 Ga0207692_10027276
632 Ga0207642_10125188
633 Ga0207688_10068218
634 Ga0207680_10022643
635 Ga0207643_10039832
636 Ga0207684_10604796
637 Ga0207707_10031773
638 Ga0207707_10187040
639 Ga0207707_10204476
640 Ga0207707_10312413
641 Ga0207695_10097754
642 Ga0207695_10272925
643 Ga0207662_10002086
644 Ga0207662_10005555
645 Ga0207662_10114686
646 Ga0207657_10009849
647 Ga0207657_10187303
648 Ga0207652_10038815
649 Ga0207646_10222401
650 Ga0207681_10038968
651 Ga0207681_10065169
652 Ga0207681_10122351
653 Ga0207650_10007680
654 Ga0207650_10187260
655 Ga0207659_10001588
656 Ga0207659_10020456
657 Ga0207659_10021159
658 Ga0207659_10097169
659 Ga0207659_10151988
660 Ga0207659_10382037
661 Ga0207644_10012322
662 Ga0207644_10309974
663 Ga0207690_10041123
664 Ga0207706_10079395
665 Ga0207706_10203826
666 Ga0207706_10261147
667 Ga0207670_10045615
668 Ga0207669_10051176
669 Ga0207669_10066142
670 Ga0207691_10019097
671 Ga0207691_10022960
672 Ga0207691_10042096
673 Ga0207691_10054859
674 Ga0207691_10258073
675 Ga0207711_10030065
676 Ga0207711_10037392
677 Ga0207711_10050036
678 Ga0207689_10017484
679 Ga0207689_10035953
680 Ga0207679_10413945
681 Ga0207667_10071385
682 Ga0207651_10001010
683 Ga0207712_10021690
684 Ga0207712_10292642
685 Ga0207668_10311924
686 Ga0207668_10324442
687 Ga0207640_10002665
688 Ga0207640_10127630
689 Ga0207640_10131729
690 Ga0207658_10098887
691 Ga0207658_10142474
692 Ga0207703_10368570
693 Ga0207639_10214588
694 Ga0207678_10101726
695 Ga0207708_10019869
696 Ga0207641_10063525
697 Ga0207641_10075706
698 Ga0207648_10101367
699 Ga0207648_10164117
700 Ga0207676_10242139
701 Ga0207674_10073078
702 Ga0207674_10129960
703 Ga0207674_10355113
704 Ga0207674_10384828
705 Ga0207675_100043615
706 Ga0207675_100060308
707 Ga0207675_100125454
708 Ga0207675_100180094
709 Ga0207675_100422645
710 Ga0207683_10399342
711 Ga0207428_10093627
712 Ga0207428_10130369
713 Ga0207428_10199162
714 Ga0265356_1006597
715 Ga0268265_10109246
716 Ga0268265_10340562
717 Ga0268265_10383459
718 Ga0268264_10477031
719 Ga0268264_10740251
720 Ga0265762_1000009
721 Ga0265760_10006452
722 Ga0265760_10041275
723 Ga0307405_10043618
724 Ga0307405_10043932
725 Ga0307413_10000467
726 Ga0307410_10073782
727 Ga0307410_10179456
728 Ga0307407_10001768
729 Ga0307407_10082026
730 Ga0307412_10018929
731 Ga0307412_10033481
732 Ga0307412_10134707
733 Ga0307409_100004969
734 Ga0307409_100091873
735 Ga0307409_100139280
736 Ga0307409_100529294
737 Ga0307416_100002563
738 Ga0307416_100445556
739 Ga0307416_100518088
740 Ga0307414_10179915
741 Ga0307414_10416305
742 Ga0307411_10005172
743 Ga0307411_10014401
744 Ga0307411_10020459
745 Ga0307411_10057719
746 Ga0307411_10146040
747 Ga0307415_100041006
748 Ga0373934_0011978
749 Ga0373944_0097550
750 Ga0373954_0047555
751 Ga0373954_0106590
752 Ga0373956_0004259
753 Ga0373956_0199445
754 Ga0373943_0012853
755 Ga0373955_0003917
756 Ga0373955_0293502
757 Ga0373935_0056214
758 Ga0373947_0046644
759 Ga0373937_0000343
760 Ga0373937_0053076
761 Ga0373937_0528446
762 Ga0373925_0203713
763 Ga0373925_0289183
764 Ga0436364_0401306
765 Ga0451576_0077154
766 Ga0451576_0201345
767 Ga0451576_0313552
768 Ga0466967_0623012
769 Ga0495603_0025365
770 Ga0495651_0060181
771 Ga0495580_0173814
772 Ga0495582_0046437
773 Ga0495628_0082775
774 Ga0495652_0110968
775 Ga0495640_0053896
776 Ga0495622_0073584
777 Ga0495633_0082704
778 Ga0495599_0185758
779 Ga0495658_0090625
780 Ga0495658_0109676
781 Ga0495669_0012808
782 Ga0495636_0124009
783 Ga0495674_0002261
784 Ga0495674_0109500
785 Ga0496105_0085307
786 Ga0496108_0011500
787 Ga0496108_0260440
788 Ga0496109_0005454
789 Ga0496109_0011341
790 Ga0496110_0009501
791 Ga0496112_0005039
792 Ga0496112_0192899
793 Ga0496113_0040910
794 Ga0496113_0065676
795 Ga0501036_0241827
796 Ga0501040_0120583
797 Ga0501041_0031107
798 Ga0501042_0077268
799 Ga0501046_0044303
800 Ga0501048_0064818
801 Ga0501067_0113676
802 Ga0501071_0115675
803 Ga0501074_0237212
804 Ga0501077_0281647
805 Ga0501079_0104330
806 Ga0501079_0298706
807 Ga0501080_0276238
808 Ga0501081_0162205
809 nmdc:mga05p37_124314_c1
810 nmdc:mga05p37_272017_c1
811 nmdc:mga05p37_4962_c1
812 nmdc:mga05p37_819665_c1
813 nmdc:mga0qj67_347739_c1
814 nmdc:mga06r32_25693_c1
815 nmdc:mga06r32_513521_c1
816 nmdc:mga06r32_6704_c1
817 nmdc:mga08y16_16112_c1
818 nmdc:mga08y16_22143_c1
819 nmdc:mga08y16_23993_c1
820 nmdc:mga0n895_24599_c1
821 nmdc:mga0n895_255_c1
822 nmdc:mga0n895_354816_c1
823 nmdc:mga0n895_37915_c1
824 nmdc:mga0n895_486587_c1
825 nmdc:mga0n895_601_c1
826 nmdc:mga0rr50_1856_c1
827 nmdc:mga0rr50_21_c1
828 nmdc:mga0rr50_8170_c1
829 nmdc:mga08x19_279_c1
830 nmdc:mga0a205_263455_c1
831 nmdc:mga0a205_466559_c1
832 nmdc:mga0a205_59593_c1
833 nmdc:mga0a205_89676_c1
834 Ga0495601_0122614
835 Ga0495619_0112358
836 Ga0501084_0035181
837 Ga0590077_006576
838 Ga0501082_0050011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01557

FAA_hydrolase

Fumarylacetoacetate (FAA) hydrolase family

91

283

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wqt-assembly1.cif.gz_A dodecahedral assembly of mhpd 0.9153 7 274
5d2i-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate 0.914 7 274
5d2k-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate 0.913 4 274
5d2k-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate 0.8934 4 274
2wqt-assembly1.cif.gz_A dodecahedral assembly of mhpd 0.8888 7 274
ID Description Score Start End Superfamily
2wqtB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9153 7 274 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.913 4 274 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.908 1 272 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9014 1 272 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8934 4 274 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A2W0A0Q2-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9864 4 274 GO:0005737
GO:0008684
AF-A0A2W0A0Q2-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9757 4 274 GO:0005737
GO:0008684
AF-A0A1F2S767-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9653 4 274 GO:0005737
GO:0008684
AF-A0A1Q3SIV6-F1-model_v4 Fumarylacetoacetase-like C-terminal domain-containing protein 0.9573 4 274 GO:0005737
GO:0008684
AF-A0A3D5DB75-F1-model_v4 Hydratase 0.9556 10 274 GO:0005737
GO:0008684

Map