F439534

General Info

Members Datasets Scaffolds Average Seq Length
419 203 838 187

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10244524|Ga0207646_102445241
Length 170
Sequence MSGKVVVNRSMSLDGFIAGPGDAMDWIFDFMAPDEFPEIAAATGAMLVGRRTDEVYPFSGPVFVLTHRPPDPPAPEVTYLTGDIGQAVATALDAAGGKNLEILGADVAGQCLRRGLVDEILVYVLPVLLGDGIRFYSSPGLARIDLEPVSSTRSGAVTILRFRVRKQSSV

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
201 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
202 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 17.66
Rhizosphere 80.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10244524 3300025922 Bacteria 1621
2 Ga0070658_10000679 3300005327 Bacteria 29418
3 Ga0070683_100013349 3300005329 Bacteria 7161
4 Ga0070683_100208409 3300005329 Bacteria 1856
5 Ga0070690_100404627 3300005330 Bacteria 1003
6 Ga0068869_100120785 3300005334 Bacteria 2004
7 Ga0070680_100001867 3300005336 Bacteria 15445
8 Ga0070680_100016478 3300005336 Bacteria 5817
9 Ga0070680_100352921 3300005336 Bacteria 1251
10 Ga0070682_100047108 3300005337 Bacteria 2679
11 Ga0070682_100062228 3300005337 Bacteria 2364
12 Ga0068868_100002586 3300005338 Bacteria 12547
13 Ga0068868_100044625 3300005338 Bacteria 3466
14 Ga0070660_100028278 3300005339 Bacteria 4193
15 Ga0070691_10025952 3300005341 Bacteria 2730
16 Ga0070692_10052385 3300005345 Bacteria 2126
17 Ga0070692_10236048 3300005345 Bacteria 1088
18 Ga0070668_100764996 3300005347 Bacteria 856
19 Ga0070669_100543268 3300005353 Bacteria 968
20 Ga0070671_100754796 3300005355 Bacteria 846
21 Ga0070688_100103725 3300005365 Bacteria 1879
22 Ga0070659_100143068 3300005366 Bacteria 1947
23 Ga0070709_10000168 3300005434 Bacteria 41320
24 Ga0070709_10047466 3300005434 Bacteria 2675
25 Ga0070709_10213532 3300005434 Bacteria 1373
26 Ga0070709_10265831 3300005434 Bacteria 1241
27 Ga0070714_100002356 3300005435 Bacteria 13893
28 Ga0070714_100084013 3300005435 Bacteria 2777
29 Ga0070714_100401567 3300005435 Bacteria 1295
30 Ga0070713_100017469 3300005436 Bacteria 5426
31 Ga0070713_100043497 3300005436 Bacteria 3672
32 Ga0070713_100129935 3300005436 Bacteria 2220
33 Ga0070713_100155021 3300005436 Bacteria 2041
34 Ga0070713_100237230 3300005436 Bacteria 1659
35 Ga0070710_10013347 3300005437 Bacteria 4111
36 Ga0070710_10027430 3300005437 Bacteria 3036
37 Ga0070710_10055029 3300005437 Bacteria 2246
38 Ga0070711_100079632 3300005439 Bacteria 2330
39 Ga0070711_100213514 3300005439 Bacteria 1496
40 Ga0070711_100746278 3300005439 Bacteria 827
41 Ga0070700_100073107 3300005441 Bacteria 2194
42 Ga0070700_100115146 3300005441 Bacteria 1793
43 Ga0070700_100115554 3300005441 Bacteria 1791
44 Ga0070708_100052223 3300005445 Bacteria 3624
45 Ga0070678_100608207 3300005456 Bacteria 976
46 Ga0070681_10000019 3300005458 Bacteria 124774
47 Ga0070681_10009147 3300005458 Bacteria 9733
48 Ga0070681_10150796 3300005458 Bacteria 2251
49 Ga0068867_100017062 3300005459 Bacteria 5158
50 Ga0070707_100099106 3300005468 Bacteria 2823
51 Ga0070699_100017474 3300005518 Bacteria 6157
52 Ga0070679_100008802 3300005530 Bacteria 9520
53 Ga0070679_100210673 3300005530 Bacteria 1907
54 Ga0070679_100240233 3300005530 Bacteria 1769
55 Ga0070679_100440850 3300005530 Bacteria 1247
56 Ga0070684_100046295 3300005535 Bacteria 3769
57 Ga0070684_100046554 3300005535 Bacteria 3758
58 Ga0070684_100267916 3300005535 Bacteria 1563
59 Ga0070684_100272279 3300005535 Bacteria 1550
60 Ga0070672_100647206 3300005543 Bacteria 923
61 Ga0070686_100107003 3300005544 Bacteria 1899
62 Ga0070696_100015431 3300005546 Bacteria 5129
63 Ga0070693_100576652 3300005547 Bacteria 809
64 Ga0068855_100058995 3300005563 Bacteria 4491
65 Ga0068855_100086569 3300005563 Bacteria 3623
66 Ga0068855_100417011 3300005563 Bacteria 1469
67 Ga0070664_100831940 3300005564 Bacteria 864
68 Ga0068854_100022599 3300005578 Bacteria 4288
69 Ga0068854_100122440 3300005578 Bacteria 1977
70 Ga0068856_100912089 3300005614 Bacteria 897
71 Ga0068856_101346272 3300005614 Bacteria 729
72 Ga0068852_100117361 3300005616 Bacteria 2430
73 Ga0068852_100216374 3300005616 Bacteria 1820
74 Ga0068852_100253873 3300005616 Bacteria 1686
75 Ga0068866_10064588 3300005718 Bacteria 1912
76 Ga0068863_101023747 3300005841 Bacteria 829
77 Ga0068858_100006881 3300005842 Bacteria 11054
78 Ga0070717_10000119 3300006028 Bacteria 61576
79 Ga0070717_10468523 3300006028 Bacteria 1137
80 Ga0075365_10142967 3300006038 Bacteria 1661
81 Ga0070716_100025811 3300006173 Bacteria 3140
82 Ga0070712_100019821 3300006175 Bacteria 4394
83 Ga0070712_100046205 3300006175 Bacteria 3010
84 Ga0070712_100104209 3300006175 Bacteria 2104
85 Ga0070712_100274514 3300006175 Bacteria 1356
86 Ga0097621_100247835 3300006237 Bacteria 1559
87 Ga0068871_100240539 3300006358 Bacteria 1574
88 Ga0068871_100241375 3300006358 Bacteria 1571
89 Ga0075434_100003275 3300006871 Bacteria 14484
90 Ga0075434_100291643 3300006871 Bacteria 1651
91 Ga0075436_100031431 3300006914 Bacteria 3656
92 Ga0075435_100001051 3300007076 Bacteria 17481
93 Ga0075435_100477406 3300007076 Bacteria 1077
94 Ga0105240_10021196 3300009093 Bacteria 8650
95 Ga0105245_10008976 3300009098 Bacteria 8720
96 Ga0105245_10013242 3300009098 Bacteria 7187
97 Ga0105245_10068701 3300009098 Bacteria 3211
98 Ga0105245_10222349 3300009098 Bacteria 1823
99 Ga0105245_10291110 3300009098 Bacteria 1599
100 Ga0105245_11225404 3300009098 Bacteria 798
101 Ga0105247_10027951 3300009101 Bacteria 3411
102 Ga0105247_10738066 3300009101 Bacteria 745
103 Ga0114129_10339900 3300009147 Bacteria 1991
104 Ga0105243_10285165 3300009148 Bacteria 1489
105 Ga0105241_10020481 3300009174 Bacteria 4886
106 Ga0105241_10536351 3300009174 Bacteria 1048
107 Ga0105242_10073048 3300009176 Bacteria 2851
108 Ga0105242_10338612 3300009176 Bacteria 1386
109 Ga0105242_10356933 3300009176 Bacteria 1352
110 Ga0105242_10440273 3300009176 Bacteria 1226
111 Ga0105242_11910330 3300009176 Bacteria 634
112 Ga0105248_10023069 3300009177 Bacteria 6911
113 Ga0105248_10428349 3300009177 Bacteria 1490
114 Ga0105237_10630766 3300009545 Bacteria 1079
115 Ga0105238_10132890 3300009551 Bacteria 2467
116 Ga0105238_10170877 3300009551 Bacteria 2150
117 Ga0105238_10175625 3300009551 Bacteria 2119
118 Ga0105249_10221832 3300009553 Bacteria 1860
119 Ga0105249_10563850 3300009553 Bacteria 1191
120 Ga0105239_10106781 3300010375 Bacteria 3101
121 Ga0105239_10147224 3300010375 Bacteria 2627
122 Ga0105239_10388278 3300010375 Bacteria 1579
123 Ga0105239_10462677 3300010375 Bacteria 1440
124 Ga0105239_10505785 3300010375 Bacteria 1374
125 Ga0105239_10515077 3300010375 Bacteria 1361
126 Ga0105239_10794697 3300010375 Bacteria 1084
127 Ga0105239_10809338 3300010375 Bacteria 1074
128 Ga0105246_10022966 3300011119 Bacteria 4032
129 Ga0105246_10040526 3300011119 Bacteria 3144
130 Ga0105246_11034196 3300011119 Bacteria 746
131 Ga0157369_10088369 3300013105 Bacteria 3307
132 Ga0157369_10275009 3300013105 Bacteria 1754
133 Ga0157374_10004649 3300013296 Bacteria 11511
134 Ga0157374_10096989 3300013296 Bacteria 2820
135 Ga0157374_10212548 3300013296 Bacteria 1897
136 Ga0157378_10028246 3300013297 Bacteria 4947
137 Ga0157378_10163318 3300013297 Bacteria 2084
138 Ga0157378_10257856 3300013297 Bacteria 1672
139 Ga0163162_10281281 3300013306 Bacteria 1796
140 Ga0163162_10306674 3300013306 Bacteria 1720
141 Ga0163162_10522431 3300013306 Bacteria 1316
142 Ga0157372_10011526 3300013307 Bacteria 9403
143 Ga0157372_10116171 3300013307 Bacteria 3068
144 Ga0157372_10144092 3300013307 Bacteria 2747
145 Ga0157375_10319128 3300013308 Bacteria 1718
146 Ga0157375_10531406 3300013308 Bacteria 1339
147 Ga0157375_10602776 3300013308 Bacteria 1257
148 Ga0157375_11030365 3300013308 Bacteria 961
149 Ga0163163_10099027 3300014325 Bacteria 2937
150 Ga0157379_10179674 3300014968 Bacteria 1912
151 Ga0157376_10783588 3300014969 Bacteria 965
152 Ga0163161_10469933 3300017792 Bacteria 1019
153 Ga0197907_11424384 3300020069 Bacteria 992
154 Ga0213875_10211271 3300021388 Bacteria 913
155 Ga0207692_10012932 3300025898 Bacteria 3603
156 Ga0207692_10020748 3300025898 Bacteria 2994
157 Ga0207692_10038107 3300025898 Bacteria 2356
158 Ga0207692_10071430 3300025898 Bacteria 1830
159 Ga0207710_10010461 3300025900 Bacteria 3907
160 Ga0207688_10002447 3300025901 Bacteria 9997
161 Ga0207685_10204160 3300025905 Bacteria 930
162 Ga0207699_10000091 3300025906 Bacteria 67284
163 Ga0207699_10044318 3300025906 Bacteria 2589
164 Ga0207699_10233840 3300025906 Bacteria 1260
165 Ga0207643_10168987 3300025908 Bacteria 1319
166 Ga0207705_10001809 3300025909 Bacteria 16861
167 Ga0207684_10081645 3300025910 Bacteria 2751
168 Ga0207684_10101182 3300025910 Bacteria 2463
169 Ga0207684_10309564 3300025910 Bacteria 1362
170 Ga0207654_10120421 3300025911 Bacteria 1647
171 Ga0207707_10000046 3300025912 Bacteria 119404
172 Ga0207707_10012046 3300025912 Bacteria 7520
173 Ga0207695_10088350 3300025913 Bacteria 3120
174 Ga0207671_10139498 3300025914 Bacteria 1867
175 Ga0207693_10024755 3300025915 Bacteria 4760
176 Ga0207693_10059053 3300025915 Bacteria 3004
177 Ga0207693_10083306 3300025915 Bacteria 2505
178 Ga0207693_10104390 3300025915 Bacteria 2223
179 Ga0207693_10268616 3300025915 Bacteria 1337
180 Ga0207693_10515094 3300025915 Bacteria 933
181 Ga0207663_10012990 3300025916 Bacteria 4516
182 Ga0207663_10023707 3300025916 Bacteria 3526
183 Ga0207663_10416346 3300025916 Bacteria 1031
184 Ga0207660_10001152 3300025917 Bacteria 17644
185 Ga0207660_10054528 3300025917 Bacteria 2853
186 Ga0207657_10002845 3300025919 Bacteria 18597
187 Ga0207652_10000545 3300025921 Bacteria 38095
188 Ga0207652_10092283 3300025921 Bacteria 2663
189 Ga0207652_10323030 3300025921 Bacteria 1393
190 Ga0207646_10012815 3300025922 Bacteria 8036
191 Ga0207694_10034834 3300025924 Bacteria 3861
192 Ga0207694_10065653 3300025924 Bacteria 2829
193 Ga0207694_10391938 3300025924 Bacteria 1154
194 Ga0207687_10000711 3300025927 Bacteria 22543
195 Ga0207687_10103668 3300025927 Bacteria 2098
196 Ga0207687_10191199 3300025927 Bacteria 1593
197 Ga0207687_10290902 3300025927 Bacteria 1313
198 Ga0207687_10365200 3300025927 Bacteria 1179
199 Ga0207700_10075003 3300025928 Bacteria 2619
200 Ga0207700_10102668 3300025928 Bacteria 2284
201 Ga0207700_10205399 3300025928 Bacteria 1662
202 Ga0207700_10291286 3300025928 Bacteria 1407
203 Ga0207700_10484864 3300025928 Bacteria 1093
204 Ga0207700_10559522 3300025928 Bacteria 1016
205 Ga0207664_10011980 3300025929 Bacteria 6190
206 Ga0207664_10038078 3300025929 Bacteria 3727
207 Ga0207664_10176958 3300025929 Bacteria 1830
208 Ga0207664_10386444 3300025929 Bacteria 1243
209 Ga0207686_10015029 3300025934 Bacteria 4322
210 Ga0207686_10039770 3300025934 Bacteria 2855
211 Ga0207709_10280396 3300025935 Bacteria 1231
212 Ga0207704_10260029 3300025938 Bacteria 1308
213 Ga0207665_10006127 3300025939 Bacteria 7984
214 Ga0207711_10029041 3300025941 Bacteria 4661
215 Ga0207689_10151108 3300025942 Bacteria 1914
216 Ga0207661_10101464 3300025944 Bacteria 2417
217 Ga0207661_11016680 3300025944 Bacteria 763
218 Ga0207667_10017784 3300025949 Bacteria 7994
219 Ga0207667_10122061 3300025949 Bacteria 2685
220 Ga0207667_10393602 3300025949 Bacteria 1411
221 Ga0207667_10471261 3300025949 Bacteria 1275
222 Ga0207667_10528670 3300025949 Bacteria 1194
223 Ga0207668_10051972 3300025972 Bacteria 2834
224 Ga0207668_10981564 3300025972 Bacteria 754
225 Ga0207640_10058927 3300025981 Bacteria 2532
226 Ga0207640_10186659 3300025981 Bacteria 1559
227 Ga0207677_10285559 3300026023 Bacteria 1356
228 Ga0207677_10813440 3300026023 Bacteria 837
229 Ga0207703_10068986 3300026035 Bacteria 2914
230 Ga0207708_10148140 3300026075 Bacteria 1846
231 Ga0207708_10191824 3300026075 Bacteria 1627
232 Ga0207708_10216314 3300026075 Bacteria 1533
233 Ga0207702_10106449 3300026078 Bacteria 2485
234 Ga0207702_11096602 3300026078 Bacteria 790
235 Ga0207648_10014754 3300026089 Bacteria 7210
236 Ga0207648_10306794 3300026089 Bacteria 1424
237 Ga0207676_10100388 3300026095 Bacteria 2398
238 Ga0207674_10185105 3300026116 Bacteria 2033
239 Ga0207683_10155827 3300026121 Bacteria 2063
240 Ga0207698_10095060 3300026142 Bacteria 2452
241 Ga0207698_10154318 3300026142 Bacteria 1998
242 Ga0268265_10570391 3300028380 Bacteria 1077
243 Ga0268264_10948220 3300028381 Bacteria 865
244 Ga0307409_100131027 3300031995 Bacteria 2143
245 Ga0373960_0084630 3300035121 Bacteria 1005
246 Ga0373935_0096562 3300035692 Bacteria 1943
247 Ga0373947_0067589 3300035725 Bacteria 2184
248 Ga0373947_0158285 3300035725 Bacteria 1463
249 Ga0373947_0163248 3300035725 Bacteria 1442
250 Ga0373937_0214178 3300036401 Bacteria 1813
251 Ga0373925_0159989 3300037068 Bacteria 1773
252 Ga0373925_0258173 3300037068 Bacteria 1399
253 Ga0373925_0489576 3300037068 Bacteria 1009
254 Ga0395900_0196950 3300037418 Bacteria 2040
255 Ga0395898_0113344 3300037466 Bacteria 2599
256 Ga0395898_0417724 3300037466 Bacteria 1278
257 Ga0395905_0122667 3300037471 Bacteria 2443
258 Ga0436364_0623332 3300037853 Bacteria 1908
259 Ga0436364_1423224 3300037853 Bacteria 960
260 Ga0395901_0116773 3300038443 Bacteria 2803
261 Ga0395901_0166954 3300038443 Bacteria 2310
262 Ga0395901_0640489 3300038443 Bacteria 1067
263 Ga0436362_0778384 3300039453 Bacteria 1176
264 Ga0451789_1333056 3300041443 Bacteria 770
265 Ga0451845_0176869 3300041501 Bacteria 596
266 Ga0451853_3483001 3300041512 Bacteria 708
267 Ga0466963_0113280 3300044694 Bacteria 1863
268 Ga0466963_1119096 3300044694 Bacteria 554
269 Ga0453684_0206999 3300044712 Bacteria 2283
270 Ga0466960_0034831 3300044901 Bacteria 2349
271 Ga0466960_0270797 3300044901 Bacteria 949
272 Ga0466958_0172864 3300045836 Bacteria 1368
273 Ga0466967_0101485 3300045976 Bacteria 2630
274 Ga0495629_0015587 3300046459 Bacteria 5456
275 Ga0495629_0124823 3300046459 Bacteria 1793
276 Ga0495641_0037068 3300046461 Bacteria 2288
277 Ga0495641_0072246 3300046461 Bacteria 1548
278 Ga0495641_0115905 3300046461 Bacteria 1195
279 Ga0495580_0564623 3300046472 Bacteria 755
280 Ga0495582_0000164 3300046473 Bacteria 35821
281 Ga0495582_0250916 3300046473 Bacteria 1015
282 Ga0495582_0277970 3300046473 Bacteria 961
283 Ga0495582_0571236 3300046473 Bacteria 654
284 Ga0495584_0449886 3300046491 Bacteria 655
285 Ga0495594_0636170 3300046499 Bacteria 604
286 Ga0495607_0087840 3300046501 Bacteria 1691
287 Ga0495628_0787830 3300046516 Bacteria 666
288 Ga0495630_0000062 3300046517 Bacteria 86140
289 Ga0495630_0338820 3300046517 Bacteria 1150
290 Ga0495644_0002600 3300046523 Bacteria 7178
291 Ga0495663_0025584 3300046525 Bacteria 1722
292 Ga0495665_0018619 3300046531 Bacteria 3731
293 Ga0495586_0112412 3300046535 Bacteria 1516
294 Ga0495598_0006478 3300046537 Bacteria 2646
295 Ga0495656_0007269 3300046615 Bacteria 3907
296 Ga0495635_0626093 3300046663 Bacteria 701
297 Ga0495659_0011869 3300046664 Bacteria 2810
298 Ga0495588_0403411 3300046674 Bacteria 718
299 Ga0495599_0104608 3300046678 Bacteria 1763
300 Ga0495599_0411726 3300046678 Bacteria 804
301 Ga0495647_0486152 3300046681 Bacteria 574
302 Ga0495658_0000274 3300046683 Bacteria 29247
303 Ga0495613_0005391 3300046689 Bacteria 9610
304 Ga0495624_0521228 3300046690 Bacteria 710
305 Ga0495624_0607531 3300046690 Bacteria 652
306 Ga0495670_0002717 3300046691 Bacteria 8737
307 Ga0495671_0131581 3300046692 Bacteria 1220
308 Ga0495589_0103401 3300046794 Bacteria 1377
309 Ga0495581_0001981 3300047315 Bacteria 11491
310 Ga0495581_0351859 3300047315 Bacteria 860
311 Ga0495581_0380017 3300047315 Bacteria 824
312 Ga0495636_0093394 3300047318 Bacteria 1308
313 Ga0495676_0028121 3300047321 Bacteria 4810
314 Ga0495676_0060555 3300047321 Bacteria 2966
315 Ga0495676_0149626 3300047321 Bacteria 1663
316 Ga0495676_0166246 3300047321 Bacteria 1556
317 Ga0495680_0385322 3300047322 Bacteria 970
318 Ga0495675_0076143 3300047444 Bacteria 2115
319 Ga0495602_0161994 3300048088 Bacteria 1745
320 Ga0495602_0186419 3300048088 Bacteria 1595
321 Ga0496100_0001372 3300048903 Bacteria 11933
322 Ga0496100_0030739 3300048903 Bacteria 3333
323 Ga0496100_0107674 3300048903 Bacteria 1931
324 Ga0496100_0142709 3300048903 Bacteria 1699
325 Ga0496100_0156137 3300048903 Bacteria 1632
326 Ga0496101_0014255 3300048904 Bacteria 5341
327 Ga0496101_0018824 3300048904 Bacteria 4703
328 Ga0496101_0076742 3300048904 Bacteria 2462
329 Ga0496101_0119402 3300048904 Bacteria 1992
330 Ga0496101_0133359 3300048904 Bacteria 1887
331 Ga0496101_0423924 3300048904 Bacteria 1049
332 Ga0496102_0001014 3300048905 Bacteria 26227
333 Ga0496102_0011670 3300048905 Bacteria 7585
334 Ga0496102_0088189 3300048905 Bacteria 2867
335 Ga0496102_0101469 3300048905 Bacteria 2673
336 Ga0496102_0167682 3300048905 Bacteria 2067
337 Ga0496102_0417394 3300048905 Bacteria 1260
338 Ga0496102_1403715 3300048905 Bacteria 617
339 Ga0496103_0002279 3300048906 Bacteria 12128
340 Ga0496103_0206190 3300048906 Bacteria 1264
341 Ga0496103_0254595 3300048906 Bacteria 1130
342 Ga0496103_0444857 3300048906 Bacteria 831
343 Ga0496104_0003157 3300048907 Bacteria 14187
344 Ga0496104_0041363 3300048907 Bacteria 4321
345 Ga0496104_0522746 3300048907 Bacteria 1098
346 Ga0496104_0569580 3300048907 Bacteria 1043
347 Ga0496105_0024112 3300048908 Bacteria 4941
348 Ga0496105_0030678 3300048908 Bacteria 4405
349 Ga0496105_0035106 3300048908 Bacteria 4126
350 Ga0496105_0380845 3300048908 Bacteria 1123
351 Ga0496105_0552725 3300048908 Bacteria 898
352 Ga0496106_0002223 3300048909 Bacteria 14468
353 Ga0496106_0005430 3300048909 Bacteria 9430
354 Ga0496106_0032666 3300048909 Bacteria 3882
355 Ga0496106_0137452 3300048909 Bacteria 1920
356 Ga0496106_0483027 3300048909 Bacteria 995
357 Ga0496107_0000576 3300048910 Bacteria 20475
358 Ga0496107_0080553 3300048910 Bacteria 2374
359 Ga0496107_0295206 3300048910 Bacteria 1206
360 Ga0496107_0375316 3300048910 Bacteria 1058
361 Ga0496107_0457818 3300048910 Bacteria 947
362 Ga0496107_0547239 3300048910 Bacteria 857
363 Ga0496108_0000504 3300048911 Bacteria 30868
364 Ga0496108_0009665 3300048911 Bacteria 7817
365 Ga0496108_0060982 3300048911 Bacteria 3174
366 Ga0496108_0171724 3300048911 Bacteria 1876
367 Ga0496108_0537141 3300048911 Bacteria 1020
368 Ga0496109_0005134 3300048912 Bacteria 10926
369 Ga0496109_0007526 3300048912 Bacteria 9227
370 Ga0496109_0050789 3300048912 Bacteria 3776
371 Ga0496109_0732706 3300048912 Bacteria 926
372 Ga0496109_0794157 3300048912 Bacteria 884
373 Ga0496109_0960567 3300048912 Bacteria 792
374 Ga0496110_0003927 3300048913 Bacteria 11441
375 Ga0496110_0024831 3300048913 Bacteria 5114
376 Ga0496110_1079955 3300048913 Bacteria 711
377 Ga0496111_0000431 3300048914 Bacteria 21230
378 Ga0496111_0002997 3300048914 Bacteria 10337
379 Ga0496112_0001159 3300048915 Bacteria 19691
380 Ga0496112_0008026 3300048915 Bacteria 9417
381 Ga0496112_0029578 3300048915 Bacteria 5298
382 Ga0496112_0211216 3300048915 Bacteria 1898
383 Ga0496113_0000873 3300048916 Bacteria 15806
384 Ga0496113_0002640 3300048916 Bacteria 10500
385 Ga0496113_0117766 3300048916 Bacteria 2074
386 Ga0496114_0020618 3300048917 Bacteria 5351
387 Ga0496114_0023514 3300048917 Bacteria 5029
388 Ga0496114_0097188 3300048917 Bacteria 2508
389 Ga0496114_0130069 3300048917 Bacteria 2173
390 Ga0496114_1253636 3300048917 Bacteria 628
391 Ga0496115_0004906 3300048918 Bacteria 9711
392 Ga0496115_0012001 3300048918 Bacteria 6511
393 Ga0496115_0050872 3300048918 Bacteria 3321
394 Ga0501033_0340984 3300049570 Bacteria 1051
395 Ga0501040_0305504 3300049576 Bacteria 1137
396 Ga0501040_0803852 3300049576 Bacteria 680
397 Ga0501048_0751273 3300049582 Bacteria 701
398 Ga0501067_0052524 3300049583 Bacteria 2258
399 Ga0501067_0076250 3300049583 Bacteria 1858
400 Ga0501068_0001216 3300049584 Bacteria 13677
401 Ga0501068_0068730 3300049584 Bacteria 2159
402 Ga0501069_0085702 3300049585 Bacteria 1778
403 Ga0501069_0120138 3300049585 Bacteria 1500
404 Ga0501069_0148668 3300049585 Bacteria 1345
405 Ga0501074_0656661 3300049590 Bacteria 741
406 Ga0501076_1404159 3300049592 Bacteria 574
407 nmdc:mga05p37_744692_c1 3300050507 Bacteria 1081
408 nmdc:mga0n895_542205_c1 3300050512 Bacteria 1169
409 nmdc:mga0n895_615850_c1 3300050512 Bacteria 1087
410 nmdc:mga0n895_8474_c1 3300050512 Bacteria 8902
411 nmdc:mga0rr50_801_c1 3300050513 Bacteria 16963
412 nmdc:mga08x19_20127_c1 3300050514 Bacteria 4107
413 Ga0495601_0000972 3300053077 Bacteria 15644
414 Ga0495655_0147944 3300053083 Bacteria 736
415 Ga0495595_0092296 3300053084 Bacteria 1454
416 Ga0495619_0011734 3300053085 Bacteria 5520
417 Ga0530510_0059914 3300061734 Bacteria 2754
418 Ga0530510_0171425 3300061734 Bacteria 1607
419 Ga0530510_0534319 3300061734 Bacteria 890
420 Ga0207646_10244524
421 Ga0070658_10000679
422 Ga0070683_100013349
423 Ga0070683_100208409
424 Ga0070690_100404627
425 Ga0068869_100120785
426 Ga0070680_100001867
427 Ga0070680_100016478
428 Ga0070680_100352921
429 Ga0070682_100047108
430 Ga0070682_100062228
431 Ga0068868_100002586
432 Ga0068868_100044625
433 Ga0070660_100028278
434 Ga0070691_10025952
435 Ga0070692_10052385
436 Ga0070692_10236048
437 Ga0070668_100764996
438 Ga0070669_100543268
439 Ga0070671_100754796
440 Ga0070688_100103725
441 Ga0070659_100143068
442 Ga0070709_10000168
443 Ga0070709_10047466
444 Ga0070709_10213532
445 Ga0070709_10265831
446 Ga0070714_100002356
447 Ga0070714_100084013
448 Ga0070714_100401567
449 Ga0070713_100017469
450 Ga0070713_100043497
451 Ga0070713_100129935
452 Ga0070713_100155021
453 Ga0070713_100237230
454 Ga0070710_10013347
455 Ga0070710_10027430
456 Ga0070710_10055029
457 Ga0070711_100079632
458 Ga0070711_100213514
459 Ga0070711_100746278
460 Ga0070700_100073107
461 Ga0070700_100115146
462 Ga0070700_100115554
463 Ga0070708_100052223
464 Ga0070678_100608207
465 Ga0070681_10000019
466 Ga0070681_10009147
467 Ga0070681_10150796
468 Ga0068867_100017062
469 Ga0070707_100099106
470 Ga0070699_100017474
471 Ga0070679_100008802
472 Ga0070679_100210673
473 Ga0070679_100240233
474 Ga0070679_100440850
475 Ga0070684_100046295
476 Ga0070684_100046554
477 Ga0070684_100267916
478 Ga0070684_100272279
479 Ga0070672_100647206
480 Ga0070686_100107003
481 Ga0070696_100015431
482 Ga0070693_100576652
483 Ga0068855_100058995
484 Ga0068855_100086569
485 Ga0068855_100417011
486 Ga0070664_100831940
487 Ga0068854_100022599
488 Ga0068854_100122440
489 Ga0068856_100912089
490 Ga0068856_101346272
491 Ga0068852_100117361
492 Ga0068852_100216374
493 Ga0068852_100253873
494 Ga0068866_10064588
495 Ga0068863_101023747
496 Ga0068858_100006881
497 Ga0070717_10000119
498 Ga0070717_10468523
499 Ga0075365_10142967
500 Ga0070716_100025811
501 Ga0070712_100019821
502 Ga0070712_100046205
503 Ga0070712_100104209
504 Ga0070712_100274514
505 Ga0097621_100247835
506 Ga0068871_100240539
507 Ga0068871_100241375
508 Ga0075434_100003275
509 Ga0075434_100291643
510 Ga0075436_100031431
511 Ga0075435_100001051
512 Ga0075435_100477406
513 Ga0105240_10021196
514 Ga0105245_10008976
515 Ga0105245_10013242
516 Ga0105245_10068701
517 Ga0105245_10222349
518 Ga0105245_10291110
519 Ga0105245_11225404
520 Ga0105247_10027951
521 Ga0105247_10738066
522 Ga0114129_10339900
523 Ga0105243_10285165
524 Ga0105241_10020481
525 Ga0105241_10536351
526 Ga0105242_10073048
527 Ga0105242_10338612
528 Ga0105242_10356933
529 Ga0105242_10440273
530 Ga0105242_11910330
531 Ga0105248_10023069
532 Ga0105248_10428349
533 Ga0105237_10630766
534 Ga0105238_10132890
535 Ga0105238_10170877
536 Ga0105238_10175625
537 Ga0105249_10221832
538 Ga0105249_10563850
539 Ga0105239_10106781
540 Ga0105239_10147224
541 Ga0105239_10388278
542 Ga0105239_10462677
543 Ga0105239_10505785
544 Ga0105239_10515077
545 Ga0105239_10794697
546 Ga0105239_10809338
547 Ga0105246_10022966
548 Ga0105246_10040526
549 Ga0105246_11034196
550 Ga0157369_10088369
551 Ga0157369_10275009
552 Ga0157374_10004649
553 Ga0157374_10096989
554 Ga0157374_10212548
555 Ga0157378_10028246
556 Ga0157378_10163318
557 Ga0157378_10257856
558 Ga0163162_10281281
559 Ga0163162_10306674
560 Ga0163162_10522431
561 Ga0157372_10011526
562 Ga0157372_10116171
563 Ga0157372_10144092
564 Ga0157375_10319128
565 Ga0157375_10531406
566 Ga0157375_10602776
567 Ga0157375_11030365
568 Ga0163163_10099027
569 Ga0157379_10179674
570 Ga0157376_10783588
571 Ga0163161_10469933
572 Ga0197907_11424384
573 Ga0213875_10211271
574 Ga0207692_10012932
575 Ga0207692_10020748
576 Ga0207692_10038107
577 Ga0207692_10071430
578 Ga0207710_10010461
579 Ga0207688_10002447
580 Ga0207685_10204160
581 Ga0207699_10000091
582 Ga0207699_10044318
583 Ga0207699_10233840
584 Ga0207643_10168987
585 Ga0207705_10001809
586 Ga0207684_10081645
587 Ga0207684_10101182
588 Ga0207684_10309564
589 Ga0207654_10120421
590 Ga0207707_10000046
591 Ga0207707_10012046
592 Ga0207695_10088350
593 Ga0207671_10139498
594 Ga0207693_10024755
595 Ga0207693_10059053
596 Ga0207693_10083306
597 Ga0207693_10104390
598 Ga0207693_10268616
599 Ga0207693_10515094
600 Ga0207663_10012990
601 Ga0207663_10023707
602 Ga0207663_10416346
603 Ga0207660_10001152
604 Ga0207660_10054528
605 Ga0207657_10002845
606 Ga0207652_10000545
607 Ga0207652_10092283
608 Ga0207652_10323030
609 Ga0207646_10012815
610 Ga0207694_10034834
611 Ga0207694_10065653
612 Ga0207694_10391938
613 Ga0207687_10000711
614 Ga0207687_10103668
615 Ga0207687_10191199
616 Ga0207687_10290902
617 Ga0207687_10365200
618 Ga0207700_10075003
619 Ga0207700_10102668
620 Ga0207700_10205399
621 Ga0207700_10291286
622 Ga0207700_10484864
623 Ga0207700_10559522
624 Ga0207664_10011980
625 Ga0207664_10038078
626 Ga0207664_10176958
627 Ga0207664_10386444
628 Ga0207686_10015029
629 Ga0207686_10039770
630 Ga0207709_10280396
631 Ga0207704_10260029
632 Ga0207665_10006127
633 Ga0207711_10029041
634 Ga0207689_10151108
635 Ga0207661_10101464
636 Ga0207661_11016680
637 Ga0207667_10017784
638 Ga0207667_10122061
639 Ga0207667_10393602
640 Ga0207667_10471261
641 Ga0207667_10528670
642 Ga0207668_10051972
643 Ga0207668_10981564
644 Ga0207640_10058927
645 Ga0207640_10186659
646 Ga0207677_10285559
647 Ga0207677_10813440
648 Ga0207703_10068986
649 Ga0207708_10148140
650 Ga0207708_10191824
651 Ga0207708_10216314
652 Ga0207702_10106449
653 Ga0207702_11096602
654 Ga0207648_10014754
655 Ga0207648_10306794
656 Ga0207676_10100388
657 Ga0207674_10185105
658 Ga0207683_10155827
659 Ga0207698_10095060
660 Ga0207698_10154318
661 Ga0268265_10570391
662 Ga0268264_10948220
663 Ga0307409_100131027
664 Ga0373960_0084630
665 Ga0373935_0096562
666 Ga0373947_0067589
667 Ga0373947_0158285
668 Ga0373947_0163248
669 Ga0373937_0214178
670 Ga0373925_0159989
671 Ga0373925_0258173
672 Ga0373925_0489576
673 Ga0395900_0196950
674 Ga0395898_0113344
675 Ga0395898_0417724
676 Ga0395905_0122667
677 Ga0436364_0623332
678 Ga0436364_1423224
679 Ga0395901_0116773
680 Ga0395901_0166954
681 Ga0395901_0640489
682 Ga0436362_0778384
683 Ga0451789_1333056
684 Ga0451845_0176869
685 Ga0451853_3483001
686 Ga0466963_0113280
687 Ga0466963_1119096
688 Ga0453684_0206999
689 Ga0466960_0034831
690 Ga0466960_0270797
691 Ga0466958_0172864
692 Ga0466967_0101485
693 Ga0495629_0015587
694 Ga0495629_0124823
695 Ga0495641_0037068
696 Ga0495641_0072246
697 Ga0495641_0115905
698 Ga0495580_0564623
699 Ga0495582_0000164
700 Ga0495582_0250916
701 Ga0495582_0277970
702 Ga0495582_0571236
703 Ga0495584_0449886
704 Ga0495594_0636170
705 Ga0495607_0087840
706 Ga0495628_0787830
707 Ga0495630_0000062
708 Ga0495630_0338820
709 Ga0495644_0002600
710 Ga0495663_0025584
711 Ga0495665_0018619
712 Ga0495586_0112412
713 Ga0495598_0006478
714 Ga0495656_0007269
715 Ga0495635_0626093
716 Ga0495659_0011869
717 Ga0495588_0403411
718 Ga0495599_0104608
719 Ga0495599_0411726
720 Ga0495647_0486152
721 Ga0495658_0000274
722 Ga0495613_0005391
723 Ga0495624_0521228
724 Ga0495624_0607531
725 Ga0495670_0002717
726 Ga0495671_0131581
727 Ga0495589_0103401
728 Ga0495581_0001981
729 Ga0495581_0351859
730 Ga0495581_0380017
731 Ga0495636_0093394
732 Ga0495676_0028121
733 Ga0495676_0060555
734 Ga0495676_0149626
735 Ga0495676_0166246
736 Ga0495680_0385322
737 Ga0495675_0076143
738 Ga0495602_0161994
739 Ga0495602_0186419
740 Ga0496100_0001372
741 Ga0496100_0030739
742 Ga0496100_0107674
743 Ga0496100_0142709
744 Ga0496100_0156137
745 Ga0496101_0014255
746 Ga0496101_0018824
747 Ga0496101_0076742
748 Ga0496101_0119402
749 Ga0496101_0133359
750 Ga0496101_0423924
751 Ga0496102_0001014
752 Ga0496102_0011670
753 Ga0496102_0088189
754 Ga0496102_0101469
755 Ga0496102_0167682
756 Ga0496102_0417394
757 Ga0496102_1403715
758 Ga0496103_0002279
759 Ga0496103_0206190
760 Ga0496103_0254595
761 Ga0496103_0444857
762 Ga0496104_0003157
763 Ga0496104_0041363
764 Ga0496104_0522746
765 Ga0496104_0569580
766 Ga0496105_0024112
767 Ga0496105_0030678
768 Ga0496105_0035106
769 Ga0496105_0380845
770 Ga0496105_0552725
771 Ga0496106_0002223
772 Ga0496106_0005430
773 Ga0496106_0032666
774 Ga0496106_0137452
775 Ga0496106_0483027
776 Ga0496107_0000576
777 Ga0496107_0080553
778 Ga0496107_0295206
779 Ga0496107_0375316
780 Ga0496107_0457818
781 Ga0496107_0547239
782 Ga0496108_0000504
783 Ga0496108_0009665
784 Ga0496108_0060982
785 Ga0496108_0171724
786 Ga0496108_0537141
787 Ga0496109_0005134
788 Ga0496109_0007526
789 Ga0496109_0050789
790 Ga0496109_0732706
791 Ga0496109_0794157
792 Ga0496109_0960567
793 Ga0496110_0003927
794 Ga0496110_0024831
795 Ga0496110_1079955
796 Ga0496111_0000431
797 Ga0496111_0002997
798 Ga0496112_0001159
799 Ga0496112_0008026
800 Ga0496112_0029578
801 Ga0496112_0211216
802 Ga0496113_0000873
803 Ga0496113_0002640
804 Ga0496113_0117766
805 Ga0496114_0020618
806 Ga0496114_0023514
807 Ga0496114_0097188
808 Ga0496114_0130069
809 Ga0496114_1253636
810 Ga0496115_0004906
811 Ga0496115_0012001
812 Ga0496115_0050872
813 Ga0501033_0340984
814 Ga0501040_0305504
815 Ga0501040_0803852
816 Ga0501048_0751273
817 Ga0501067_0052524
818 Ga0501067_0076250
819 Ga0501068_0001216
820 Ga0501068_0068730
821 Ga0501069_0085702
822 Ga0501069_0120138
823 Ga0501069_0148668
824 Ga0501074_0656661
825 Ga0501076_1404159
826 nmdc:mga05p37_744692_c1
827 nmdc:mga0n895_542205_c1
828 nmdc:mga0n895_615850_c1
829 nmdc:mga0n895_8474_c1
830 nmdc:mga0rr50_801_c1
831 nmdc:mga08x19_20127_c1
832 Ga0495601_0000972
833 Ga0495655_0147944
834 Ga0495595_0092296
835 Ga0495619_0011734
836 Ga0530510_0059914
837 Ga0530510_0171425
838 Ga0530510_0534319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

3

160

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.8778 1 180
2xw7-assembly1.cif.gz_B structure of mycobacterium smegmatis putative reductase ms0308 0.859 1 180
7xh2-assembly1.cif.gz_A dihydrofolate reductase-like protein sach in safracin biosynthesis 0.8129 3 181
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8093 4 183
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8087 3 182
ID Description Score Start End Superfamily
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8778 1 180 3.40.430.10
2xw7B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.859 1 180 3.40.430.10
af_Q54MY9_581_853_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8253 163 180 1.10.510.10
af_A4HZA0_1445_1711_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.8244 163 180 1.10.510.10
af_K7LUZ4_16_86_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.8029 162 180 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A1G9I3A7-F1-model_v4 Dihydrofolate reductase 0.9562 2 183 GO:0008703
GO:0009231
AF-A0A4Y3WS67-F1-model_v4 Deaminase 0.945 1 185 GO:0008703
GO:0009231
AF-A0A0W7X5P0-F1-model_v4 Deaminase 0.9319 2 183 GO:0008703
GO:0009231
AF-A0A1E4I276-F1-model_v4 Deaminase 0.9254 1 183 GO:0008703
GO:0009231
AF-A0A4Y3WS67-F1-model_v4 Deaminase 0.9105 1 185 GO:0008703
GO:0009231

Map