F439452

General Info

Members Datasets Scaffolds Average Seq Length
419 195 838 259

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10184329|Ga0070658_101843292
Length 243
Sequence MCGIAGYSVRTGSSLDRTLAAQALLAAIAERGADAVGYAYRRPEDAYATVVKQRTPASKLLERVAVPDEASQLLVHVRDYTKGHPSINANNHPVRHGPVVGIHNGIITNDDELLAPHSCARAEAKMTVDSEAIFALAAHSRNDPRALEHLRGALATGWLDEREPGVVFSTKLALDTVEQFCALKLRKREVKPGSWFAIAGGEVVRRERFRPDLEYVEPDPLPAVRAPGERDFCMTRLAAIAAI

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
72 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
74 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
88 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
94 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
111 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
123 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
124 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
125 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
129 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
130 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
131 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
132 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
133 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
139 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
140 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
152 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
153 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
154 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
161 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
162 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
190 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
191 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
192 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
193 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
194 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
195 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.37
Metatranscriptomes 2.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.74
Rhizosphere 88.07
Stem 0
Stem Tuber 0
Unclassified 9.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10184329 3300005327 Bacteria 1757
2 Ga0070658_10049856 3300005327 Bacteria 3392
3 Ga0070658_10063015 3300005327 Bacteria 3022
4 Ga0070658_10092941 3300005327 Bacteria 2488
5 Ga0070658_10380687 3300005327 Unclassified 1210
6 Ga0070680_100083888 3300005336 Bacteria 2631
7 Ga0070680_100132757 3300005336 Bacteria 2084
8 Ga0070660_100038053 3300005339 Bacteria 3650
9 Ga0070660_100039694 3300005339 Bacteria 3578
10 Ga0070660_100065329 3300005339 Bacteria 2831
11 Ga0070661_100017268 3300005344 Bacteria 5117
12 Ga0070661_100089403 3300005344 Bacteria 2280
13 Ga0070661_100440390 3300005344 Bacteria 1035
14 Ga0070671_100049208 3300005355 Bacteria 3507
15 Ga0070659_100022717 3300005366 Bacteria 4791
16 Ga0070659_100144258 3300005366 Bacteria 1939
17 Ga0070714_100065942 3300005435 Bacteria 3119
18 Ga0070714_100093219 3300005435 Bacteria 2641
19 Ga0070681_10001211 3300005458 Bacteria 22450
20 Ga0070681_10015354 3300005458 Bacteria 7618
21 Ga0070681_10061551 3300005458 Bacteria 3727
22 Ga0070681_10121486 3300005458 Bacteria 2547
23 Ga0070706_100632196 3300005467 Unclassified 994
24 Ga0070679_100018501 3300005530 Bacteria 6762
25 Ga0070679_100040086 3300005530 Bacteria 4659
26 Ga0070679_100236057 3300005530 Bacteria 1787
27 Ga0070684_100198381 3300005535 Bacteria 1828
28 Ga0068853_100295659 3300005539 Bacteria 1495
29 Ga0070665_100044026 3300005548 Bacteria 4483
30 Ga0070665_100315952 3300005548 Bacteria 1566
31 Ga0068855_100018717 3300005563 Bacteria 8327
32 Ga0068855_100036020 3300005563 Bacteria 5891
33 Ga0068855_100298359 3300005563 Bacteria 1785
34 Ga0068855_100828323 3300005563 Unclassified 982
35 Ga0068855_100865820 3300005563 Bacteria 956
36 Ga0068857_100486617 3300005577 Bacteria 1157
37 Ga0068856_100045809 3300005614 Bacteria 4307
38 Ga0068852_100029305 3300005616 Bacteria 4520
39 Ga0068863_100224090 3300005841 Unclassified 1812
40 Ga0070717_10003139 3300006028 Bacteria 11806
41 Ga0070717_10284342 3300006028 Bacteria 1468
42 Ga0070712_100135205 3300006175 Bacteria 1874
43 Ga0070712_100252909 3300006175 Bacteria 1409
44 Ga0075428_100425957 3300006844 Bacteria 1422
45 Ga0075434_100014043 3300006871 Bacteria 7646
46 Ga0075435_100044712 3300007076 Bacteria 3548
47 Ga0075435_100331333 3300007076 Bacteria 1304
48 Ga0105240_10032416 3300009093 Bacteria 6764
49 Ga0105245_10300589 3300009098 Bacteria 1575
50 Ga0105245_10372180 3300009098 Bacteria 1421
51 Ga0114129_10279860 3300009147 Bacteria 2229
52 Ga0114129_10829511 3300009147 Bacteria 1177
53 Ga0105241_10626745 3300009174 Bacteria 974
54 Ga0105242_10044962 3300009176 Bacteria 3577
55 Ga0105248_10427973 3300009177 Bacteria 1491
56 Ga0105237_10093011 3300009545 Bacteria 3005
57 Ga0105237_10170647 3300009545 Bacteria 2175
58 Ga0105238_10079734 3300009551 Bacteria 3264
59 Ga0105238_10099238 3300009551 Bacteria 2895
60 Ga0105239_10317922 3300010375 Bacteria 1755
61 Ga0157373_10038949 3300013100 Bacteria 3404
62 Ga0157373_10103085 3300013100 Bacteria 2007
63 Ga0157370_10014193 3300013104 Bacteria 8164
64 Ga0157370_10018591 3300013104 Bacteria 6987
65 Ga0157370_10032453 3300013104 Bacteria 5100
66 Ga0157370_10060745 3300013104 Bacteria 3587
67 Ga0157369_10002320 3300013105 Bacteria 22898
68 Ga0157369_10010474 3300013105 Bacteria 10561
69 Ga0157369_10018305 3300013105 Bacteria 7856
70 Ga0157369_10023530 3300013105 Bacteria 6861
71 Ga0157369_10082174 3300013105 Bacteria 3447
72 Ga0157369_10135938 3300013105 Bacteria 2603
73 Ga0157369_10144342 3300013105 Bacteria 2517
74 Ga0157369_10147025 3300013105 Bacteria 2492
75 Ga0157369_10258223 3300013105 Bacteria 1817
76 Ga0157374_10230619 3300013296 Bacteria 1819
77 Ga0157374_10378851 3300013296 Bacteria 1409
78 Ga0157378_10089095 3300013297 Bacteria 2801
79 Ga0163162_10456616 3300013306 Unclassified 1409
80 Ga0157372_10179201 3300013307 Bacteria 2453
81 Ga0157372_10179845 3300013307 Bacteria 2448
82 Ga0157372_10276154 3300013307 Bacteria 1953
83 Ga0157372_10889827 3300013307 Bacteria 1033
84 Ga0157375_10021615 3300013308 Bacteria 5905
85 Ga0182008_10040740 3300014497 Bacteria 2318
86 Ga0182008_10095926 3300014497 Bacteria 1464
87 Ga0197907_10207184 3300020069 Bacteria 1932
88 Ga0206356_10442128 3300020070 Unclassified 1456
89 Ga0206356_11047083 3300020070 Bacteria 1804
90 Ga0206356_11331715 3300020070 Bacteria 1488
91 Ga0206354_10026336 3300020081 Bacteria 2824
92 Ga0206354_10436935 3300020081 Bacteria 1514
93 Ga0206353_10590627 3300020082 Bacteria 3736
94 Ga0206353_10655724 3300020082 Bacteria 10912
95 Ga0206353_10852712 3300020082 Bacteria 1092
96 Ga0206353_11615899 3300020082 Bacteria 4176
97 Ga0213876_10021365 3300021384 Bacteria 3424
98 Ga0213871_10001003 3300021441 Bacteria 4414
99 Ga0224712_10045749 3300022467 Bacteria 1676
100 Ga0207705_10055349 3300025909 Bacteria 2860
101 Ga0207705_10078336 3300025909 Bacteria 2405
102 Ga0207705_10084070 3300025909 Bacteria 2323
103 Ga0207707_10018763 3300025912 Bacteria 6031
104 Ga0207707_10072086 3300025912 Bacteria 3011
105 Ga0207695_10621959 3300025913 Unclassified 961
106 Ga0207693_10035132 3300025915 Bacteria 3952
107 Ga0207693_10071833 3300025915 Bacteria 2709
108 Ga0207693_10235226 3300025915 Bacteria 1439
109 Ga0207693_10271495 3300025915 Bacteria 1329
110 Ga0207663_10075074 3300025916 Bacteria 2193
111 Ga0207663_10084296 3300025916 Bacteria 2090
112 Ga0207663_10258511 3300025916 Bacteria 1285
113 Ga0207660_10012959 3300025917 Bacteria 5462
114 Ga0207660_10110267 3300025917 Bacteria 2070
115 Ga0207660_10161351 3300025917 Bacteria 1730
116 Ga0207660_10207724 3300025917 Unclassified 1532
117 Ga0207657_10002072 3300025919 Bacteria 21689
118 Ga0207657_10003977 3300025919 Bacteria 15705
119 Ga0207657_10031481 3300025919 Bacteria 4804
120 Ga0207657_10149644 3300025919 Bacteria 1902
121 Ga0207652_10105849 3300025921 Bacteria 2489
122 Ga0207646_10352408 3300025922 Bacteria 1330
123 Ga0207687_10295089 3300025927 Unclassified 1304
124 Ga0207700_10161463 3300025928 Bacteria 1861
125 Ga0207664_10015905 3300025929 Bacteria 5479
126 Ga0207664_10043349 3300025929 Bacteria 3518
127 Ga0207644_10055770 3300025931 Bacteria 2849
128 Ga0207690_10037247 3300025932 Bacteria 3157
129 Ga0207690_10155421 3300025932 Bacteria 1700
130 Ga0207690_10161118 3300025932 Bacteria 1672
131 Ga0207661_10382916 3300025944 Bacteria 1273
132 Ga0207667_10023514 3300025949 Bacteria 6785
133 Ga0207667_10196180 3300025949 Bacteria 2071
134 Ga0207667_10249128 3300025949 Bacteria 1817
135 Ga0207639_10314095 3300026041 Bacteria 1389
136 Ga0207702_10139309 3300026078 Bacteria 2193
137 Ga0207641_10070184 3300026088 Bacteria 3010
138 Ga0207674_10096898 3300026116 Bacteria 2934
139 Ga0207674_10422551 3300026116 Bacteria 1288
140 Ga0207683_10011896 3300026121 Bacteria 7426
141 Ga0207698_10027805 3300026142 Bacteria 4021
142 Ga0207698_10079086 3300026142 Bacteria 2643
143 Ga0207428_10148396 3300027907 Unclassified 1786
144 Ga0268266_10100255 3300028379 Bacteria 2551
145 Ga0265323_10055124 3300028653 Bacteria 1399
146 Ga0265338_10025049 3300028800 Bacteria 6074
147 Ga0265325_10005193 3300031241 Bacteria 8090
148 Ga0265329_10007817 3300031242 Bacteria 4102
149 Ga0265340_10076623 3300031247 Bacteria 1579
150 Ga0265327_10087784 3300031251 Bacteria 1522
151 Ga0265316_10055356 3300031344 Bacteria 3102
152 Ga0265313_10004697 3300031595 Bacteria 10314
153 Ga0265313_10097618 3300031595 Bacteria 1309
154 Ga0265314_10003413 3300031711 Bacteria 15378
155 Ga0307409_100180114 3300031995 Bacteria 1870
156 Ga0373926_0010296 3300035083 Bacteria 3133
157 Ga0373944_0009152 3300035089 Bacteria 2682
158 Ga0373923_0067204 3300035111 Bacteria 1533
159 Ga0373936_0015264 3300035113 Bacteria 2942
160 Ga0373945_0002944 3300035116 Bacteria 5349
161 Ga0373953_0033039 3300035117 Unclassified 2022
162 Ga0373957_0030496 3300035120 Bacteria 1976
163 Ga0373943_0000693 3300035170 Bacteria 14694
164 Ga0373946_0023556 3300035171 Bacteria 2407
165 Ga0373935_0038588 3300035692 Bacteria 2991
166 Ga0373927_0037737 3300035695 Bacteria 3139
167 Ga0373927_0192809 3300035695 Unclassified 1337
168 Ga0373933_0040662 3300035724 Bacteria 2741
169 Ga0373947_0008896 3300035725 Bacteria 5774
170 Ga0373937_0072894 3300036401 Bacteria 3167
171 Ga0373925_0007920 3300037068 Bacteria 7737
172 Ga0373925_0039554 3300037068 Bacteria 3488
173 Ga0373925_0148160 3300037068 Bacteria 1841
174 Ga0395899_0038597 3300037312 Bacteria 3577
175 Ga0395899_0093527 3300037312 Bacteria 2176
176 Ga0395899_0134915 3300037312 Bacteria 1760
177 Ga0395900_0111129 3300037418 Bacteria 2815
178 Ga0395900_0125279 3300037418 Bacteria 2635
179 Ga0395900_0284611 3300037418 Bacteria 1644
180 Ga0395900_0372791 3300037418 Unclassified 1397
181 Ga0395900_0550514 3300037418 Bacteria 1098
182 Ga0395898_0016583 3300037466 Bacteria 7531
183 Ga0395898_0023488 3300037466 Bacteria 6229
184 Ga0395898_0250681 3300037466 Unclassified 1688
185 Ga0395898_0299789 3300037466 Bacteria 1533
186 Ga0395905_0132115 3300037471 Bacteria 2348
187 Ga0395905_0177075 3300037471 Unclassified 2002
188 Ga0395905_0412828 3300037471 Bacteria 1245
189 Ga0395901_0236918 3300038443 Unclassified 1904
190 Ga0395901_0385921 3300038443 Bacteria 1441
191 Ga0395901_0628837 3300038443 Unclassified 1079
192 Ga0395901_0653288 3300038443 Bacteria 1055
193 Ga0436365_1245864 3300039437 Bacteria 1431
194 Ga0436365_1344480 3300039437 Bacteria 3100
195 Ga0436360_1170606 3300039438 Bacteria 14832
196 Ga0436363_0621978 3300039450 Bacteria 1989
197 Ga0436363_0651653 3300039450 Bacteria 1127
198 Ga0466965_0030561 3300044683 Bacteria 2625
199 Ga0466965_0077573 3300044683 Bacteria 1678
200 Ga0466966_0034948 3300044684 Bacteria 3249
201 Ga0466966_0203310 3300044684 Bacteria 1198
202 Ga0466961_0011744 3300044693 Bacteria 5596
203 Ga0466961_0019293 3300044693 Bacteria 4387
204 Ga0466961_0025016 3300044693 Bacteria 3842
205 Ga0466961_0078872 3300044693 Bacteria 2086
206 Ga0466963_0008566 3300044694 Bacteria 6138
207 Ga0466963_0012785 3300044694 Bacteria 5143
208 Ga0466963_0030385 3300044694 Bacteria 3485
209 Ga0466963_0036405 3300044694 Bacteria 3210
210 Ga0466963_0038255 3300044694 Bacteria 3136
211 Ga0466963_0091018 3300044694 Bacteria 2077
212 Ga0466963_0112362 3300044694 Bacteria 1870
213 Ga0466963_0146580 3300044694 Bacteria 1638
214 Ga0466963_0302412 3300044694 Bacteria 1125
215 Ga0466963_0354774 3300044694 Archaea 1033
216 Ga0466964_0021680 3300044706 Bacteria 2486
217 Ga0466964_0051696 3300044706 Bacteria 1688
218 Ga0466964_0225896 3300044706 Bacteria 911
219 Ga0466971_0000609 3300044719 Bacteria 14247
220 Ga0466971_0007738 3300044719 Bacteria 4682
221 Ga0466971_0007951 3300044719 Bacteria 4620
222 Ga0466957_0003191 3300044842 Bacteria 8953
223 Ga0466957_0018713 3300044842 Bacteria 4069
224 Ga0466957_0057842 3300044842 Bacteria 2374
225 Ga0466960_0223126 3300044901 Bacteria 1038
226 Ga0466959_0177502 3300045049 Bacteria 1491
227 Ga0466959_0307797 3300045049 Bacteria 1084
228 Ga0466958_0005117 3300045836 Bacteria 7009
229 Ga0466958_0076765 3300045836 Bacteria 2051
230 Ga0466958_0136874 3300045836 Bacteria 1540
231 Ga0466958_0212991 3300045836 Unclassified 1231
232 Ga0466967_0000080 3300045976 Bacteria 34736
233 Ga0466967_0004471 3300045976 Bacteria 9436
234 Ga0466967_0004614 3300045976 Bacteria 9336
235 Ga0466967_0110402 3300045976 Bacteria 2526
236 Ga0466967_0142900 3300045976 Bacteria 2230
237 Ga0466967_0160034 3300045976 Bacteria 2112
238 Ga0466967_0166727 3300045976 Bacteria 2070
239 Ga0466967_0235869 3300045976 Bacteria 1743
240 Ga0466967_0269608 3300045976 Bacteria 1631
241 Ga0466967_0342782 3300045976 Unclassified 1445
242 Ga0466967_0345004 3300045976 Unclassified 1440
243 Ga0495592_0001569 3300046454 Bacteria 15968
244 Ga0495592_0116303 3300046454 Unclassified 1887
245 Ga0495629_0000319 3300046459 Bacteria 41153
246 Ga0495641_0035560 3300046461 Bacteria 2346
247 Ga0495651_0000008 3300046462 Bacteria 156989
248 Ga0495651_0021468 3300046462 Bacteria 5019
249 Ga0495651_0031603 3300046462 Bacteria 4128
250 Ga0495653_0001373 3300046463 Bacteria 18921
251 Ga0495653_0032396 3300046463 Bacteria 4150
252 Ga0495582_0000690 3300046473 Bacteria 18604
253 Ga0495582_0050133 3300046473 Bacteria 2300
254 Ga0495582_0245896 3300046473 Unclassified 1025
255 Ga0495639_0010257 3300046475 Bacteria 4031
256 Ga0495662_0019773 3300046476 Bacteria 3257
257 Ga0495662_0154481 3300046476 Bacteria 1130
258 Ga0495585_0044147 3300046492 Bacteria 2491
259 Ga0495607_0032192 3300046501 Bacteria 3204
260 Ga0495608_0001253 3300046511 Bacteria 18066
261 Ga0495608_0021145 3300046511 Bacteria 4467
262 Ga0495608_0142885 3300046511 Bacteria 1527
263 Ga0495628_0000016 3300046516 Bacteria 170260
264 Ga0495628_0029067 3300046516 Bacteria 4486
265 Ga0495628_0240798 3300046516 Bacteria 1353
266 Ga0495630_0002069 3300046517 Bacteria 13948
267 Ga0495630_0058393 3300046517 Bacteria 2892
268 Ga0495630_0406436 3300046517 Bacteria 1043
269 Ga0495637_0101396 3300046520 Unclassified 1124
270 Ga0495644_0000819 3300046523 Bacteria 12808
271 Ga0495663_0011105 3300046525 Bacteria 2506
272 Ga0495642_0025625 3300046528 Bacteria 2338
273 Ga0495652_0009210 3300046529 Bacteria 8977
274 Ga0495652_0059207 3300046529 Bacteria 3241
275 Ga0495652_0311029 3300046529 Bacteria 1141
276 Ga0495665_0001668 3300046531 Bacteria 11913
277 Ga0495640_0082565 3300046533 Bacteria 2134
278 Ga0495640_0161068 3300046533 Bacteria 1438
279 Ga0495587_0001262 3300046536 Bacteria 16819
280 Ga0495587_0022485 3300046536 Bacteria 3882
281 Ga0495609_0098990 3300046538 Unclassified 1264
282 Ga0495645_0000068 3300046543 Bacteria 72552
283 Ga0495645_0056616 3300046543 Bacteria 2847
284 Ga0495645_0267719 3300046543 Unclassified 1128
285 Ga0495667_0008581 3300046559 Bacteria 6935
286 Ga0495667_0015746 3300046559 Bacteria 5113
287 Ga0495667_0215365 3300046559 Bacteria 1227
288 Ga0495656_0000621 3300046615 Bacteria 11326
289 Ga0495634_0007937 3300046642 Bacteria 7919
290 Ga0495611_0085428 3300046648 Bacteria 1455
291 Ga0495635_0147366 3300046663 Bacteria 1602
292 Ga0495635_0430198 3300046663 Bacteria 874
293 Ga0495659_0051090 3300046664 Unclassified 1505
294 Ga0495657_0015282 3300046675 Bacteria 5619
295 Ga0495657_0020293 3300046675 Bacteria 4780
296 Ga0495599_0000181 3300046678 Bacteria 41303
297 Ga0495599_0016488 3300046678 Bacteria 4587
298 Ga0495623_0000093 3300046679 Bacteria 53441
299 Ga0495623_0005203 3300046679 Bacteria 8535
300 Ga0495646_0007726 3300046680 Bacteria 6834
301 Ga0495646_0035449 3300046680 Bacteria 3095
302 Ga0495646_0076809 3300046680 Bacteria 1955
303 Ga0495646_0306897 3300046680 Unclassified 838
304 Ga0495647_0012879 3300046681 Bacteria 2887
305 Ga0495658_0000384 3300046683 Bacteria 24849
306 Ga0495658_0040142 3300046683 Bacteria 2601
307 Ga0495658_0056334 3300046683 Bacteria 2242
308 Ga0495658_0409068 3300046683 Unclassified 865
309 Ga0495613_0059353 3300046689 Bacteria 2805
310 Ga0495624_0051105 3300046690 Bacteria 2617
311 Ga0495624_0069284 3300046690 Bacteria 2197
312 Ga0495589_0021244 3300046794 Bacteria 3317
313 Ga0495600_0076104 3300046809 Bacteria 2191
314 Ga0495600_0103608 3300046809 Bacteria 1854
315 Ga0495600_0336499 3300046809 Bacteria 947
316 Ga0495604_0000111 3300047317 Bacteria 68576
317 Ga0495604_0319277 3300047317 Bacteria 1038
318 Ga0495636_0075808 3300047318 Unclassified 1442
319 Ga0495674_0001928 3300047319 Bacteria 20475
320 Ga0495674_0028846 3300047319 Bacteria 5056
321 Ga0495674_0211102 3300047319 Bacteria 1608
322 Ga0495674_0228447 3300047319 Bacteria 1536
323 Ga0495676_0005182 3300047321 Bacteria 11930
324 Ga0495676_0030179 3300047321 Bacteria 4607
325 Ga0495676_0315497 3300047321 Unclassified 1051
326 Ga0495680_0002350 3300047322 Bacteria 19403
327 Ga0495680_0006002 3300047322 Bacteria 11360
328 Ga0495680_0006719 3300047322 Bacteria 10637
329 Ga0495680_0023563 3300047322 Bacteria 5116
330 Ga0495680_0260186 3300047322 Bacteria 1227
331 Ga0495675_0000483 3300047444 Bacteria 25993
332 Ga0495675_0010791 3300047444 Bacteria 5725
333 Ga0495679_067001 3300047446 Unclassified 1041
334 Ga0495684_0024218 3300047471 Bacteria 4672
335 Ga0495684_0083341 3300047471 Bacteria 2425
336 Ga0495684_0362942 3300047471 Bacteria 1025
337 Ga0495593_0038323 3300047673 Bacteria 2589
338 Ga0495593_0190376 3300047673 Unclassified 1032
339 Ga0495602_0006649 3300048088 Bacteria 12122
340 Ga0495602_0035701 3300048088 Bacteria 4633
341 Ga0495602_0127890 3300048088 Bacteria 2032
342 Ga0496100_0007234 3300048903 Bacteria 6106
343 Ga0496100_0047246 3300048903 Bacteria 2772
344 Ga0496100_0343084 3300048903 Bacteria 1126
345 Ga0496101_0007462 3300048904 Bacteria 7088
346 Ga0496101_0015430 3300048904 Bacteria 5149
347 Ga0496101_0027701 3300048904 Bacteria 3950
348 Ga0496101_0036587 3300048904 Bacteria 3477
349 Ga0496102_0009303 3300048905 Bacteria 8436
350 Ga0496102_0134094 3300048905 Bacteria 2320
351 Ga0496102_0164196 3300048905 Bacteria 2089
352 Ga0496103_0003753 3300048906 Bacteria 9238
353 Ga0496103_0009596 3300048906 Bacteria 5730
354 Ga0496104_0038156 3300048907 Bacteria 4494
355 Ga0496104_0133784 3300048907 Bacteria 2382
356 Ga0496104_0189820 3300048907 Bacteria 1966
357 Ga0496105_0001696 3300048908 Bacteria 15709
358 Ga0496106_0001537 3300048909 Bacteria 17362
359 Ga0496106_0022310 3300048909 Bacteria 4702
360 Ga0496106_0038462 3300048909 Bacteria 3580
361 Ga0496107_0046869 3300048910 Bacteria 3111
362 Ga0496107_0272058 3300048910 Bacteria 1261
363 Ga0496108_0031559 3300048911 Bacteria 4396
364 Ga0496108_0042083 3300048911 Bacteria 3813
365 Ga0496108_0586507 3300048911 Bacteria 972
366 Ga0496109_0015796 3300048912 Bacteria 6590
367 Ga0496109_0031726 3300048912 Bacteria 4744
368 Ga0496109_0053585 3300048912 Bacteria 3679
369 Ga0496110_0234829 3300048913 Bacteria 1668
370 Ga0496111_0117140 3300048914 Bacteria 1965
371 Ga0496111_0171157 3300048914 Unclassified 1614
372 Ga0496111_0209070 3300048914 Bacteria 1450
373 Ga0496112_0037554 3300048915 Bacteria 4727
374 Ga0496112_0086719 3300048915 Bacteria 3097
375 Ga0496112_0202232 3300048915 Bacteria 1945
376 Ga0496112_0254415 3300048915 Bacteria 1707
377 Ga0496112_0326474 3300048915 Bacteria 1478
378 Ga0496112_0752068 3300048915 Bacteria 901
379 Ga0496112_0825498 3300048915 Unclassified 851
380 Ga0496113_0033569 3300048916 Bacteria 3738
381 Ga0496113_0091520 3300048916 Bacteria 2345
382 Ga0496114_0029976 3300048917 Bacteria 4474
383 Ga0496114_0043541 3300048917 Bacteria 3722
384 Ga0496115_0001529 3300048918 Bacteria 16618
385 Ga0496115_0099468 3300048918 Bacteria 2383
386 Ga0496115_0106957 3300048918 Bacteria 2297
387 Ga0501067_0002005 3300049583 Bacteria 11218
388 Ga0501067_0062689 3300049583 Bacteria 2058
389 Ga0501067_0106297 3300049583 Bacteria 1560
390 Ga0501069_0018849 3300049585 Bacteria 3725
391 Ga0501069_0019552 3300049585 Bacteria 3664
392 Ga0501070_0016223 3300049586 Bacteria 6259
393 Ga0501070_0172433 3300049586 Bacteria 1782
394 Ga0501070_0295974 3300049586 Bacteria 1319
395 Ga0501080_0172055 3300049742 Bacteria 1997
396 Ga0501080_0539967 3300049742 Bacteria 1039
397 nmdc:mga05p37_17936_c1 3300050507 Bacteria 8545
398 nmdc:mga05p37_348810_c1 3300050507 Unclassified 1743
399 nmdc:mga08y16_196784_c1 3300050511 Bacteria 2089
400 nmdc:mga0n895_18728_c1 3300050512 Bacteria 6415
401 nmdc:mga0n895_204059_c1 3300050512 Bacteria 2007
402 nmdc:mga0n895_2410_c1 3300050512 Bacteria 14579
403 nmdc:mga0a205_156225_c1 3300050515 Unclassified 2179
404 nmdc:mga0a205_34448_c1 3300050515 Bacteria 4857
405 Ga0495601_0014421 3300053077 Bacteria 4762
406 Ga0495612_0023688 3300053078 Bacteria 2464
407 Ga0495612_0178781 3300053078 Unclassified 931
408 Ga0495595_0009456 3300053084 Bacteria 4033
409 Ga0495595_0016940 3300053084 Bacteria 3126
410 Ga0495619_0002542 3300053085 Bacteria 11945
411 Ga0495619_0011871 3300053085 Bacteria 5486
412 Ga0495619_0023233 3300053085 Bacteria 3973
413 Ga0495619_0028130 3300053085 Bacteria 3624
414 Ga0495619_0181258 3300053085 Unclassified 1457
415 Ga0466962_0000222 3300061719 Bacteria 23567
416 Ga0466962_0003190 3300061719 Bacteria 7789
417 Ga0466962_0010321 3300061719 Bacteria 4486
418 Ga0466962_0066947 3300061719 Bacteria 1715
419 Ga0530510_0060541 3300061734 Bacteria 2740
420 Ga0070658_10184329
421 Ga0070658_10049856
422 Ga0070658_10063015
423 Ga0070658_10092941
424 Ga0070658_10380687
425 Ga0070680_100083888
426 Ga0070680_100132757
427 Ga0070660_100038053
428 Ga0070660_100039694
429 Ga0070660_100065329
430 Ga0070661_100017268
431 Ga0070661_100089403
432 Ga0070661_100440390
433 Ga0070671_100049208
434 Ga0070659_100022717
435 Ga0070659_100144258
436 Ga0070714_100065942
437 Ga0070714_100093219
438 Ga0070681_10001211
439 Ga0070681_10015354
440 Ga0070681_10061551
441 Ga0070681_10121486
442 Ga0070706_100632196
443 Ga0070679_100018501
444 Ga0070679_100040086
445 Ga0070679_100236057
446 Ga0070684_100198381
447 Ga0068853_100295659
448 Ga0070665_100044026
449 Ga0070665_100315952
450 Ga0068855_100018717
451 Ga0068855_100036020
452 Ga0068855_100298359
453 Ga0068855_100828323
454 Ga0068855_100865820
455 Ga0068857_100486617
456 Ga0068856_100045809
457 Ga0068852_100029305
458 Ga0068863_100224090
459 Ga0070717_10003139
460 Ga0070717_10284342
461 Ga0070712_100135205
462 Ga0070712_100252909
463 Ga0075428_100425957
464 Ga0075434_100014043
465 Ga0075435_100044712
466 Ga0075435_100331333
467 Ga0105240_10032416
468 Ga0105245_10300589
469 Ga0105245_10372180
470 Ga0114129_10279860
471 Ga0114129_10829511
472 Ga0105241_10626745
473 Ga0105242_10044962
474 Ga0105248_10427973
475 Ga0105237_10093011
476 Ga0105237_10170647
477 Ga0105238_10079734
478 Ga0105238_10099238
479 Ga0105239_10317922
480 Ga0157373_10038949
481 Ga0157373_10103085
482 Ga0157370_10014193
483 Ga0157370_10018591
484 Ga0157370_10032453
485 Ga0157370_10060745
486 Ga0157369_10002320
487 Ga0157369_10010474
488 Ga0157369_10018305
489 Ga0157369_10023530
490 Ga0157369_10082174
491 Ga0157369_10135938
492 Ga0157369_10144342
493 Ga0157369_10147025
494 Ga0157369_10258223
495 Ga0157374_10230619
496 Ga0157374_10378851
497 Ga0157378_10089095
498 Ga0163162_10456616
499 Ga0157372_10179201
500 Ga0157372_10179845
501 Ga0157372_10276154
502 Ga0157372_10889827
503 Ga0157375_10021615
504 Ga0182008_10040740
505 Ga0182008_10095926
506 Ga0197907_10207184
507 Ga0206356_10442128
508 Ga0206356_11047083
509 Ga0206356_11331715
510 Ga0206354_10026336
511 Ga0206354_10436935
512 Ga0206353_10590627
513 Ga0206353_10655724
514 Ga0206353_10852712
515 Ga0206353_11615899
516 Ga0213876_10021365
517 Ga0213871_10001003
518 Ga0224712_10045749
519 Ga0207705_10055349
520 Ga0207705_10078336
521 Ga0207705_10084070
522 Ga0207707_10018763
523 Ga0207707_10072086
524 Ga0207695_10621959
525 Ga0207693_10035132
526 Ga0207693_10071833
527 Ga0207693_10235226
528 Ga0207693_10271495
529 Ga0207663_10075074
530 Ga0207663_10084296
531 Ga0207663_10258511
532 Ga0207660_10012959
533 Ga0207660_10110267
534 Ga0207660_10161351
535 Ga0207660_10207724
536 Ga0207657_10002072
537 Ga0207657_10003977
538 Ga0207657_10031481
539 Ga0207657_10149644
540 Ga0207652_10105849
541 Ga0207646_10352408
542 Ga0207687_10295089
543 Ga0207700_10161463
544 Ga0207664_10015905
545 Ga0207664_10043349
546 Ga0207644_10055770
547 Ga0207690_10037247
548 Ga0207690_10155421
549 Ga0207690_10161118
550 Ga0207661_10382916
551 Ga0207667_10023514
552 Ga0207667_10196180
553 Ga0207667_10249128
554 Ga0207639_10314095
555 Ga0207702_10139309
556 Ga0207641_10070184
557 Ga0207674_10096898
558 Ga0207674_10422551
559 Ga0207683_10011896
560 Ga0207698_10027805
561 Ga0207698_10079086
562 Ga0207428_10148396
563 Ga0268266_10100255
564 Ga0265323_10055124
565 Ga0265338_10025049
566 Ga0265325_10005193
567 Ga0265329_10007817
568 Ga0265340_10076623
569 Ga0265327_10087784
570 Ga0265316_10055356
571 Ga0265313_10004697
572 Ga0265313_10097618
573 Ga0265314_10003413
574 Ga0307409_100180114
575 Ga0373926_0010296
576 Ga0373944_0009152
577 Ga0373923_0067204
578 Ga0373936_0015264
579 Ga0373945_0002944
580 Ga0373953_0033039
581 Ga0373957_0030496
582 Ga0373943_0000693
583 Ga0373946_0023556
584 Ga0373935_0038588
585 Ga0373927_0037737
586 Ga0373927_0192809
587 Ga0373933_0040662
588 Ga0373947_0008896
589 Ga0373937_0072894
590 Ga0373925_0007920
591 Ga0373925_0039554
592 Ga0373925_0148160
593 Ga0395899_0038597
594 Ga0395899_0093527
595 Ga0395899_0134915
596 Ga0395900_0111129
597 Ga0395900_0125279
598 Ga0395900_0284611
599 Ga0395900_0372791
600 Ga0395900_0550514
601 Ga0395898_0016583
602 Ga0395898_0023488
603 Ga0395898_0250681
604 Ga0395898_0299789
605 Ga0395905_0132115
606 Ga0395905_0177075
607 Ga0395905_0412828
608 Ga0395901_0236918
609 Ga0395901_0385921
610 Ga0395901_0628837
611 Ga0395901_0653288
612 Ga0436365_1245864
613 Ga0436365_1344480
614 Ga0436360_1170606
615 Ga0436363_0621978
616 Ga0436363_0651653
617 Ga0466965_0030561
618 Ga0466965_0077573
619 Ga0466966_0034948
620 Ga0466966_0203310
621 Ga0466961_0011744
622 Ga0466961_0019293
623 Ga0466961_0025016
624 Ga0466961_0078872
625 Ga0466963_0008566
626 Ga0466963_0012785
627 Ga0466963_0030385
628 Ga0466963_0036405
629 Ga0466963_0038255
630 Ga0466963_0091018
631 Ga0466963_0112362
632 Ga0466963_0146580
633 Ga0466963_0302412
634 Ga0466963_0354774
635 Ga0466964_0021680
636 Ga0466964_0051696
637 Ga0466964_0225896
638 Ga0466971_0000609
639 Ga0466971_0007738
640 Ga0466971_0007951
641 Ga0466957_0003191
642 Ga0466957_0018713
643 Ga0466957_0057842
644 Ga0466960_0223126
645 Ga0466959_0177502
646 Ga0466959_0307797
647 Ga0466958_0005117
648 Ga0466958_0076765
649 Ga0466958_0136874
650 Ga0466958_0212991
651 Ga0466967_0000080
652 Ga0466967_0004471
653 Ga0466967_0004614
654 Ga0466967_0110402
655 Ga0466967_0142900
656 Ga0466967_0160034
657 Ga0466967_0166727
658 Ga0466967_0235869
659 Ga0466967_0269608
660 Ga0466967_0342782
661 Ga0466967_0345004
662 Ga0495592_0001569
663 Ga0495592_0116303
664 Ga0495629_0000319
665 Ga0495641_0035560
666 Ga0495651_0000008
667 Ga0495651_0021468
668 Ga0495651_0031603
669 Ga0495653_0001373
670 Ga0495653_0032396
671 Ga0495582_0000690
672 Ga0495582_0050133
673 Ga0495582_0245896
674 Ga0495639_0010257
675 Ga0495662_0019773
676 Ga0495662_0154481
677 Ga0495585_0044147
678 Ga0495607_0032192
679 Ga0495608_0001253
680 Ga0495608_0021145
681 Ga0495608_0142885
682 Ga0495628_0000016
683 Ga0495628_0029067
684 Ga0495628_0240798
685 Ga0495630_0002069
686 Ga0495630_0058393
687 Ga0495630_0406436
688 Ga0495637_0101396
689 Ga0495644_0000819
690 Ga0495663_0011105
691 Ga0495642_0025625
692 Ga0495652_0009210
693 Ga0495652_0059207
694 Ga0495652_0311029
695 Ga0495665_0001668
696 Ga0495640_0082565
697 Ga0495640_0161068
698 Ga0495587_0001262
699 Ga0495587_0022485
700 Ga0495609_0098990
701 Ga0495645_0000068
702 Ga0495645_0056616
703 Ga0495645_0267719
704 Ga0495667_0008581
705 Ga0495667_0015746
706 Ga0495667_0215365
707 Ga0495656_0000621
708 Ga0495634_0007937
709 Ga0495611_0085428
710 Ga0495635_0147366
711 Ga0495635_0430198
712 Ga0495659_0051090
713 Ga0495657_0015282
714 Ga0495657_0020293
715 Ga0495599_0000181
716 Ga0495599_0016488
717 Ga0495623_0000093
718 Ga0495623_0005203
719 Ga0495646_0007726
720 Ga0495646_0035449
721 Ga0495646_0076809
722 Ga0495646_0306897
723 Ga0495647_0012879
724 Ga0495658_0000384
725 Ga0495658_0040142
726 Ga0495658_0056334
727 Ga0495658_0409068
728 Ga0495613_0059353
729 Ga0495624_0051105
730 Ga0495624_0069284
731 Ga0495589_0021244
732 Ga0495600_0076104
733 Ga0495600_0103608
734 Ga0495600_0336499
735 Ga0495604_0000111
736 Ga0495604_0319277
737 Ga0495636_0075808
738 Ga0495674_0001928
739 Ga0495674_0028846
740 Ga0495674_0211102
741 Ga0495674_0228447
742 Ga0495676_0005182
743 Ga0495676_0030179
744 Ga0495676_0315497
745 Ga0495680_0002350
746 Ga0495680_0006002
747 Ga0495680_0006719
748 Ga0495680_0023563
749 Ga0495680_0260186
750 Ga0495675_0000483
751 Ga0495675_0010791
752 Ga0495679_067001
753 Ga0495684_0024218
754 Ga0495684_0083341
755 Ga0495684_0362942
756 Ga0495593_0038323
757 Ga0495593_0190376
758 Ga0495602_0006649
759 Ga0495602_0035701
760 Ga0495602_0127890
761 Ga0496100_0007234
762 Ga0496100_0047246
763 Ga0496100_0343084
764 Ga0496101_0007462
765 Ga0496101_0015430
766 Ga0496101_0027701
767 Ga0496101_0036587
768 Ga0496102_0009303
769 Ga0496102_0134094
770 Ga0496102_0164196
771 Ga0496103_0003753
772 Ga0496103_0009596
773 Ga0496104_0038156
774 Ga0496104_0133784
775 Ga0496104_0189820
776 Ga0496105_0001696
777 Ga0496106_0001537
778 Ga0496106_0022310
779 Ga0496106_0038462
780 Ga0496107_0046869
781 Ga0496107_0272058
782 Ga0496108_0031559
783 Ga0496108_0042083
784 Ga0496108_0586507
785 Ga0496109_0015796
786 Ga0496109_0031726
787 Ga0496109_0053585
788 Ga0496110_0234829
789 Ga0496111_0117140
790 Ga0496111_0171157
791 Ga0496111_0209070
792 Ga0496112_0037554
793 Ga0496112_0086719
794 Ga0496112_0202232
795 Ga0496112_0254415
796 Ga0496112_0326474
797 Ga0496112_0752068
798 Ga0496112_0825498
799 Ga0496113_0033569
800 Ga0496113_0091520
801 Ga0496114_0029976
802 Ga0496114_0043541
803 Ga0496115_0001529
804 Ga0496115_0099468
805 Ga0496115_0106957
806 Ga0501067_0002005
807 Ga0501067_0062689
808 Ga0501067_0106297
809 Ga0501069_0018849
810 Ga0501069_0019552
811 Ga0501070_0016223
812 Ga0501070_0172433
813 Ga0501070_0295974
814 Ga0501080_0172055
815 Ga0501080_0539967
816 nmdc:mga05p37_17936_c1
817 nmdc:mga05p37_348810_c1
818 nmdc:mga08y16_196784_c1
819 nmdc:mga0n895_18728_c1
820 nmdc:mga0n895_204059_c1
821 nmdc:mga0n895_2410_c1
822 nmdc:mga0a205_156225_c1
823 nmdc:mga0a205_34448_c1
824 Ga0495601_0014421
825 Ga0495612_0023688
826 Ga0495612_0178781
827 Ga0495595_0009456
828 Ga0495595_0016940
829 Ga0495619_0002542
830 Ga0495619_0011871
831 Ga0495619_0023233
832 Ga0495619_0028130
833 Ga0495619_0181258
834 Ga0466962_0000222
835 Ga0466962_0003190
836 Ga0466962_0010321
837 Ga0466962_0066947
838 Ga0530510_0060541

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13537

GATase_7

Glutamine amidotransferase domain

68

172

0.89

PF13522

GATase_6

Glutamine amidotransferase domain

57

176

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ooj-assembly1.cif.gz_F c1a mutant of e. coli glms in complex with glucose-6p and glutamate 0.8158 3 224
1xfg-assembly1.cif.gz_A glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate 0.8114 2 224
1ao0-assembly1.cif.gz_C glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp 0.7943 2 229
1jxa-assembly2.cif.gz_C glucosamine 6-phosphate synthase with glucose 6-phosphate 0.7768 2 224
7ndl-assembly1.cif.gz_B crystal structure of human gfat-1 s205d 0.7746 2 231
ID Description Score Start End Superfamily
af_A4HSY7_2_295_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7921 2 229 3.60.20.10
af_Q58516_3_191_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7921 4 199 3.60.20.10
af_Q54LK1_43_282_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7851 2 230 3.60.20.10
af_Q7KTW9_18_204_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7741 73 229 3.60.20.10
af_P17169_2_241_3.60.20.10 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.7696 2 236 3.60.20.10
ID Description Score Start End GO Terms
AF-A0A538FCJ1-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9562 94 234
AF-A0A7W1N6S5-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.952 1 226
AF-A0A7W1N6S5-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9438 1 226
AF-A0A538HRB9-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9431 2 262
AF-A0A538FCJ1-F1-model_v4 Glutamine amidotransferase type-2 domain-containing protein 0.9431 94 234

Map