F439452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 419 | 195 | 838 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300005327|Ga0070658_10184329|Ga0070658_101843292 |
| Length | 243 |
| Sequence | MCGIAGYSVRTGSSLDRTLAAQALLAAIAERGADAVGYAYRRPEDAYATVVKQRTPASKLLERVAVPDEASQLLVHVRDYTKGHPSINANNHPVRHGPVVGIHNGIITNDDELLAPHSCARAEAKMTVDSEAIFALAAHSRNDPRALEHLRGALATGWLDEREPGVVFSTKLALDTVEQFCALKLRKREVKPGSWFAIAGGEVVRRERFRPDLEYVEPDPLPAVRAPGERDFCMTRLAAIAAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 13 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 15 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 16 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 17 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 18 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 19 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 22 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 23 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 24 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 32 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 34 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 37 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 42 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 43 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 44 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 45 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 46 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 47 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 48 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 72 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 74 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 76 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 77 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 78 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 79 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 80 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 81 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 83 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 84 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 85 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 86 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 87 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 88 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 89 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 90 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 91 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 92 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 93 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 94 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 95 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 105 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 106 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 107 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 108 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 109 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 110 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 111 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 112 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 113 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 114 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 115 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 116 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 117 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 168 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 169 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 172 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 195 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.37 |
| Metatranscriptomes | 2.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 10.74 |
| Rhizosphere | 88.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10184329 | 3300005327 | Bacteria | 1757 |
| 2 | Ga0070658_10049856 | 3300005327 | Bacteria | 3392 |
| 3 | Ga0070658_10063015 | 3300005327 | Bacteria | 3022 |
| 4 | Ga0070658_10092941 | 3300005327 | Bacteria | 2488 |
| 5 | Ga0070658_10380687 | 3300005327 | Unclassified | 1210 |
| 6 | Ga0070680_100083888 | 3300005336 | Bacteria | 2631 |
| 7 | Ga0070680_100132757 | 3300005336 | Bacteria | 2084 |
| 8 | Ga0070660_100038053 | 3300005339 | Bacteria | 3650 |
| 9 | Ga0070660_100039694 | 3300005339 | Bacteria | 3578 |
| 10 | Ga0070660_100065329 | 3300005339 | Bacteria | 2831 |
| 11 | Ga0070661_100017268 | 3300005344 | Bacteria | 5117 |
| 12 | Ga0070661_100089403 | 3300005344 | Bacteria | 2280 |
| 13 | Ga0070661_100440390 | 3300005344 | Bacteria | 1035 |
| 14 | Ga0070671_100049208 | 3300005355 | Bacteria | 3507 |
| 15 | Ga0070659_100022717 | 3300005366 | Bacteria | 4791 |
| 16 | Ga0070659_100144258 | 3300005366 | Bacteria | 1939 |
| 17 | Ga0070714_100065942 | 3300005435 | Bacteria | 3119 |
| 18 | Ga0070714_100093219 | 3300005435 | Bacteria | 2641 |
| 19 | Ga0070681_10001211 | 3300005458 | Bacteria | 22450 |
| 20 | Ga0070681_10015354 | 3300005458 | Bacteria | 7618 |
| 21 | Ga0070681_10061551 | 3300005458 | Bacteria | 3727 |
| 22 | Ga0070681_10121486 | 3300005458 | Bacteria | 2547 |
| 23 | Ga0070706_100632196 | 3300005467 | Unclassified | 994 |
| 24 | Ga0070679_100018501 | 3300005530 | Bacteria | 6762 |
| 25 | Ga0070679_100040086 | 3300005530 | Bacteria | 4659 |
| 26 | Ga0070679_100236057 | 3300005530 | Bacteria | 1787 |
| 27 | Ga0070684_100198381 | 3300005535 | Bacteria | 1828 |
| 28 | Ga0068853_100295659 | 3300005539 | Bacteria | 1495 |
| 29 | Ga0070665_100044026 | 3300005548 | Bacteria | 4483 |
| 30 | Ga0070665_100315952 | 3300005548 | Bacteria | 1566 |
| 31 | Ga0068855_100018717 | 3300005563 | Bacteria | 8327 |
| 32 | Ga0068855_100036020 | 3300005563 | Bacteria | 5891 |
| 33 | Ga0068855_100298359 | 3300005563 | Bacteria | 1785 |
| 34 | Ga0068855_100828323 | 3300005563 | Unclassified | 982 |
| 35 | Ga0068855_100865820 | 3300005563 | Bacteria | 956 |
| 36 | Ga0068857_100486617 | 3300005577 | Bacteria | 1157 |
| 37 | Ga0068856_100045809 | 3300005614 | Bacteria | 4307 |
| 38 | Ga0068852_100029305 | 3300005616 | Bacteria | 4520 |
| 39 | Ga0068863_100224090 | 3300005841 | Unclassified | 1812 |
| 40 | Ga0070717_10003139 | 3300006028 | Bacteria | 11806 |
| 41 | Ga0070717_10284342 | 3300006028 | Bacteria | 1468 |
| 42 | Ga0070712_100135205 | 3300006175 | Bacteria | 1874 |
| 43 | Ga0070712_100252909 | 3300006175 | Bacteria | 1409 |
| 44 | Ga0075428_100425957 | 3300006844 | Bacteria | 1422 |
| 45 | Ga0075434_100014043 | 3300006871 | Bacteria | 7646 |
| 46 | Ga0075435_100044712 | 3300007076 | Bacteria | 3548 |
| 47 | Ga0075435_100331333 | 3300007076 | Bacteria | 1304 |
| 48 | Ga0105240_10032416 | 3300009093 | Bacteria | 6764 |
| 49 | Ga0105245_10300589 | 3300009098 | Bacteria | 1575 |
| 50 | Ga0105245_10372180 | 3300009098 | Bacteria | 1421 |
| 51 | Ga0114129_10279860 | 3300009147 | Bacteria | 2229 |
| 52 | Ga0114129_10829511 | 3300009147 | Bacteria | 1177 |
| 53 | Ga0105241_10626745 | 3300009174 | Bacteria | 974 |
| 54 | Ga0105242_10044962 | 3300009176 | Bacteria | 3577 |
| 55 | Ga0105248_10427973 | 3300009177 | Bacteria | 1491 |
| 56 | Ga0105237_10093011 | 3300009545 | Bacteria | 3005 |
| 57 | Ga0105237_10170647 | 3300009545 | Bacteria | 2175 |
| 58 | Ga0105238_10079734 | 3300009551 | Bacteria | 3264 |
| 59 | Ga0105238_10099238 | 3300009551 | Bacteria | 2895 |
| 60 | Ga0105239_10317922 | 3300010375 | Bacteria | 1755 |
| 61 | Ga0157373_10038949 | 3300013100 | Bacteria | 3404 |
| 62 | Ga0157373_10103085 | 3300013100 | Bacteria | 2007 |
| 63 | Ga0157370_10014193 | 3300013104 | Bacteria | 8164 |
| 64 | Ga0157370_10018591 | 3300013104 | Bacteria | 6987 |
| 65 | Ga0157370_10032453 | 3300013104 | Bacteria | 5100 |
| 66 | Ga0157370_10060745 | 3300013104 | Bacteria | 3587 |
| 67 | Ga0157369_10002320 | 3300013105 | Bacteria | 22898 |
| 68 | Ga0157369_10010474 | 3300013105 | Bacteria | 10561 |
| 69 | Ga0157369_10018305 | 3300013105 | Bacteria | 7856 |
| 70 | Ga0157369_10023530 | 3300013105 | Bacteria | 6861 |
| 71 | Ga0157369_10082174 | 3300013105 | Bacteria | 3447 |
| 72 | Ga0157369_10135938 | 3300013105 | Bacteria | 2603 |
| 73 | Ga0157369_10144342 | 3300013105 | Bacteria | 2517 |
| 74 | Ga0157369_10147025 | 3300013105 | Bacteria | 2492 |
| 75 | Ga0157369_10258223 | 3300013105 | Bacteria | 1817 |
| 76 | Ga0157374_10230619 | 3300013296 | Bacteria | 1819 |
| 77 | Ga0157374_10378851 | 3300013296 | Bacteria | 1409 |
| 78 | Ga0157378_10089095 | 3300013297 | Bacteria | 2801 |
| 79 | Ga0163162_10456616 | 3300013306 | Unclassified | 1409 |
| 80 | Ga0157372_10179201 | 3300013307 | Bacteria | 2453 |
| 81 | Ga0157372_10179845 | 3300013307 | Bacteria | 2448 |
| 82 | Ga0157372_10276154 | 3300013307 | Bacteria | 1953 |
| 83 | Ga0157372_10889827 | 3300013307 | Bacteria | 1033 |
| 84 | Ga0157375_10021615 | 3300013308 | Bacteria | 5905 |
| 85 | Ga0182008_10040740 | 3300014497 | Bacteria | 2318 |
| 86 | Ga0182008_10095926 | 3300014497 | Bacteria | 1464 |
| 87 | Ga0197907_10207184 | 3300020069 | Bacteria | 1932 |
| 88 | Ga0206356_10442128 | 3300020070 | Unclassified | 1456 |
| 89 | Ga0206356_11047083 | 3300020070 | Bacteria | 1804 |
| 90 | Ga0206356_11331715 | 3300020070 | Bacteria | 1488 |
| 91 | Ga0206354_10026336 | 3300020081 | Bacteria | 2824 |
| 92 | Ga0206354_10436935 | 3300020081 | Bacteria | 1514 |
| 93 | Ga0206353_10590627 | 3300020082 | Bacteria | 3736 |
| 94 | Ga0206353_10655724 | 3300020082 | Bacteria | 10912 |
| 95 | Ga0206353_10852712 | 3300020082 | Bacteria | 1092 |
| 96 | Ga0206353_11615899 | 3300020082 | Bacteria | 4176 |
| 97 | Ga0213876_10021365 | 3300021384 | Bacteria | 3424 |
| 98 | Ga0213871_10001003 | 3300021441 | Bacteria | 4414 |
| 99 | Ga0224712_10045749 | 3300022467 | Bacteria | 1676 |
| 100 | Ga0207705_10055349 | 3300025909 | Bacteria | 2860 |
| 101 | Ga0207705_10078336 | 3300025909 | Bacteria | 2405 |
| 102 | Ga0207705_10084070 | 3300025909 | Bacteria | 2323 |
| 103 | Ga0207707_10018763 | 3300025912 | Bacteria | 6031 |
| 104 | Ga0207707_10072086 | 3300025912 | Bacteria | 3011 |
| 105 | Ga0207695_10621959 | 3300025913 | Unclassified | 961 |
| 106 | Ga0207693_10035132 | 3300025915 | Bacteria | 3952 |
| 107 | Ga0207693_10071833 | 3300025915 | Bacteria | 2709 |
| 108 | Ga0207693_10235226 | 3300025915 | Bacteria | 1439 |
| 109 | Ga0207693_10271495 | 3300025915 | Bacteria | 1329 |
| 110 | Ga0207663_10075074 | 3300025916 | Bacteria | 2193 |
| 111 | Ga0207663_10084296 | 3300025916 | Bacteria | 2090 |
| 112 | Ga0207663_10258511 | 3300025916 | Bacteria | 1285 |
| 113 | Ga0207660_10012959 | 3300025917 | Bacteria | 5462 |
| 114 | Ga0207660_10110267 | 3300025917 | Bacteria | 2070 |
| 115 | Ga0207660_10161351 | 3300025917 | Bacteria | 1730 |
| 116 | Ga0207660_10207724 | 3300025917 | Unclassified | 1532 |
| 117 | Ga0207657_10002072 | 3300025919 | Bacteria | 21689 |
| 118 | Ga0207657_10003977 | 3300025919 | Bacteria | 15705 |
| 119 | Ga0207657_10031481 | 3300025919 | Bacteria | 4804 |
| 120 | Ga0207657_10149644 | 3300025919 | Bacteria | 1902 |
| 121 | Ga0207652_10105849 | 3300025921 | Bacteria | 2489 |
| 122 | Ga0207646_10352408 | 3300025922 | Bacteria | 1330 |
| 123 | Ga0207687_10295089 | 3300025927 | Unclassified | 1304 |
| 124 | Ga0207700_10161463 | 3300025928 | Bacteria | 1861 |
| 125 | Ga0207664_10015905 | 3300025929 | Bacteria | 5479 |
| 126 | Ga0207664_10043349 | 3300025929 | Bacteria | 3518 |
| 127 | Ga0207644_10055770 | 3300025931 | Bacteria | 2849 |
| 128 | Ga0207690_10037247 | 3300025932 | Bacteria | 3157 |
| 129 | Ga0207690_10155421 | 3300025932 | Bacteria | 1700 |
| 130 | Ga0207690_10161118 | 3300025932 | Bacteria | 1672 |
| 131 | Ga0207661_10382916 | 3300025944 | Bacteria | 1273 |
| 132 | Ga0207667_10023514 | 3300025949 | Bacteria | 6785 |
| 133 | Ga0207667_10196180 | 3300025949 | Bacteria | 2071 |
| 134 | Ga0207667_10249128 | 3300025949 | Bacteria | 1817 |
| 135 | Ga0207639_10314095 | 3300026041 | Bacteria | 1389 |
| 136 | Ga0207702_10139309 | 3300026078 | Bacteria | 2193 |
| 137 | Ga0207641_10070184 | 3300026088 | Bacteria | 3010 |
| 138 | Ga0207674_10096898 | 3300026116 | Bacteria | 2934 |
| 139 | Ga0207674_10422551 | 3300026116 | Bacteria | 1288 |
| 140 | Ga0207683_10011896 | 3300026121 | Bacteria | 7426 |
| 141 | Ga0207698_10027805 | 3300026142 | Bacteria | 4021 |
| 142 | Ga0207698_10079086 | 3300026142 | Bacteria | 2643 |
| 143 | Ga0207428_10148396 | 3300027907 | Unclassified | 1786 |
| 144 | Ga0268266_10100255 | 3300028379 | Bacteria | 2551 |
| 145 | Ga0265323_10055124 | 3300028653 | Bacteria | 1399 |
| 146 | Ga0265338_10025049 | 3300028800 | Bacteria | 6074 |
| 147 | Ga0265325_10005193 | 3300031241 | Bacteria | 8090 |
| 148 | Ga0265329_10007817 | 3300031242 | Bacteria | 4102 |
| 149 | Ga0265340_10076623 | 3300031247 | Bacteria | 1579 |
| 150 | Ga0265327_10087784 | 3300031251 | Bacteria | 1522 |
| 151 | Ga0265316_10055356 | 3300031344 | Bacteria | 3102 |
| 152 | Ga0265313_10004697 | 3300031595 | Bacteria | 10314 |
| 153 | Ga0265313_10097618 | 3300031595 | Bacteria | 1309 |
| 154 | Ga0265314_10003413 | 3300031711 | Bacteria | 15378 |
| 155 | Ga0307409_100180114 | 3300031995 | Bacteria | 1870 |
| 156 | Ga0373926_0010296 | 3300035083 | Bacteria | 3133 |
| 157 | Ga0373944_0009152 | 3300035089 | Bacteria | 2682 |
| 158 | Ga0373923_0067204 | 3300035111 | Bacteria | 1533 |
| 159 | Ga0373936_0015264 | 3300035113 | Bacteria | 2942 |
| 160 | Ga0373945_0002944 | 3300035116 | Bacteria | 5349 |
| 161 | Ga0373953_0033039 | 3300035117 | Unclassified | 2022 |
| 162 | Ga0373957_0030496 | 3300035120 | Bacteria | 1976 |
| 163 | Ga0373943_0000693 | 3300035170 | Bacteria | 14694 |
| 164 | Ga0373946_0023556 | 3300035171 | Bacteria | 2407 |
| 165 | Ga0373935_0038588 | 3300035692 | Bacteria | 2991 |
| 166 | Ga0373927_0037737 | 3300035695 | Bacteria | 3139 |
| 167 | Ga0373927_0192809 | 3300035695 | Unclassified | 1337 |
| 168 | Ga0373933_0040662 | 3300035724 | Bacteria | 2741 |
| 169 | Ga0373947_0008896 | 3300035725 | Bacteria | 5774 |
| 170 | Ga0373937_0072894 | 3300036401 | Bacteria | 3167 |
| 171 | Ga0373925_0007920 | 3300037068 | Bacteria | 7737 |
| 172 | Ga0373925_0039554 | 3300037068 | Bacteria | 3488 |
| 173 | Ga0373925_0148160 | 3300037068 | Bacteria | 1841 |
| 174 | Ga0395899_0038597 | 3300037312 | Bacteria | 3577 |
| 175 | Ga0395899_0093527 | 3300037312 | Bacteria | 2176 |
| 176 | Ga0395899_0134915 | 3300037312 | Bacteria | 1760 |
| 177 | Ga0395900_0111129 | 3300037418 | Bacteria | 2815 |
| 178 | Ga0395900_0125279 | 3300037418 | Bacteria | 2635 |
| 179 | Ga0395900_0284611 | 3300037418 | Bacteria | 1644 |
| 180 | Ga0395900_0372791 | 3300037418 | Unclassified | 1397 |
| 181 | Ga0395900_0550514 | 3300037418 | Bacteria | 1098 |
| 182 | Ga0395898_0016583 | 3300037466 | Bacteria | 7531 |
| 183 | Ga0395898_0023488 | 3300037466 | Bacteria | 6229 |
| 184 | Ga0395898_0250681 | 3300037466 | Unclassified | 1688 |
| 185 | Ga0395898_0299789 | 3300037466 | Bacteria | 1533 |
| 186 | Ga0395905_0132115 | 3300037471 | Bacteria | 2348 |
| 187 | Ga0395905_0177075 | 3300037471 | Unclassified | 2002 |
| 188 | Ga0395905_0412828 | 3300037471 | Bacteria | 1245 |
| 189 | Ga0395901_0236918 | 3300038443 | Unclassified | 1904 |
| 190 | Ga0395901_0385921 | 3300038443 | Bacteria | 1441 |
| 191 | Ga0395901_0628837 | 3300038443 | Unclassified | 1079 |
| 192 | Ga0395901_0653288 | 3300038443 | Bacteria | 1055 |
| 193 | Ga0436365_1245864 | 3300039437 | Bacteria | 1431 |
| 194 | Ga0436365_1344480 | 3300039437 | Bacteria | 3100 |
| 195 | Ga0436360_1170606 | 3300039438 | Bacteria | 14832 |
| 196 | Ga0436363_0621978 | 3300039450 | Bacteria | 1989 |
| 197 | Ga0436363_0651653 | 3300039450 | Bacteria | 1127 |
| 198 | Ga0466965_0030561 | 3300044683 | Bacteria | 2625 |
| 199 | Ga0466965_0077573 | 3300044683 | Bacteria | 1678 |
| 200 | Ga0466966_0034948 | 3300044684 | Bacteria | 3249 |
| 201 | Ga0466966_0203310 | 3300044684 | Bacteria | 1198 |
| 202 | Ga0466961_0011744 | 3300044693 | Bacteria | 5596 |
| 203 | Ga0466961_0019293 | 3300044693 | Bacteria | 4387 |
| 204 | Ga0466961_0025016 | 3300044693 | Bacteria | 3842 |
| 205 | Ga0466961_0078872 | 3300044693 | Bacteria | 2086 |
| 206 | Ga0466963_0008566 | 3300044694 | Bacteria | 6138 |
| 207 | Ga0466963_0012785 | 3300044694 | Bacteria | 5143 |
| 208 | Ga0466963_0030385 | 3300044694 | Bacteria | 3485 |
| 209 | Ga0466963_0036405 | 3300044694 | Bacteria | 3210 |
| 210 | Ga0466963_0038255 | 3300044694 | Bacteria | 3136 |
| 211 | Ga0466963_0091018 | 3300044694 | Bacteria | 2077 |
| 212 | Ga0466963_0112362 | 3300044694 | Bacteria | 1870 |
| 213 | Ga0466963_0146580 | 3300044694 | Bacteria | 1638 |
| 214 | Ga0466963_0302412 | 3300044694 | Bacteria | 1125 |
| 215 | Ga0466963_0354774 | 3300044694 | Archaea | 1033 |
| 216 | Ga0466964_0021680 | 3300044706 | Bacteria | 2486 |
| 217 | Ga0466964_0051696 | 3300044706 | Bacteria | 1688 |
| 218 | Ga0466964_0225896 | 3300044706 | Bacteria | 911 |
| 219 | Ga0466971_0000609 | 3300044719 | Bacteria | 14247 |
| 220 | Ga0466971_0007738 | 3300044719 | Bacteria | 4682 |
| 221 | Ga0466971_0007951 | 3300044719 | Bacteria | 4620 |
| 222 | Ga0466957_0003191 | 3300044842 | Bacteria | 8953 |
| 223 | Ga0466957_0018713 | 3300044842 | Bacteria | 4069 |
| 224 | Ga0466957_0057842 | 3300044842 | Bacteria | 2374 |
| 225 | Ga0466960_0223126 | 3300044901 | Bacteria | 1038 |
| 226 | Ga0466959_0177502 | 3300045049 | Bacteria | 1491 |
| 227 | Ga0466959_0307797 | 3300045049 | Bacteria | 1084 |
| 228 | Ga0466958_0005117 | 3300045836 | Bacteria | 7009 |
| 229 | Ga0466958_0076765 | 3300045836 | Bacteria | 2051 |
| 230 | Ga0466958_0136874 | 3300045836 | Bacteria | 1540 |
| 231 | Ga0466958_0212991 | 3300045836 | Unclassified | 1231 |
| 232 | Ga0466967_0000080 | 3300045976 | Bacteria | 34736 |
| 233 | Ga0466967_0004471 | 3300045976 | Bacteria | 9436 |
| 234 | Ga0466967_0004614 | 3300045976 | Bacteria | 9336 |
| 235 | Ga0466967_0110402 | 3300045976 | Bacteria | 2526 |
| 236 | Ga0466967_0142900 | 3300045976 | Bacteria | 2230 |
| 237 | Ga0466967_0160034 | 3300045976 | Bacteria | 2112 |
| 238 | Ga0466967_0166727 | 3300045976 | Bacteria | 2070 |
| 239 | Ga0466967_0235869 | 3300045976 | Bacteria | 1743 |
| 240 | Ga0466967_0269608 | 3300045976 | Bacteria | 1631 |
| 241 | Ga0466967_0342782 | 3300045976 | Unclassified | 1445 |
| 242 | Ga0466967_0345004 | 3300045976 | Unclassified | 1440 |
| 243 | Ga0495592_0001569 | 3300046454 | Bacteria | 15968 |
| 244 | Ga0495592_0116303 | 3300046454 | Unclassified | 1887 |
| 245 | Ga0495629_0000319 | 3300046459 | Bacteria | 41153 |
| 246 | Ga0495641_0035560 | 3300046461 | Bacteria | 2346 |
| 247 | Ga0495651_0000008 | 3300046462 | Bacteria | 156989 |
| 248 | Ga0495651_0021468 | 3300046462 | Bacteria | 5019 |
| 249 | Ga0495651_0031603 | 3300046462 | Bacteria | 4128 |
| 250 | Ga0495653_0001373 | 3300046463 | Bacteria | 18921 |
| 251 | Ga0495653_0032396 | 3300046463 | Bacteria | 4150 |
| 252 | Ga0495582_0000690 | 3300046473 | Bacteria | 18604 |
| 253 | Ga0495582_0050133 | 3300046473 | Bacteria | 2300 |
| 254 | Ga0495582_0245896 | 3300046473 | Unclassified | 1025 |
| 255 | Ga0495639_0010257 | 3300046475 | Bacteria | 4031 |
| 256 | Ga0495662_0019773 | 3300046476 | Bacteria | 3257 |
| 257 | Ga0495662_0154481 | 3300046476 | Bacteria | 1130 |
| 258 | Ga0495585_0044147 | 3300046492 | Bacteria | 2491 |
| 259 | Ga0495607_0032192 | 3300046501 | Bacteria | 3204 |
| 260 | Ga0495608_0001253 | 3300046511 | Bacteria | 18066 |
| 261 | Ga0495608_0021145 | 3300046511 | Bacteria | 4467 |
| 262 | Ga0495608_0142885 | 3300046511 | Bacteria | 1527 |
| 263 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 264 | Ga0495628_0029067 | 3300046516 | Bacteria | 4486 |
| 265 | Ga0495628_0240798 | 3300046516 | Bacteria | 1353 |
| 266 | Ga0495630_0002069 | 3300046517 | Bacteria | 13948 |
| 267 | Ga0495630_0058393 | 3300046517 | Bacteria | 2892 |
| 268 | Ga0495630_0406436 | 3300046517 | Bacteria | 1043 |
| 269 | Ga0495637_0101396 | 3300046520 | Unclassified | 1124 |
| 270 | Ga0495644_0000819 | 3300046523 | Bacteria | 12808 |
| 271 | Ga0495663_0011105 | 3300046525 | Bacteria | 2506 |
| 272 | Ga0495642_0025625 | 3300046528 | Bacteria | 2338 |
| 273 | Ga0495652_0009210 | 3300046529 | Bacteria | 8977 |
| 274 | Ga0495652_0059207 | 3300046529 | Bacteria | 3241 |
| 275 | Ga0495652_0311029 | 3300046529 | Bacteria | 1141 |
| 276 | Ga0495665_0001668 | 3300046531 | Bacteria | 11913 |
| 277 | Ga0495640_0082565 | 3300046533 | Bacteria | 2134 |
| 278 | Ga0495640_0161068 | 3300046533 | Bacteria | 1438 |
| 279 | Ga0495587_0001262 | 3300046536 | Bacteria | 16819 |
| 280 | Ga0495587_0022485 | 3300046536 | Bacteria | 3882 |
| 281 | Ga0495609_0098990 | 3300046538 | Unclassified | 1264 |
| 282 | Ga0495645_0000068 | 3300046543 | Bacteria | 72552 |
| 283 | Ga0495645_0056616 | 3300046543 | Bacteria | 2847 |
| 284 | Ga0495645_0267719 | 3300046543 | Unclassified | 1128 |
| 285 | Ga0495667_0008581 | 3300046559 | Bacteria | 6935 |
| 286 | Ga0495667_0015746 | 3300046559 | Bacteria | 5113 |
| 287 | Ga0495667_0215365 | 3300046559 | Bacteria | 1227 |
| 288 | Ga0495656_0000621 | 3300046615 | Bacteria | 11326 |
| 289 | Ga0495634_0007937 | 3300046642 | Bacteria | 7919 |
| 290 | Ga0495611_0085428 | 3300046648 | Bacteria | 1455 |
| 291 | Ga0495635_0147366 | 3300046663 | Bacteria | 1602 |
| 292 | Ga0495635_0430198 | 3300046663 | Bacteria | 874 |
| 293 | Ga0495659_0051090 | 3300046664 | Unclassified | 1505 |
| 294 | Ga0495657_0015282 | 3300046675 | Bacteria | 5619 |
| 295 | Ga0495657_0020293 | 3300046675 | Bacteria | 4780 |
| 296 | Ga0495599_0000181 | 3300046678 | Bacteria | 41303 |
| 297 | Ga0495599_0016488 | 3300046678 | Bacteria | 4587 |
| 298 | Ga0495623_0000093 | 3300046679 | Bacteria | 53441 |
| 299 | Ga0495623_0005203 | 3300046679 | Bacteria | 8535 |
| 300 | Ga0495646_0007726 | 3300046680 | Bacteria | 6834 |
| 301 | Ga0495646_0035449 | 3300046680 | Bacteria | 3095 |
| 302 | Ga0495646_0076809 | 3300046680 | Bacteria | 1955 |
| 303 | Ga0495646_0306897 | 3300046680 | Unclassified | 838 |
| 304 | Ga0495647_0012879 | 3300046681 | Bacteria | 2887 |
| 305 | Ga0495658_0000384 | 3300046683 | Bacteria | 24849 |
| 306 | Ga0495658_0040142 | 3300046683 | Bacteria | 2601 |
| 307 | Ga0495658_0056334 | 3300046683 | Bacteria | 2242 |
| 308 | Ga0495658_0409068 | 3300046683 | Unclassified | 865 |
| 309 | Ga0495613_0059353 | 3300046689 | Bacteria | 2805 |
| 310 | Ga0495624_0051105 | 3300046690 | Bacteria | 2617 |
| 311 | Ga0495624_0069284 | 3300046690 | Bacteria | 2197 |
| 312 | Ga0495589_0021244 | 3300046794 | Bacteria | 3317 |
| 313 | Ga0495600_0076104 | 3300046809 | Bacteria | 2191 |
| 314 | Ga0495600_0103608 | 3300046809 | Bacteria | 1854 |
| 315 | Ga0495600_0336499 | 3300046809 | Bacteria | 947 |
| 316 | Ga0495604_0000111 | 3300047317 | Bacteria | 68576 |
| 317 | Ga0495604_0319277 | 3300047317 | Bacteria | 1038 |
| 318 | Ga0495636_0075808 | 3300047318 | Unclassified | 1442 |
| 319 | Ga0495674_0001928 | 3300047319 | Bacteria | 20475 |
| 320 | Ga0495674_0028846 | 3300047319 | Bacteria | 5056 |
| 321 | Ga0495674_0211102 | 3300047319 | Bacteria | 1608 |
| 322 | Ga0495674_0228447 | 3300047319 | Bacteria | 1536 |
| 323 | Ga0495676_0005182 | 3300047321 | Bacteria | 11930 |
| 324 | Ga0495676_0030179 | 3300047321 | Bacteria | 4607 |
| 325 | Ga0495676_0315497 | 3300047321 | Unclassified | 1051 |
| 326 | Ga0495680_0002350 | 3300047322 | Bacteria | 19403 |
| 327 | Ga0495680_0006002 | 3300047322 | Bacteria | 11360 |
| 328 | Ga0495680_0006719 | 3300047322 | Bacteria | 10637 |
| 329 | Ga0495680_0023563 | 3300047322 | Bacteria | 5116 |
| 330 | Ga0495680_0260186 | 3300047322 | Bacteria | 1227 |
| 331 | Ga0495675_0000483 | 3300047444 | Bacteria | 25993 |
| 332 | Ga0495675_0010791 | 3300047444 | Bacteria | 5725 |
| 333 | Ga0495679_067001 | 3300047446 | Unclassified | 1041 |
| 334 | Ga0495684_0024218 | 3300047471 | Bacteria | 4672 |
| 335 | Ga0495684_0083341 | 3300047471 | Bacteria | 2425 |
| 336 | Ga0495684_0362942 | 3300047471 | Bacteria | 1025 |
| 337 | Ga0495593_0038323 | 3300047673 | Bacteria | 2589 |
| 338 | Ga0495593_0190376 | 3300047673 | Unclassified | 1032 |
| 339 | Ga0495602_0006649 | 3300048088 | Bacteria | 12122 |
| 340 | Ga0495602_0035701 | 3300048088 | Bacteria | 4633 |
| 341 | Ga0495602_0127890 | 3300048088 | Bacteria | 2032 |
| 342 | Ga0496100_0007234 | 3300048903 | Bacteria | 6106 |
| 343 | Ga0496100_0047246 | 3300048903 | Bacteria | 2772 |
| 344 | Ga0496100_0343084 | 3300048903 | Bacteria | 1126 |
| 345 | Ga0496101_0007462 | 3300048904 | Bacteria | 7088 |
| 346 | Ga0496101_0015430 | 3300048904 | Bacteria | 5149 |
| 347 | Ga0496101_0027701 | 3300048904 | Bacteria | 3950 |
| 348 | Ga0496101_0036587 | 3300048904 | Bacteria | 3477 |
| 349 | Ga0496102_0009303 | 3300048905 | Bacteria | 8436 |
| 350 | Ga0496102_0134094 | 3300048905 | Bacteria | 2320 |
| 351 | Ga0496102_0164196 | 3300048905 | Bacteria | 2089 |
| 352 | Ga0496103_0003753 | 3300048906 | Bacteria | 9238 |
| 353 | Ga0496103_0009596 | 3300048906 | Bacteria | 5730 |
| 354 | Ga0496104_0038156 | 3300048907 | Bacteria | 4494 |
| 355 | Ga0496104_0133784 | 3300048907 | Bacteria | 2382 |
| 356 | Ga0496104_0189820 | 3300048907 | Bacteria | 1966 |
| 357 | Ga0496105_0001696 | 3300048908 | Bacteria | 15709 |
| 358 | Ga0496106_0001537 | 3300048909 | Bacteria | 17362 |
| 359 | Ga0496106_0022310 | 3300048909 | Bacteria | 4702 |
| 360 | Ga0496106_0038462 | 3300048909 | Bacteria | 3580 |
| 361 | Ga0496107_0046869 | 3300048910 | Bacteria | 3111 |
| 362 | Ga0496107_0272058 | 3300048910 | Bacteria | 1261 |
| 363 | Ga0496108_0031559 | 3300048911 | Bacteria | 4396 |
| 364 | Ga0496108_0042083 | 3300048911 | Bacteria | 3813 |
| 365 | Ga0496108_0586507 | 3300048911 | Bacteria | 972 |
| 366 | Ga0496109_0015796 | 3300048912 | Bacteria | 6590 |
| 367 | Ga0496109_0031726 | 3300048912 | Bacteria | 4744 |
| 368 | Ga0496109_0053585 | 3300048912 | Bacteria | 3679 |
| 369 | Ga0496110_0234829 | 3300048913 | Bacteria | 1668 |
| 370 | Ga0496111_0117140 | 3300048914 | Bacteria | 1965 |
| 371 | Ga0496111_0171157 | 3300048914 | Unclassified | 1614 |
| 372 | Ga0496111_0209070 | 3300048914 | Bacteria | 1450 |
| 373 | Ga0496112_0037554 | 3300048915 | Bacteria | 4727 |
| 374 | Ga0496112_0086719 | 3300048915 | Bacteria | 3097 |
| 375 | Ga0496112_0202232 | 3300048915 | Bacteria | 1945 |
| 376 | Ga0496112_0254415 | 3300048915 | Bacteria | 1707 |
| 377 | Ga0496112_0326474 | 3300048915 | Bacteria | 1478 |
| 378 | Ga0496112_0752068 | 3300048915 | Bacteria | 901 |
| 379 | Ga0496112_0825498 | 3300048915 | Unclassified | 851 |
| 380 | Ga0496113_0033569 | 3300048916 | Bacteria | 3738 |
| 381 | Ga0496113_0091520 | 3300048916 | Bacteria | 2345 |
| 382 | Ga0496114_0029976 | 3300048917 | Bacteria | 4474 |
| 383 | Ga0496114_0043541 | 3300048917 | Bacteria | 3722 |
| 384 | Ga0496115_0001529 | 3300048918 | Bacteria | 16618 |
| 385 | Ga0496115_0099468 | 3300048918 | Bacteria | 2383 |
| 386 | Ga0496115_0106957 | 3300048918 | Bacteria | 2297 |
| 387 | Ga0501067_0002005 | 3300049583 | Bacteria | 11218 |
| 388 | Ga0501067_0062689 | 3300049583 | Bacteria | 2058 |
| 389 | Ga0501067_0106297 | 3300049583 | Bacteria | 1560 |
| 390 | Ga0501069_0018849 | 3300049585 | Bacteria | 3725 |
| 391 | Ga0501069_0019552 | 3300049585 | Bacteria | 3664 |
| 392 | Ga0501070_0016223 | 3300049586 | Bacteria | 6259 |
| 393 | Ga0501070_0172433 | 3300049586 | Bacteria | 1782 |
| 394 | Ga0501070_0295974 | 3300049586 | Bacteria | 1319 |
| 395 | Ga0501080_0172055 | 3300049742 | Bacteria | 1997 |
| 396 | Ga0501080_0539967 | 3300049742 | Bacteria | 1039 |
| 397 | nmdc:mga05p37_17936_c1 | 3300050507 | Bacteria | 8545 |
| 398 | nmdc:mga05p37_348810_c1 | 3300050507 | Unclassified | 1743 |
| 399 | nmdc:mga08y16_196784_c1 | 3300050511 | Bacteria | 2089 |
| 400 | nmdc:mga0n895_18728_c1 | 3300050512 | Bacteria | 6415 |
| 401 | nmdc:mga0n895_204059_c1 | 3300050512 | Bacteria | 2007 |
| 402 | nmdc:mga0n895_2410_c1 | 3300050512 | Bacteria | 14579 |
| 403 | nmdc:mga0a205_156225_c1 | 3300050515 | Unclassified | 2179 |
| 404 | nmdc:mga0a205_34448_c1 | 3300050515 | Bacteria | 4857 |
| 405 | Ga0495601_0014421 | 3300053077 | Bacteria | 4762 |
| 406 | Ga0495612_0023688 | 3300053078 | Bacteria | 2464 |
| 407 | Ga0495612_0178781 | 3300053078 | Unclassified | 931 |
| 408 | Ga0495595_0009456 | 3300053084 | Bacteria | 4033 |
| 409 | Ga0495595_0016940 | 3300053084 | Bacteria | 3126 |
| 410 | Ga0495619_0002542 | 3300053085 | Bacteria | 11945 |
| 411 | Ga0495619_0011871 | 3300053085 | Bacteria | 5486 |
| 412 | Ga0495619_0023233 | 3300053085 | Bacteria | 3973 |
| 413 | Ga0495619_0028130 | 3300053085 | Bacteria | 3624 |
| 414 | Ga0495619_0181258 | 3300053085 | Unclassified | 1457 |
| 415 | Ga0466962_0000222 | 3300061719 | Bacteria | 23567 |
| 416 | Ga0466962_0003190 | 3300061719 | Bacteria | 7789 |
| 417 | Ga0466962_0010321 | 3300061719 | Bacteria | 4486 |
| 418 | Ga0466962_0066947 | 3300061719 | Bacteria | 1715 |
| 419 | Ga0530510_0060541 | 3300061734 | Bacteria | 2740 |
| 420 | Ga0070658_10184329 | |||
| 421 | Ga0070658_10049856 | |||
| 422 | Ga0070658_10063015 | |||
| 423 | Ga0070658_10092941 | |||
| 424 | Ga0070658_10380687 | |||
| 425 | Ga0070680_100083888 | |||
| 426 | Ga0070680_100132757 | |||
| 427 | Ga0070660_100038053 | |||
| 428 | Ga0070660_100039694 | |||
| 429 | Ga0070660_100065329 | |||
| 430 | Ga0070661_100017268 | |||
| 431 | Ga0070661_100089403 | |||
| 432 | Ga0070661_100440390 | |||
| 433 | Ga0070671_100049208 | |||
| 434 | Ga0070659_100022717 | |||
| 435 | Ga0070659_100144258 | |||
| 436 | Ga0070714_100065942 | |||
| 437 | Ga0070714_100093219 | |||
| 438 | Ga0070681_10001211 | |||
| 439 | Ga0070681_10015354 | |||
| 440 | Ga0070681_10061551 | |||
| 441 | Ga0070681_10121486 | |||
| 442 | Ga0070706_100632196 | |||
| 443 | Ga0070679_100018501 | |||
| 444 | Ga0070679_100040086 | |||
| 445 | Ga0070679_100236057 | |||
| 446 | Ga0070684_100198381 | |||
| 447 | Ga0068853_100295659 | |||
| 448 | Ga0070665_100044026 | |||
| 449 | Ga0070665_100315952 | |||
| 450 | Ga0068855_100018717 | |||
| 451 | Ga0068855_100036020 | |||
| 452 | Ga0068855_100298359 | |||
| 453 | Ga0068855_100828323 | |||
| 454 | Ga0068855_100865820 | |||
| 455 | Ga0068857_100486617 | |||
| 456 | Ga0068856_100045809 | |||
| 457 | Ga0068852_100029305 | |||
| 458 | Ga0068863_100224090 | |||
| 459 | Ga0070717_10003139 | |||
| 460 | Ga0070717_10284342 | |||
| 461 | Ga0070712_100135205 | |||
| 462 | Ga0070712_100252909 | |||
| 463 | Ga0075428_100425957 | |||
| 464 | Ga0075434_100014043 | |||
| 465 | Ga0075435_100044712 | |||
| 466 | Ga0075435_100331333 | |||
| 467 | Ga0105240_10032416 | |||
| 468 | Ga0105245_10300589 | |||
| 469 | Ga0105245_10372180 | |||
| 470 | Ga0114129_10279860 | |||
| 471 | Ga0114129_10829511 | |||
| 472 | Ga0105241_10626745 | |||
| 473 | Ga0105242_10044962 | |||
| 474 | Ga0105248_10427973 | |||
| 475 | Ga0105237_10093011 | |||
| 476 | Ga0105237_10170647 | |||
| 477 | Ga0105238_10079734 | |||
| 478 | Ga0105238_10099238 | |||
| 479 | Ga0105239_10317922 | |||
| 480 | Ga0157373_10038949 | |||
| 481 | Ga0157373_10103085 | |||
| 482 | Ga0157370_10014193 | |||
| 483 | Ga0157370_10018591 | |||
| 484 | Ga0157370_10032453 | |||
| 485 | Ga0157370_10060745 | |||
| 486 | Ga0157369_10002320 | |||
| 487 | Ga0157369_10010474 | |||
| 488 | Ga0157369_10018305 | |||
| 489 | Ga0157369_10023530 | |||
| 490 | Ga0157369_10082174 | |||
| 491 | Ga0157369_10135938 | |||
| 492 | Ga0157369_10144342 | |||
| 493 | Ga0157369_10147025 | |||
| 494 | Ga0157369_10258223 | |||
| 495 | Ga0157374_10230619 | |||
| 496 | Ga0157374_10378851 | |||
| 497 | Ga0157378_10089095 | |||
| 498 | Ga0163162_10456616 | |||
| 499 | Ga0157372_10179201 | |||
| 500 | Ga0157372_10179845 | |||
| 501 | Ga0157372_10276154 | |||
| 502 | Ga0157372_10889827 | |||
| 503 | Ga0157375_10021615 | |||
| 504 | Ga0182008_10040740 | |||
| 505 | Ga0182008_10095926 | |||
| 506 | Ga0197907_10207184 | |||
| 507 | Ga0206356_10442128 | |||
| 508 | Ga0206356_11047083 | |||
| 509 | Ga0206356_11331715 | |||
| 510 | Ga0206354_10026336 | |||
| 511 | Ga0206354_10436935 | |||
| 512 | Ga0206353_10590627 | |||
| 513 | Ga0206353_10655724 | |||
| 514 | Ga0206353_10852712 | |||
| 515 | Ga0206353_11615899 | |||
| 516 | Ga0213876_10021365 | |||
| 517 | Ga0213871_10001003 | |||
| 518 | Ga0224712_10045749 | |||
| 519 | Ga0207705_10055349 | |||
| 520 | Ga0207705_10078336 | |||
| 521 | Ga0207705_10084070 | |||
| 522 | Ga0207707_10018763 | |||
| 523 | Ga0207707_10072086 | |||
| 524 | Ga0207695_10621959 | |||
| 525 | Ga0207693_10035132 | |||
| 526 | Ga0207693_10071833 | |||
| 527 | Ga0207693_10235226 | |||
| 528 | Ga0207693_10271495 | |||
| 529 | Ga0207663_10075074 | |||
| 530 | Ga0207663_10084296 | |||
| 531 | Ga0207663_10258511 | |||
| 532 | Ga0207660_10012959 | |||
| 533 | Ga0207660_10110267 | |||
| 534 | Ga0207660_10161351 | |||
| 535 | Ga0207660_10207724 | |||
| 536 | Ga0207657_10002072 | |||
| 537 | Ga0207657_10003977 | |||
| 538 | Ga0207657_10031481 | |||
| 539 | Ga0207657_10149644 | |||
| 540 | Ga0207652_10105849 | |||
| 541 | Ga0207646_10352408 | |||
| 542 | Ga0207687_10295089 | |||
| 543 | Ga0207700_10161463 | |||
| 544 | Ga0207664_10015905 | |||
| 545 | Ga0207664_10043349 | |||
| 546 | Ga0207644_10055770 | |||
| 547 | Ga0207690_10037247 | |||
| 548 | Ga0207690_10155421 | |||
| 549 | Ga0207690_10161118 | |||
| 550 | Ga0207661_10382916 | |||
| 551 | Ga0207667_10023514 | |||
| 552 | Ga0207667_10196180 | |||
| 553 | Ga0207667_10249128 | |||
| 554 | Ga0207639_10314095 | |||
| 555 | Ga0207702_10139309 | |||
| 556 | Ga0207641_10070184 | |||
| 557 | Ga0207674_10096898 | |||
| 558 | Ga0207674_10422551 | |||
| 559 | Ga0207683_10011896 | |||
| 560 | Ga0207698_10027805 | |||
| 561 | Ga0207698_10079086 | |||
| 562 | Ga0207428_10148396 | |||
| 563 | Ga0268266_10100255 | |||
| 564 | Ga0265323_10055124 | |||
| 565 | Ga0265338_10025049 | |||
| 566 | Ga0265325_10005193 | |||
| 567 | Ga0265329_10007817 | |||
| 568 | Ga0265340_10076623 | |||
| 569 | Ga0265327_10087784 | |||
| 570 | Ga0265316_10055356 | |||
| 571 | Ga0265313_10004697 | |||
| 572 | Ga0265313_10097618 | |||
| 573 | Ga0265314_10003413 | |||
| 574 | Ga0307409_100180114 | |||
| 575 | Ga0373926_0010296 | |||
| 576 | Ga0373944_0009152 | |||
| 577 | Ga0373923_0067204 | |||
| 578 | Ga0373936_0015264 | |||
| 579 | Ga0373945_0002944 | |||
| 580 | Ga0373953_0033039 | |||
| 581 | Ga0373957_0030496 | |||
| 582 | Ga0373943_0000693 | |||
| 583 | Ga0373946_0023556 | |||
| 584 | Ga0373935_0038588 | |||
| 585 | Ga0373927_0037737 | |||
| 586 | Ga0373927_0192809 | |||
| 587 | Ga0373933_0040662 | |||
| 588 | Ga0373947_0008896 | |||
| 589 | Ga0373937_0072894 | |||
| 590 | Ga0373925_0007920 | |||
| 591 | Ga0373925_0039554 | |||
| 592 | Ga0373925_0148160 | |||
| 593 | Ga0395899_0038597 | |||
| 594 | Ga0395899_0093527 | |||
| 595 | Ga0395899_0134915 | |||
| 596 | Ga0395900_0111129 | |||
| 597 | Ga0395900_0125279 | |||
| 598 | Ga0395900_0284611 | |||
| 599 | Ga0395900_0372791 | |||
| 600 | Ga0395900_0550514 | |||
| 601 | Ga0395898_0016583 | |||
| 602 | Ga0395898_0023488 | |||
| 603 | Ga0395898_0250681 | |||
| 604 | Ga0395898_0299789 | |||
| 605 | Ga0395905_0132115 | |||
| 606 | Ga0395905_0177075 | |||
| 607 | Ga0395905_0412828 | |||
| 608 | Ga0395901_0236918 | |||
| 609 | Ga0395901_0385921 | |||
| 610 | Ga0395901_0628837 | |||
| 611 | Ga0395901_0653288 | |||
| 612 | Ga0436365_1245864 | |||
| 613 | Ga0436365_1344480 | |||
| 614 | Ga0436360_1170606 | |||
| 615 | Ga0436363_0621978 | |||
| 616 | Ga0436363_0651653 | |||
| 617 | Ga0466965_0030561 | |||
| 618 | Ga0466965_0077573 | |||
| 619 | Ga0466966_0034948 | |||
| 620 | Ga0466966_0203310 | |||
| 621 | Ga0466961_0011744 | |||
| 622 | Ga0466961_0019293 | |||
| 623 | Ga0466961_0025016 | |||
| 624 | Ga0466961_0078872 | |||
| 625 | Ga0466963_0008566 | |||
| 626 | Ga0466963_0012785 | |||
| 627 | Ga0466963_0030385 | |||
| 628 | Ga0466963_0036405 | |||
| 629 | Ga0466963_0038255 | |||
| 630 | Ga0466963_0091018 | |||
| 631 | Ga0466963_0112362 | |||
| 632 | Ga0466963_0146580 | |||
| 633 | Ga0466963_0302412 | |||
| 634 | Ga0466963_0354774 | |||
| 635 | Ga0466964_0021680 | |||
| 636 | Ga0466964_0051696 | |||
| 637 | Ga0466964_0225896 | |||
| 638 | Ga0466971_0000609 | |||
| 639 | Ga0466971_0007738 | |||
| 640 | Ga0466971_0007951 | |||
| 641 | Ga0466957_0003191 | |||
| 642 | Ga0466957_0018713 | |||
| 643 | Ga0466957_0057842 | |||
| 644 | Ga0466960_0223126 | |||
| 645 | Ga0466959_0177502 | |||
| 646 | Ga0466959_0307797 | |||
| 647 | Ga0466958_0005117 | |||
| 648 | Ga0466958_0076765 | |||
| 649 | Ga0466958_0136874 | |||
| 650 | Ga0466958_0212991 | |||
| 651 | Ga0466967_0000080 | |||
| 652 | Ga0466967_0004471 | |||
| 653 | Ga0466967_0004614 | |||
| 654 | Ga0466967_0110402 | |||
| 655 | Ga0466967_0142900 | |||
| 656 | Ga0466967_0160034 | |||
| 657 | Ga0466967_0166727 | |||
| 658 | Ga0466967_0235869 | |||
| 659 | Ga0466967_0269608 | |||
| 660 | Ga0466967_0342782 | |||
| 661 | Ga0466967_0345004 | |||
| 662 | Ga0495592_0001569 | |||
| 663 | Ga0495592_0116303 | |||
| 664 | Ga0495629_0000319 | |||
| 665 | Ga0495641_0035560 | |||
| 666 | Ga0495651_0000008 | |||
| 667 | Ga0495651_0021468 | |||
| 668 | Ga0495651_0031603 | |||
| 669 | Ga0495653_0001373 | |||
| 670 | Ga0495653_0032396 | |||
| 671 | Ga0495582_0000690 | |||
| 672 | Ga0495582_0050133 | |||
| 673 | Ga0495582_0245896 | |||
| 674 | Ga0495639_0010257 | |||
| 675 | Ga0495662_0019773 | |||
| 676 | Ga0495662_0154481 | |||
| 677 | Ga0495585_0044147 | |||
| 678 | Ga0495607_0032192 | |||
| 679 | Ga0495608_0001253 | |||
| 680 | Ga0495608_0021145 | |||
| 681 | Ga0495608_0142885 | |||
| 682 | Ga0495628_0000016 | |||
| 683 | Ga0495628_0029067 | |||
| 684 | Ga0495628_0240798 | |||
| 685 | Ga0495630_0002069 | |||
| 686 | Ga0495630_0058393 | |||
| 687 | Ga0495630_0406436 | |||
| 688 | Ga0495637_0101396 | |||
| 689 | Ga0495644_0000819 | |||
| 690 | Ga0495663_0011105 | |||
| 691 | Ga0495642_0025625 | |||
| 692 | Ga0495652_0009210 | |||
| 693 | Ga0495652_0059207 | |||
| 694 | Ga0495652_0311029 | |||
| 695 | Ga0495665_0001668 | |||
| 696 | Ga0495640_0082565 | |||
| 697 | Ga0495640_0161068 | |||
| 698 | Ga0495587_0001262 | |||
| 699 | Ga0495587_0022485 | |||
| 700 | Ga0495609_0098990 | |||
| 701 | Ga0495645_0000068 | |||
| 702 | Ga0495645_0056616 | |||
| 703 | Ga0495645_0267719 | |||
| 704 | Ga0495667_0008581 | |||
| 705 | Ga0495667_0015746 | |||
| 706 | Ga0495667_0215365 | |||
| 707 | Ga0495656_0000621 | |||
| 708 | Ga0495634_0007937 | |||
| 709 | Ga0495611_0085428 | |||
| 710 | Ga0495635_0147366 | |||
| 711 | Ga0495635_0430198 | |||
| 712 | Ga0495659_0051090 | |||
| 713 | Ga0495657_0015282 | |||
| 714 | Ga0495657_0020293 | |||
| 715 | Ga0495599_0000181 | |||
| 716 | Ga0495599_0016488 | |||
| 717 | Ga0495623_0000093 | |||
| 718 | Ga0495623_0005203 | |||
| 719 | Ga0495646_0007726 | |||
| 720 | Ga0495646_0035449 | |||
| 721 | Ga0495646_0076809 | |||
| 722 | Ga0495646_0306897 | |||
| 723 | Ga0495647_0012879 | |||
| 724 | Ga0495658_0000384 | |||
| 725 | Ga0495658_0040142 | |||
| 726 | Ga0495658_0056334 | |||
| 727 | Ga0495658_0409068 | |||
| 728 | Ga0495613_0059353 | |||
| 729 | Ga0495624_0051105 | |||
| 730 | Ga0495624_0069284 | |||
| 731 | Ga0495589_0021244 | |||
| 732 | Ga0495600_0076104 | |||
| 733 | Ga0495600_0103608 | |||
| 734 | Ga0495600_0336499 | |||
| 735 | Ga0495604_0000111 | |||
| 736 | Ga0495604_0319277 | |||
| 737 | Ga0495636_0075808 | |||
| 738 | Ga0495674_0001928 | |||
| 739 | Ga0495674_0028846 | |||
| 740 | Ga0495674_0211102 | |||
| 741 | Ga0495674_0228447 | |||
| 742 | Ga0495676_0005182 | |||
| 743 | Ga0495676_0030179 | |||
| 744 | Ga0495676_0315497 | |||
| 745 | Ga0495680_0002350 | |||
| 746 | Ga0495680_0006002 | |||
| 747 | Ga0495680_0006719 | |||
| 748 | Ga0495680_0023563 | |||
| 749 | Ga0495680_0260186 | |||
| 750 | Ga0495675_0000483 | |||
| 751 | Ga0495675_0010791 | |||
| 752 | Ga0495679_067001 | |||
| 753 | Ga0495684_0024218 | |||
| 754 | Ga0495684_0083341 | |||
| 755 | Ga0495684_0362942 | |||
| 756 | Ga0495593_0038323 | |||
| 757 | Ga0495593_0190376 | |||
| 758 | Ga0495602_0006649 | |||
| 759 | Ga0495602_0035701 | |||
| 760 | Ga0495602_0127890 | |||
| 761 | Ga0496100_0007234 | |||
| 762 | Ga0496100_0047246 | |||
| 763 | Ga0496100_0343084 | |||
| 764 | Ga0496101_0007462 | |||
| 765 | Ga0496101_0015430 | |||
| 766 | Ga0496101_0027701 | |||
| 767 | Ga0496101_0036587 | |||
| 768 | Ga0496102_0009303 | |||
| 769 | Ga0496102_0134094 | |||
| 770 | Ga0496102_0164196 | |||
| 771 | Ga0496103_0003753 | |||
| 772 | Ga0496103_0009596 | |||
| 773 | Ga0496104_0038156 | |||
| 774 | Ga0496104_0133784 | |||
| 775 | Ga0496104_0189820 | |||
| 776 | Ga0496105_0001696 | |||
| 777 | Ga0496106_0001537 | |||
| 778 | Ga0496106_0022310 | |||
| 779 | Ga0496106_0038462 | |||
| 780 | Ga0496107_0046869 | |||
| 781 | Ga0496107_0272058 | |||
| 782 | Ga0496108_0031559 | |||
| 783 | Ga0496108_0042083 | |||
| 784 | Ga0496108_0586507 | |||
| 785 | Ga0496109_0015796 | |||
| 786 | Ga0496109_0031726 | |||
| 787 | Ga0496109_0053585 | |||
| 788 | Ga0496110_0234829 | |||
| 789 | Ga0496111_0117140 | |||
| 790 | Ga0496111_0171157 | |||
| 791 | Ga0496111_0209070 | |||
| 792 | Ga0496112_0037554 | |||
| 793 | Ga0496112_0086719 | |||
| 794 | Ga0496112_0202232 | |||
| 795 | Ga0496112_0254415 | |||
| 796 | Ga0496112_0326474 | |||
| 797 | Ga0496112_0752068 | |||
| 798 | Ga0496112_0825498 | |||
| 799 | Ga0496113_0033569 | |||
| 800 | Ga0496113_0091520 | |||
| 801 | Ga0496114_0029976 | |||
| 802 | Ga0496114_0043541 | |||
| 803 | Ga0496115_0001529 | |||
| 804 | Ga0496115_0099468 | |||
| 805 | Ga0496115_0106957 | |||
| 806 | Ga0501067_0002005 | |||
| 807 | Ga0501067_0062689 | |||
| 808 | Ga0501067_0106297 | |||
| 809 | Ga0501069_0018849 | |||
| 810 | Ga0501069_0019552 | |||
| 811 | Ga0501070_0016223 | |||
| 812 | Ga0501070_0172433 | |||
| 813 | Ga0501070_0295974 | |||
| 814 | Ga0501080_0172055 | |||
| 815 | Ga0501080_0539967 | |||
| 816 | nmdc:mga05p37_17936_c1 | |||
| 817 | nmdc:mga05p37_348810_c1 | |||
| 818 | nmdc:mga08y16_196784_c1 | |||
| 819 | nmdc:mga0n895_18728_c1 | |||
| 820 | nmdc:mga0n895_204059_c1 | |||
| 821 | nmdc:mga0n895_2410_c1 | |||
| 822 | nmdc:mga0a205_156225_c1 | |||
| 823 | nmdc:mga0a205_34448_c1 | |||
| 824 | Ga0495601_0014421 | |||
| 825 | Ga0495612_0023688 | |||
| 826 | Ga0495612_0178781 | |||
| 827 | Ga0495595_0009456 | |||
| 828 | Ga0495595_0016940 | |||
| 829 | Ga0495619_0002542 | |||
| 830 | Ga0495619_0011871 | |||
| 831 | Ga0495619_0023233 | |||
| 832 | Ga0495619_0028130 | |||
| 833 | Ga0495619_0181258 | |||
| 834 | Ga0466962_0000222 | |||
| 835 | Ga0466962_0003190 | |||
| 836 | Ga0466962_0010321 | |||
| 837 | Ga0466962_0066947 | |||
| 838 | Ga0530510_0060541 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ooj-assembly1.cif.gz_F | c1a mutant of e. coli glms in complex with glucose-6p and glutamate | 0.8158 | 3 | 224 |
| 1xfg-assembly1.cif.gz_A | glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate | 0.8114 | 2 | 224 |
| 1ao0-assembly1.cif.gz_C | glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp | 0.7943 | 2 | 229 |
| 1jxa-assembly2.cif.gz_C | glucosamine 6-phosphate synthase with glucose 6-phosphate | 0.7768 | 2 | 224 |
| 7ndl-assembly1.cif.gz_B | crystal structure of human gfat-1 s205d | 0.7746 | 2 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4HSY7_2_295_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7921 | 2 | 229 | 3.60.20.10 |
| af_Q58516_3_191_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7921 | 4 | 199 | 3.60.20.10 |
| af_Q54LK1_43_282_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7851 | 2 | 230 | 3.60.20.10 |
| af_Q7KTW9_18_204_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7741 | 73 | 229 | 3.60.20.10 |
| af_P17169_2_241_3.60.20.10 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.7696 | 2 | 236 | 3.60.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538FCJ1-F1-model_v4 | Glutamine amidotransferase type-2 domain-containing protein | 0.9562 | 94 | 234 |
|
| AF-A0A7W1N6S5-F1-model_v4 | Glutamine amidotransferase type-2 domain-containing protein | 0.952 | 1 | 226 |
|
| AF-A0A7W1N6S5-F1-model_v4 | Glutamine amidotransferase type-2 domain-containing protein | 0.9438 | 1 | 226 |
|
| AF-A0A538HRB9-F1-model_v4 | Glutamine amidotransferase type-2 domain-containing protein | 0.9431 | 2 | 262 |
|
| AF-A0A538FCJ1-F1-model_v4 | Glutamine amidotransferase type-2 domain-containing protein | 0.9431 | 94 | 234 |
|