F439451

General Info

Members Datasets Scaffolds Average Seq Length
419 195 419 197

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10077795|Ga0070658_100777954
Length 209
Sequence VSDGSPAKPAARRGVPILATILALAAVAVMIGLGVWQLQRAKWKTGLLAQYAAAEKAPPITWPTVPLRDSDLPLFRHATGLCVKPVGQRAMAGENLGGDAGYVHIIDCSTGAEGPGMSVELGWSKDPNAKFNWSGGLVSGIIVPDRHSRIRLVAAGAPKGLQQSAPPSVASASAVSPVGHKGYAATWFALALAALVIYVLAMRTRLRGQ

Samples

Sample ID Description Type Environment
1 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
153 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
154 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
165 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 3.34
Rhizosphere 96.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1026161 3300001904 Bacteria 907
2 JGI24740J21852_10001443 3300001979 Bacteria 10897
3 JGI24740J21852_10012784 3300001979 Bacteria 3155
4 JGI24740J21852_10043667 3300001979 Unclassified 1335
5 JGI24739J22299_10001357 3300001989 Bacteria 9185
6 JGI24739J22299_10008968 3300001989 Bacteria 3733
7 JGI24737J22298_10001192 3300001990 Bacteria 9171
8 JGI24737J22298_10009375 3300001990 Bacteria 3259
9 JGI24743J22301_10030010 3300001991 Bacteria 1068
10 JGI24735J21928_10001813 3300002067 Bacteria 7505
11 JGI24738J21930_10000809 3300002075 Bacteria 8991
12 Ga0070658_10016854 3300005327 Bacteria 5849
13 Ga0070658_10019863 3300005327 Bacteria 5382
14 Ga0070658_10038990 3300005327 Bacteria 3832
15 Ga0070658_10077795 3300005327 Bacteria 2722
16 Ga0070658_10261840 3300005327 Bacteria 1469
17 Ga0070658_10327129 3300005327 Bacteria 1309
18 Ga0070658_10583357 3300005327 Bacteria 968
19 Ga0070658_10938556 3300005327 Bacteria 752
20 Ga0070676_10012034 3300005328 Bacteria 4715
21 Ga0070676_10014085 3300005328 Bacteria 4389
22 Ga0070676_10087679 3300005328 Bacteria 1900
23 Ga0070690_100019031 3300005330 Bacteria 4159
24 Ga0070690_100057090 3300005330 Bacteria 2505
25 Ga0070670_100011035 3300005331 Bacteria 7719
26 Ga0070670_100052652 3300005331 Bacteria 3495
27 Ga0070677_10009109 3300005333 Bacteria 3361
28 Ga0070677_10340111 3300005333 Bacteria 774
29 Ga0068869_100000037 3300005334 Bacteria 54729
30 Ga0070666_10059971 3300005335 Bacteria 2574
31 Ga0070680_100003004 3300005336 Bacteria 12527
32 Ga0068868_100003289 3300005338 Bacteria 11252
33 Ga0068868_100134513 3300005338 Bacteria 2025
34 Ga0070660_100009220 3300005339 Bacteria 6932
35 Ga0070660_100132077 3300005339 Bacteria 1999
36 Ga0070660_100416512 3300005339 Bacteria 1112
37 Ga0070689_100321673 3300005340 Bacteria 1292
38 Ga0070691_10217353 3300005341 Bacteria 1011
39 Ga0070661_100013925 3300005344 Bacteria 5653
40 Ga0070692_10310774 3300005345 Bacteria 965
41 Ga0070668_100064049 3300005347 Bacteria 2850
42 Ga0070668_100307501 3300005347 Bacteria 1331
43 Ga0070669_100000553 3300005353 Bacteria 27761
44 Ga0070675_100068006 3300005354 Bacteria 2949
45 Ga0070671_100010880 3300005355 Bacteria 7304
46 Ga0070671_100017714 3300005355 Bacteria 5773
47 Ga0070674_100064445 3300005356 Bacteria 2568
48 Ga0070674_100206137 3300005356 Bacteria 1521
49 Ga0070674_100217565 3300005356 Bacteria 1484
50 Ga0070673_100000617 3300005364 Bacteria 19485
51 Ga0070673_100470199 3300005364 Bacteria 1133
52 Ga0070659_100000226 3300005366 Bacteria 43761
53 Ga0070659_100148993 3300005366 Bacteria 1908
54 Ga0070659_100263381 3300005366 Bacteria 1431
55 Ga0070659_100982585 3300005366 Bacteria 740
56 Ga0070667_100006736 3300005367 Bacteria 9545
57 Ga0070667_100124053 3300005367 Bacteria 2249
58 Ga0070709_10014724 3300005434 Bacteria 4429
59 Ga0070714_100003924 3300005435 Bacteria 11182
60 Ga0070714_100023027 3300005435 Bacteria 5113
61 Ga0070714_100045702 3300005435 Bacteria 3712
62 Ga0070714_100246861 3300005435 Bacteria 1649
63 Ga0070713_100006462 3300005436 Bacteria 8128
64 Ga0070694_100299335 3300005444 Bacteria 1232
65 Ga0070663_100080411 3300005455 Bacteria 2393
66 Ga0070663_100487158 3300005455 Bacteria 1022
67 Ga0070678_100014590 3300005456 Bacteria 4965
68 Ga0070662_100000705 3300005457 Bacteria 20486
69 Ga0070662_100004010 3300005457 Bacteria 9232
70 Ga0070662_100044680 3300005457 Bacteria 3174
71 Ga0070662_100073697 3300005457 Bacteria 2523
72 Ga0070681_10548143 3300005458 Bacteria 1070
73 Ga0070681_10888191 3300005458 Bacteria 809
74 Ga0068867_100000435 3300005459 Bacteria 27943
75 Ga0068867_100014022 3300005459 Bacteria 5677
76 Ga0068867_100151768 3300005459 Bacteria 1820
77 Ga0070685_10248576 3300005466 Bacteria 1177
78 Ga0070685_10480429 3300005466 Bacteria 876
79 Ga0070679_100063026 3300005530 Bacteria 3696
80 Ga0070679_100267645 3300005530 Bacteria 1664
81 Ga0070679_100560344 3300005530 Bacteria 1086
82 Ga0068853_100007949 3300005539 Bacteria 8505
83 Ga0070672_100001515 3300005543 Bacteria 14397
84 Ga0070672_100008763 3300005543 Bacteria 6942
85 Ga0070672_100169551 3300005543 Bacteria 1815
86 Ga0070686_100019722 3300005544 Bacteria 3978
87 Ga0070696_100009811 3300005546 Bacteria 6404
88 Ga0070665_100007268 3300005548 Bacteria 11254
89 Ga0070665_100021177 3300005548 Bacteria 6536
90 Ga0070665_100152128 3300005548 Bacteria 2316
91 Ga0070665_100263282 3300005548 Bacteria 1725
92 Ga0070704_100260675 3300005549 Bacteria 1428
93 Ga0068855_100021630 3300005563 Bacteria 7715
94 Ga0068855_100038922 3300005563 Bacteria 5646
95 Ga0068855_100501648 3300005563 Bacteria 1319
96 Ga0068855_101198557 3300005563 Bacteria 790
97 Ga0070664_100026955 3300005564 Bacteria 4772
98 Ga0070664_100875270 3300005564 Bacteria 842
99 Ga0068857_100004366 3300005577 Bacteria 11946
100 Ga0068857_100196655 3300005577 Bacteria 1837
101 Ga0068854_100000415 3300005578 Bacteria 26758
102 Ga0068854_100090105 3300005578 Bacteria 2280
103 Ga0068854_100164224 3300005578 Bacteria 1722
104 Ga0068856_100390342 3300005614 Unclassified 1412
105 Ga0068852_100000998 3300005616 Bacteria 18659
106 Ga0068852_100002226 3300005616 Bacteria 13301
107 Ga0068852_100369666 3300005616 Bacteria 1404
108 Ga0068859_100003734 3300005617 Bacteria 15514
109 Ga0068859_100009808 3300005617 Bacteria 9671
110 Ga0068864_100003081 3300005618 Bacteria 13762
111 Ga0068864_100238641 3300005618 Bacteria 1684
112 Ga0068866_10233774 3300005718 Bacteria 1116
113 Ga0068861_100087623 3300005719 Bacteria 2450
114 Ga0068870_10401642 3300005840 Bacteria 892
115 Ga0068863_100016153 3300005841 Bacteria 7161
116 Ga0068863_100024831 3300005841 Bacteria 5716
117 Ga0068858_100019406 3300005842 Bacteria 6358
118 Ga0068858_100041282 3300005842 Bacteria 4278
119 Ga0068860_100003826 3300005843 Bacteria 15481
120 Ga0068862_100079967 3300005844 Bacteria 2834
121 Ga0068862_100102616 3300005844 Bacteria 2504
122 Ga0068862_100284022 3300005844 Bacteria 1518
123 Ga0068862_100632289 3300005844 Bacteria 1031
124 Ga0070717_10073969 3300006028 Bacteria 2849
125 Ga0070712_100137711 3300006175 Bacteria 1858
126 Ga0097621_100027033 3300006237 Bacteria 4508
127 Ga0097621_100062133 3300006237 Bacteria 3066
128 Ga0075370_10113979 3300006353 Bacteria 1571
129 Ga0068871_100034536 3300006358 Bacteria 4013
130 Ga0068865_100004123 3300006881 Bacteria 8738
131 Ga0068865_100004950 3300006881 Bacteria 8055
132 Ga0097620_100003734 3300006931 Bacteria 15514
133 Ga0097620_100009808 3300006931 Bacteria 9671
134 Ga0105245_10003832 3300009098 Bacteria 13375
135 Ga0105245_10044701 3300009098 Bacteria 3954
136 Ga0105247_10141471 3300009101 Bacteria 1577
137 Ga0105243_10015057 3300009148 Bacteria 5853
138 Ga0105243_10172765 3300009148 Bacteria 1873
139 Ga0105242_10059728 3300009176 Bacteria 3130
140 Ga0105248_10004678 3300009177 Bacteria 15148
141 Ga0105238_10007923 3300009551 Bacteria 10631
142 Ga0105238_10429791 3300009551 Bacteria 1316
143 Ga0105249_10285601 3300009553 Unclassified 1650
144 Ga0105239_10148095 3300010375 Bacteria 2619
145 Ga0105239_11546391 3300010375 Bacteria 767
146 Ga0105246_10006203 3300011119 Bacteria 7297
147 Ga0157373_10001808 3300013100 Bacteria 16270
148 Ga0157373_10012629 3300013100 Bacteria 6210
149 Ga0157373_10014762 3300013100 Bacteria 5721
150 Ga0157373_10183217 3300013100 Bacteria 1475
151 Ga0157373_10242380 3300013100 Bacteria 1274
152 Ga0157371_10004280 3300013102 Bacteria 12521
153 Ga0157371_10093030 3300013102 Bacteria 2136
154 Ga0157371_10814372 3300013102 Bacteria 704
155 Ga0157369_10385708 3300013105 Bacteria 1454
156 Ga0157378_10008452 3300013297 Bacteria 8968
157 Ga0157372_10035290 3300013307 Bacteria 5505
158 Ga0157372_10891429 3300013307 Bacteria 1032
159 Ga0163163_10195392 3300014325 Bacteria 2071
160 Ga0157377_10336336 3300014745 Bacteria 1008
161 Ga0157379_10044813 3300014968 Bacteria 3948
162 Ga0157376_10009190 3300014969 Bacteria 7170
163 Ga0207697_10002743 3300025315 Bacteria 8981
164 Ga0207682_10020918 3300025893 Bacteria 2572
165 Ga0207710_10152658 3300025900 Bacteria 1121
166 Ga0207680_10019300 3300025903 Bacteria 3643
167 Ga0207647_10000106 3300025904 Bacteria 64310
168 Ga0207699_10152465 3300025906 Bacteria 1531
169 Ga0207645_10019552 3300025907 Bacteria 4439
170 Ga0207645_10095178 3300025907 Bacteria 1918
171 Ga0207645_10106030 3300025907 Bacteria 1816
172 Ga0207645_10110282 3300025907 Bacteria 1781
173 Ga0207643_10095734 3300025908 Bacteria 1736
174 Ga0207705_10073621 3300025909 Bacteria 2478
175 Ga0207705_10370495 3300025909 Bacteria 1105
176 Ga0207707_10402422 3300025912 Bacteria 1175
177 Ga0207693_10027346 3300025915 Bacteria 4510
178 Ga0207660_10106409 3300025917 Bacteria 2103
179 Ga0207657_10003988 3300025919 Bacteria 15693
180 Ga0207652_10014014 3300025921 Bacteria 6491
181 Ga0207652_10058890 3300025921 Bacteria 3310
182 Ga0207652_10263632 3300025921 Bacteria 1554
183 Ga0207681_10002495 3300025923 Bacteria 11687
184 Ga0207694_10175482 3300025924 Bacteria 1736
185 Ga0207650_10007073 3300025925 Bacteria 7647
186 Ga0207659_10023419 3300025926 Bacteria 4120
187 Ga0207687_10011982 3300025927 Bacteria 5670
188 Ga0207687_10502518 3300025927 Bacteria 1012
189 Ga0207664_10202868 3300025929 Bacteria 1713
190 Ga0207664_10528655 3300025929 Bacteria 1057
191 Ga0207644_10001636 3300025931 Bacteria 14430
192 Ga0207644_10002510 3300025931 Bacteria 11811
193 Ga0207644_10010797 3300025931 Bacteria 6027
194 Ga0207644_10497742 3300025931 Bacteria 1005
195 Ga0207690_10046365 3300025932 Bacteria 2878
196 Ga0207690_10082068 3300025932 Bacteria 2254
197 Ga0207690_10243023 3300025932 Bacteria 1387
198 Ga0207706_10000341 3300025933 Bacteria 50615
199 Ga0207706_10003248 3300025933 Bacteria 15582
200 Ga0207706_10013494 3300025933 Bacteria 7424
201 Ga0207706_10015460 3300025933 Bacteria 6895
202 Ga0207706_10274752 3300025933 Bacteria 1470
203 Ga0207686_10094891 3300025934 Bacteria 1978
204 Ga0207709_10026074 3300025935 Bacteria 3354
205 Ga0207709_10102992 3300025935 Bacteria 1891
206 Ga0207670_10064072 3300025936 Bacteria 2518
207 Ga0207669_10039775 3300025937 Bacteria 2721
208 Ga0207704_10020531 3300025938 Bacteria 3498
209 Ga0207704_10081239 3300025938 Bacteria 2096
210 Ga0207691_10003928 3300025940 Bacteria 14444
211 Ga0207691_10012138 3300025940 Bacteria 8259
212 Ga0207691_10228211 3300025940 Bacteria 1613
213 Ga0207711_10002755 3300025941 Bacteria 15479
214 Ga0207711_10003505 3300025941 Bacteria 13589
215 Ga0207689_10001967 3300025942 Bacteria 19411
216 Ga0207679_10061599 3300025945 Bacteria 2793
217 Ga0207679_10145449 3300025945 Bacteria 1922
218 Ga0207667_10018478 3300025949 Bacteria 7816
219 Ga0207667_10092864 3300025949 Bacteria 3117
220 Ga0207667_10750039 3300025949 Bacteria 975
221 Ga0207651_10000825 3300025960 Bacteria 13420
222 Ga0207651_10016809 3300025960 Bacteria 4300
223 Ga0207668_10047140 3300025972 Bacteria 2949
224 Ga0207658_10007456 3300025986 Bacteria 7455
225 Ga0207658_10087569 3300025986 Bacteria 2405
226 Ga0207677_10000925 3300026023 Bacteria 16383
227 Ga0207677_10246944 3300026023 Bacteria 1447
228 Ga0207703_10101913 3300026035 Bacteria 2435
229 Ga0207639_10100213 3300026041 Bacteria 2339
230 Ga0207639_10607299 3300026041 Bacteria 1009
231 Ga0207678_10000960 3300026067 Bacteria 26370
232 Ga0207678_10014368 3300026067 Bacteria 6963
233 Ga0207678_10385118 3300026067 Bacteria 1212
234 Ga0207708_10311465 3300026075 Bacteria 1283
235 Ga0207702_10392165 3300026078 Bacteria 1337
236 Ga0207641_10010069 3300026088 Bacteria 7774
237 Ga0207641_10252820 3300026088 Bacteria 1646
238 Ga0207648_10002130 3300026089 Bacteria 21534
239 Ga0207648_10009403 3300026089 Bacteria 9362
240 Ga0207648_10024720 3300026089 Bacteria 5358
241 Ga0207676_10001969 3300026095 Bacteria 14965
242 Ga0207674_10005518 3300026116 Bacteria 15021
243 Ga0207674_10032057 3300026116 Bacteria 5513
244 Ga0207675_100051646 3300026118 Bacteria 3836
245 Ga0207683_10069438 3300026121 Bacteria 3112
246 Ga0207683_10134893 3300026121 Bacteria 2222
247 Ga0207698_10012042 3300026142 Bacteria 5639
248 Ga0207698_10021641 3300026142 Bacteria 4452
249 Ga0207698_10046740 3300026142 Bacteria 3272
250 Ga0268266_10041245 3300028379 Bacteria 3937
251 Ga0268266_10148201 3300028379 Bacteria 2112
252 Ga0268266_10159135 3300028379 Bacteria 2042
253 Ga0268265_10125864 3300028380 Bacteria 2120
254 Ga0268265_10219283 3300028380 Bacteria 1663
255 Ga0268264_10003563 3300028381 Bacteria 13405
256 Ga0316180_1136621 3300030736 Unclassified 1053
257 Ga0307408_100014795 3300031548 Bacteria 5187
258 Ga0307408_100103044 3300031548 Bacteria 2178
259 Ga0307408_100115167 3300031548 Bacteria 2073
260 Ga0307408_100322921 3300031548 Bacteria 1301
261 Ga0307405_10027073 3300031731 Bacteria 3319
262 Ga0307405_10034521 3300031731 Bacteria 3010
263 Ga0307405_10041480 3300031731 Bacteria 2795
264 Ga0307405_10052146 3300031731 Bacteria 2542
265 Ga0307405_10062896 3300031731 Bacteria 2352
266 Ga0307405_10063458 3300031731 Bacteria 2343
267 Ga0307405_10091889 3300031731 Bacteria 2012
268 Ga0307405_10371915 3300031731 Bacteria 1110
269 Ga0307413_10011049 3300031824 Bacteria 4416
270 Ga0307413_10038141 3300031824 Bacteria 2782
271 Ga0307413_10137148 3300031824 Bacteria 1684
272 Ga0307413_10152017 3300031824 Bacteria 1614
273 Ga0307413_10264461 3300031824 Bacteria 1284
274 Ga0307413_10343521 3300031824 Bacteria 1149
275 Ga0307413_10421706 3300031824 Bacteria 1051
276 Ga0307410_10017727 3300031852 Bacteria 4284
277 Ga0307410_10030147 3300031852 Bacteria 3463
278 Ga0307410_10037329 3300031852 Bacteria 3173
279 Ga0307410_10041604 3300031852 Bacteria 3031
280 Ga0307410_10124258 3300031852 Bacteria 1886
281 Ga0307410_10156569 3300031852 Bacteria 1702
282 Ga0307410_10160158 3300031852 Bacteria 1685
283 Ga0307410_10218866 3300031852 Bacteria 1464
284 Ga0307410_10224821 3300031852 Bacteria 1446
285 Ga0307410_10281852 3300031852 Bacteria 1304
286 Ga0307410_10333368 3300031852 Bacteria 1207
287 Ga0307410_10407027 3300031852 Bacteria 1100
288 Ga0307410_10419479 3300031852 Bacteria 1085
289 Ga0307406_10037288 3300031901 Bacteria 3001
290 Ga0307406_10130467 3300031901 Bacteria 1763
291 Ga0307406_10161401 3300031901 Bacteria 1611
292 Ga0307406_10214343 3300031901 Bacteria 1427
293 Ga0307406_10319521 3300031901 Bacteria 1200
294 Ga0307406_10596058 3300031901 Bacteria 910
295 Ga0307407_10126561 3300031903 Bacteria 1628
296 Ga0307407_10190270 3300031903 Bacteria 1367
297 Ga0307407_10259213 3300031903 Bacteria 1195
298 Ga0307407_10503984 3300031903 Unclassified 888
299 Ga0307412_10026402 3300031911 Bacteria 3609
300 Ga0307412_10057829 3300031911 Bacteria 2590
301 Ga0307412_10102744 3300031911 Bacteria 2024
302 Ga0307412_10110798 3300031911 Bacteria 1959
303 Ga0307412_10266431 3300031911 Bacteria 1338
304 Ga0307412_10531602 3300031911 Bacteria 984
305 Ga0307409_100143562 3300031995 Bacteria 2061
306 Ga0307409_100341580 3300031995 Bacteria 1409
307 Ga0307409_100345227 3300031995 Bacteria 1402
308 Ga0307409_100366557 3300031995 Bacteria 1364
309 Ga0307409_100441218 3300031995 Bacteria 1254
310 Ga0307409_100850732 3300031995 Unclassified 923
311 Ga0307409_100963506 3300031995 Bacteria 870
312 Ga0307409_101026026 3300031995 Bacteria 844
313 Ga0307416_100003111 3300032002 Bacteria 9717
314 Ga0307416_100020561 3300032002 Bacteria 4714
315 Ga0307416_100021810 3300032002 Bacteria 4607
316 Ga0307416_100125767 3300032002 Bacteria 2296
317 Ga0307416_100360189 3300032002 Bacteria 1476
318 Ga0307416_100360389 3300032002 Bacteria 1476
319 Ga0307416_100413058 3300032002 Bacteria 1391
320 Ga0307416_100551932 3300032002 Bacteria 1225
321 Ga0307416_100557362 3300032002 Bacteria 1220
322 Ga0307416_100669718 3300032002 Bacteria 1124
323 Ga0307416_100728797 3300032002 Bacteria 1083
324 Ga0307416_100857209 3300032002 Bacteria 1007
325 Ga0307416_101070896 3300032002 Bacteria 910
326 Ga0307416_101178366 3300032002 Bacteria 871
327 Ga0307414_10100228 3300032004 Bacteria 2178
328 Ga0307414_10128890 3300032004 Bacteria 1960
329 Ga0307414_10129066 3300032004 Bacteria 1959
330 Ga0307414_10175707 3300032004 Bacteria 1717
331 Ga0307414_10264314 3300032004 Bacteria 1437
332 Ga0307414_10410092 3300032004 Bacteria 1179
333 Ga0307414_10474341 3300032004 Bacteria 1102
334 Ga0307414_10490317 3300032004 Bacteria 1085
335 Ga0307414_10521620 3300032004 Bacteria 1054
336 Ga0307414_10539251 3300032004 Bacteria 1038
337 Ga0307414_10741337 3300032004 Bacteria 892
338 Ga0307411_10004664 3300032005 Bacteria 6607
339 Ga0307411_10010298 3300032005 Bacteria 4975
340 Ga0307411_10017607 3300032005 Bacteria 4077
341 Ga0307411_10022197 3300032005 Bacteria 3732
342 Ga0307411_10033236 3300032005 Bacteria 3197
343 Ga0307411_10077691 3300032005 Bacteria 2273
344 Ga0307411_10087719 3300032005 Bacteria 2161
345 Ga0307411_10117866 3300032005 Bacteria 1914
346 Ga0307411_10150877 3300032005 Bacteria 1727
347 Ga0307411_10180844 3300032005 Bacteria 1600
348 Ga0307411_10223119 3300032005 Bacteria 1463
349 Ga0307415_100007004 3300032126 Bacteria 6131
350 Ga0307415_100014070 3300032126 Bacteria 4691
351 Ga0307415_100027689 3300032126 Bacteria 3594
352 Ga0307415_100051584 3300032126 Bacteria 2792
353 Ga0307415_100128096 3300032126 Bacteria 1916
354 Ga0307415_100220099 3300032126 Bacteria 1521
355 Ga0307415_100738161 3300032126 Bacteria 892
356 Ga0307415_100789246 3300032126 Bacteria 866
357 Ga0307415_100918246 3300032126 Bacteria 808
358 Ga0373943_0003527 3300035170 Bacteria 7122
359 Ga0373946_0007909 3300035171 Bacteria 3904
360 Ga0373962_0018930 3300035242 Bacteria 1797
361 Ga0373935_0086806 3300035692 Bacteria 2042
362 Ga0373927_0161060 3300035695 Bacteria 1470
363 Ga0373947_0017985 3300035725 Bacteria 4067
364 Ga0373925_0011242 3300037068 Bacteria 6493
365 Ga0395899_0114884 3300037312 Bacteria 1933
366 Ga0395899_0501972 3300037312 Bacteria 787
367 Ga0395900_0016948 3300037418 Bacteria 7437
368 Ga0395900_0069573 3300037418 Bacteria 3617
369 Ga0395900_0133180 3300037418 Bacteria 2547
370 Ga0395900_0571405 3300037418 Bacteria 1073
371 Ga0395900_0782929 3300037418 Bacteria 883
372 Ga0395898_0040456 3300037466 Bacteria 4609
373 Ga0395898_0157386 3300037466 Bacteria 2173
374 Ga0395905_0016985 3300037471 Bacteria 6910
375 Ga0395905_0033725 3300037471 Bacteria 4808
376 Ga0395905_0059441 3300037471 Bacteria 3573
377 Ga0395905_0178232 3300037471 Bacteria 1995
378 Ga0395905_0314565 3300037471 Bacteria 1454
379 Ga0395905_0389065 3300037471 Bacteria 1289
380 Ga0395905_1319093 3300037471 Unclassified 625
381 Ga0395901_0277449 3300038443 Bacteria 1742
382 Ga0395901_0687457 3300038443 Bacteria 1022
383 Ga0450920_021114 3300042122 Bacteria 1258
384 Ga0450905_003312 3300042142 Bacteria 2114
385 Ga0439434_0155349 3300042435 Bacteria 758
386 Ga0439464_0012866 3300042439 Unclassified 2234
387 Ga0466971_0277030 3300044719 Bacteria 802
388 Ga0466967_0480518 3300045976 Bacteria 1217
389 Ga0466967_1091984 3300045976 Bacteria 795
390 Ga0495663_0012638 3300046525 Bacteria 2354
391 Ga0495598_0015780 3300046537 Bacteria 1914
392 Ga0495621_0004973 3300046539 Bacteria 3784
393 Ga0495633_0116088 3300046558 Bacteria 1240
394 Ga0495659_0039385 3300046664 Bacteria 1680
395 Ga0495669_0007454 3300046684 Bacteria 4588
396 Ga0495669_0287008 3300046684 Bacteria 792
397 Ga0495670_0023580 3300046691 Bacteria 3037
398 Ga0495677_0083752 3300047445 Bacteria 1197
399 Ga0495677_0093692 3300047445 Bacteria 1133
400 Ga0496100_0005962 3300048903 Bacteria 6609
401 Ga0496101_0013702 3300048904 Bacteria 5437
402 Ga0496102_0140848 3300048905 Bacteria 2261
403 Ga0496103_0034513 3300048906 Bacteria 3094
404 Ga0496105_0141691 3300048908 Bacteria 1979
405 Ga0496105_0170391 3300048908 Bacteria 1785
406 Ga0496108_0059840 3300048911 Bacteria 3203
407 Ga0496110_0002065 3300048913 Bacteria 14971
408 Ga0496110_0237789 3300048913 Bacteria 1657
409 Ga0496111_0016078 3300048914 Bacteria 5151
410 Ga0496112_0009336 3300048915 Bacteria 8829
411 Ga0496113_0016450 3300048916 Bacteria 5110
412 Ga0496114_0798561 3300048917 Bacteria 822
413 Ga0496115_0544149 3300048918 Bacteria 929
414 Ga0501067_0440607 3300049583 Bacteria 727
415 Ga0501069_0063071 3300049585 Bacteria 2070
416 Ga0501074_0121877 3300049590 Bacteria 1865
417 Ga0501080_0069932 3300049742 Bacteria 3265
418 nmdc:mga07m45_127601_c1 3300050496 Bacteria 1471
419 nmdc:mga06r32_46833_c1 3300050510 Bacteria 4127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046684 Ga0495669_0287008 Ga0495669_0287008_282_770 159
2 3300013102 Ga0157371_10814372 Ga0157371_108143721 170
3 3300013307 Ga0157372_10891429 Ga0157372_108914292 170
4 3300031852 Ga0307410_10333368 Ga0307410_103333681 172
5 3300031903 Ga0307407_10503984 Ga0307407_105039841 172
6 3300032004 Ga0307414_10410092 Ga0307414_104100922 172
7 3300038443 Ga0395901_0687457 Ga0395901_0687457_441_968 175
8 3300037312 Ga0395899_0501972 Ga0395899_0501972_12_554 176
9 3300037471 Ga0395905_1319093 Ga0395905_1319093_65_607 176
10 3300031824 Ga0307413_10343521 Ga0307413_103435212 180
11 3300031824 Ga0307413_10264461 Ga0307413_102644612 182
12 3300031852 Ga0307410_10224821 Ga0307410_102248213 182
13 3300031901 Ga0307406_10319521 Ga0307406_103195212 182
14 3300032002 Ga0307416_100669718 Ga0307416_1006697182 182
15 3300032002 Ga0307416_100857209 Ga0307416_1008572092 182
16 3300031731 Ga0307405_10062896 Ga0307405_100628963 184
17 3300031824 Ga0307413_10011049 Ga0307413_100110495 184
18 3300031852 Ga0307410_10041604 Ga0307410_100416042 184
19 3300031911 Ga0307412_10266431 Ga0307412_102664313 184
20 3300031995 Ga0307409_100366557 Ga0307409_1003665572 184
21 3300031995 Ga0307409_100850732 Ga0307409_1008507321 184
22 3300032002 Ga0307416_100020561 Ga0307416_1000205616 184
23 3300032005 Ga0307411_10017607 Ga0307411_100176072 184
24 3300031852 Ga0307410_10281852 Ga0307410_102818522 185
25 3300032002 Ga0307416_100125767 Ga0307416_1001257672 185
26 3300032004 Ga0307414_10521620 Ga0307414_105216202 185
27 3300037312 Ga0395899_0114884 Ga0395899_0114884_546_1115 186
28 3300050510 nmdc:mga06r32_46833_c1 nmdc:mga06r32_46833_c1_839_1411 186
29 3300037466 Ga0395898_0157386 Ga0395898_0157386_1164_1775 187
30 3300037471 Ga0395905_0016985 Ga0395905_0016985_3672_4283 187
31 3300005335 Ga0070666_10059971 Ga0070666_100599712 188
32 3300005355 Ga0070671_100010880 Ga0070671_1000108802 188
33 3300005543 Ga0070672_100169551 Ga0070672_1001695512 188
34 3300025931 Ga0207644_10002510 Ga0207644_100025104 188
35 3300025940 Ga0207691_10228211 Ga0207691_102282112 188
36 3300026121 Ga0207683_10069438 Ga0207683_100694384 188
37 3300005435 Ga0070714_100003924 Ga0070714_10000392410 189
38 3300005844 Ga0068862_100284022 Ga0068862_1002840222 189
39 3300013100 Ga0157373_10242380 Ga0157373_102423802 191
40 3300031731 Ga0307405_10063458 Ga0307405_100634582 192
41 3300031852 Ga0307410_10124258 Ga0307410_101242582 192
42 3300031901 Ga0307406_10161401 Ga0307406_101614013 192
43 3300031911 Ga0307412_10531602 Ga0307412_105316022 192
44 3300032002 Ga0307416_101178366 Ga0307416_1011783662 192
45 3300032004 Ga0307414_10264314 Ga0307414_102643141 192
46 3300032005 Ga0307411_10087719 Ga0307411_100877192 192
47 3300032126 Ga0307415_100051584 Ga0307415_1000515843 192
48 3300005366 Ga0070659_100148993 Ga0070659_1001489932 193
49 3300005435 Ga0070714_100045702 Ga0070714_1000457026 193
50 3300005457 Ga0070662_100004010 Ga0070662_1000040103 193
51 3300005530 Ga0070679_100063026 Ga0070679_1000630263 193
52 3300013100 Ga0157373_10001808 Ga0157373_100018089 193
53 3300025921 Ga0207652_10058890 Ga0207652_100588902 193
54 3300025933 Ga0207706_10000341 Ga0207706_1000034119 193
55 3300001979 JGI24740J21852_10012784 JGI24740J21852_100127845 194
56 3300001989 JGI24739J22299_10008968 JGI24739J22299_100089686 194
57 3300001990 JGI24737J22298_10009375 JGI24737J22298_100093751 194
58 3300002067 JGI24735J21928_10001813 JGI24735J21928_100018131 194
59 3300005327 Ga0070658_10038990 Ga0070658_100389903 194
60 3300005327 Ga0070658_10583357 Ga0070658_105833572 194
61 3300005333 Ga0070677_10340111 Ga0070677_103401111 194
62 3300005345 Ga0070692_10310774 Ga0070692_103107741 194
63 3300005366 Ga0070659_100982585 Ga0070659_1009825851 194
64 3300005455 Ga0070663_100080411 Ga0070663_1000804112 194
65 3300005457 Ga0070662_100073697 Ga0070662_1000736972 194
66 3300005458 Ga0070681_10888191 Ga0070681_108881912 194
67 3300005577 Ga0068857_100196655 Ga0068857_1001966553 194
68 3300005618 Ga0068864_100238641 Ga0068864_1002386412 194
69 3300005844 Ga0068862_100079967 Ga0068862_1000799672 194
70 3300009553 Ga0105249_10285601 Ga0105249_102856011 194
71 3300025909 Ga0207705_10073621 Ga0207705_100736212 194
72 3300025909 Ga0207705_10370495 Ga0207705_103704952 194
73 3300025917 Ga0207660_10106409 Ga0207660_101064091 194
74 3300025921 Ga0207652_10014014 Ga0207652_100140148 194
75 3300025932 Ga0207690_10046365 Ga0207690_100463652 194
76 3300025933 Ga0207706_10015460 Ga0207706_100154606 194
77 3300025945 Ga0207679_10061599 Ga0207679_100615992 194
78 3300025949 Ga0207667_10750039 Ga0207667_107500392 194
79 3300026041 Ga0207639_10607299 Ga0207639_106072992 194
80 3300026067 Ga0207678_10000960 Ga0207678_1000096023 194
81 3300026067 Ga0207678_10385118 Ga0207678_103851182 194
82 3300026116 Ga0207674_10032057 Ga0207674_100320573 194
83 3300028380 Ga0268265_10219283 Ga0268265_102192832 194
84 3300030736 Ga0316180_1136621 Ga0316180_11366212 194
85 3300031548 Ga0307408_100103044 Ga0307408_1001030441 194
86 3300031548 Ga0307408_100322921 Ga0307408_1003229212 194
87 3300031731 Ga0307405_10027073 Ga0307405_100270733 194
88 3300031731 Ga0307405_10034521 Ga0307405_100345213 194
89 3300031824 Ga0307413_10038141 Ga0307413_100381412 194
90 3300031824 Ga0307413_10421706 Ga0307413_104217062 194
91 3300031852 Ga0307410_10030147 Ga0307410_100301472 194
92 3300031852 Ga0307410_10156569 Ga0307410_101565693 194
93 3300031852 Ga0307410_10160158 Ga0307410_101601582 194
94 3300031852 Ga0307410_10218866 Ga0307410_102188662 194
95 3300031852 Ga0307410_10419479 Ga0307410_104194792 194
96 3300031901 Ga0307406_10037288 Ga0307406_100372883 194
97 3300031901 Ga0307406_10130467 Ga0307406_101304673 194
98 3300031901 Ga0307406_10214343 Ga0307406_102143432 194
99 3300031903 Ga0307407_10190270 Ga0307407_101902702 194
100 3300031903 Ga0307407_10259213 Ga0307407_102592132 194
101 3300031911 Ga0307412_10026402 Ga0307412_100264026 194
102 3300031911 Ga0307412_10057829 Ga0307412_100578292 194
103 3300031911 Ga0307412_10102744 Ga0307412_101027442 194
104 3300031911 Ga0307412_10110798 Ga0307412_101107983 194
105 3300031995 Ga0307409_100341580 Ga0307409_1003415803 194
106 3300031995 Ga0307409_101026026 Ga0307409_1010260262 194
107 3300032002 Ga0307416_100021810 Ga0307416_1000218107 194
108 3300032002 Ga0307416_100360189 Ga0307416_1003601892 194
109 3300032002 Ga0307416_100413058 Ga0307416_1004130582 194
110 3300032002 Ga0307416_100551932 Ga0307416_1005519323 194
111 3300032002 Ga0307416_100728797 Ga0307416_1007287972 194
112 3300032002 Ga0307416_101070896 Ga0307416_1010708962 194
113 3300032004 Ga0307414_10100228 Ga0307414_101002284 194
114 3300032004 Ga0307414_10128890 Ga0307414_101288902 194
115 3300032004 Ga0307414_10129066 Ga0307414_101290662 194
116 3300032004 Ga0307414_10474341 Ga0307414_104743412 194
117 3300032004 Ga0307414_10490317 Ga0307414_104903172 194
118 3300032004 Ga0307414_10539251 Ga0307414_105392512 194
119 3300032004 Ga0307414_10741337 Ga0307414_107413372 194
120 3300032005 Ga0307411_10010298 Ga0307411_100102983 194
121 3300032005 Ga0307411_10033236 Ga0307411_100332363 194
122 3300032005 Ga0307411_10077691 Ga0307411_100776912 194
123 3300032005 Ga0307411_10117866 Ga0307411_101178662 194
124 3300032005 Ga0307411_10180844 Ga0307411_101808442 194
125 3300032126 Ga0307415_100027689 Ga0307415_1000276896 194
126 3300032126 Ga0307415_100128096 Ga0307415_1001280962 194
127 3300032126 Ga0307415_100789246 Ga0307415_1007892462 194
128 3300032126 Ga0307415_100918246 Ga0307415_1009182462 194
129 3300037418 Ga0395900_0016948 Ga0395900_0016948_2643_3227 194
130 3300037418 Ga0395900_0571405 Ga0395900_0571405_177_761 194
131 3300037471 Ga0395905_0059441 Ga0395905_0059441_1740_2324 194
132 3300037471 Ga0395905_0178232 Ga0395905_0178232_716_1312 194
133 3300042435 Ga0439434_0155349 Ga0439434_0155349_31_627 194
134 3300042439 Ga0439464_0012866 Ga0439464_0012866_1244_1840 194
135 3300005327 Ga0070658_10019863 Ga0070658_100198637 195
136 3300005328 Ga0070676_10014085 Ga0070676_100140855 195
137 3300005330 Ga0070690_100019031 Ga0070690_1000190315 195
138 3300005331 Ga0070670_100052652 Ga0070670_1000526525 195
139 3300005336 Ga0070680_100003004 Ga0070680_10000300410 195
140 3300005338 Ga0068868_100134513 Ga0068868_1001345132 195
141 3300005347 Ga0070668_100307501 Ga0070668_1003075011 195
142 3300005356 Ga0070674_100206137 Ga0070674_1002061372 195
143 3300005356 Ga0070674_100217565 Ga0070674_1002175652 195
144 3300005364 Ga0070673_100470199 Ga0070673_1004701991 195
145 3300005367 Ga0070667_100124053 Ga0070667_1001240533 195
146 3300005456 Ga0070678_100014590 Ga0070678_1000145904 195
147 3300005457 Ga0070662_100044680 Ga0070662_1000446802 195
148 3300005459 Ga0068867_100151768 Ga0068867_1001517682 195
149 3300005466 Ga0070685_10480429 Ga0070685_104804292 195
150 3300005530 Ga0070679_100267645 Ga0070679_1002676452 195
151 3300005543 Ga0070672_100008763 Ga0070672_1000087637 195
152 3300005544 Ga0070686_100019722 Ga0070686_1000197225 195
153 3300005548 Ga0070665_100021177 Ga0070665_1000211779 195
154 3300005548 Ga0070665_100152128 Ga0070665_1001521282 195
155 3300005563 Ga0068855_100038922 Ga0068855_1000389224 195
156 3300005563 Ga0068855_101198557 Ga0068855_1011985571 195
157 3300005564 Ga0070664_100875270 Ga0070664_1008752702 195
158 3300005578 Ga0068854_100164224 Ga0068854_1001642242 195
159 3300005617 Ga0068859_100009808 Ga0068859_1000098084 195
160 3300005841 Ga0068863_100016153 Ga0068863_1000161534 195
161 3300005842 Ga0068858_100041282 Ga0068858_1000412823 195
162 3300005844 Ga0068862_100102616 Ga0068862_1001026163 195
163 3300005844 Ga0068862_100632289 Ga0068862_1006322891 195
164 3300006237 Ga0097621_100027033 Ga0097621_1000270333 195
165 3300006881 Ga0068865_100004123 Ga0068865_1000041233 195
166 3300006931 Ga0097620_100009808 Ga0097620_1000098084 195
167 3300009098 Ga0105245_10044701 Ga0105245_100447015 195
168 3300009101 Ga0105247_10141471 Ga0105247_101414712 195
169 3300009148 Ga0105243_10015057 Ga0105243_100150578 195
170 3300009176 Ga0105242_10059728 Ga0105242_100597283 195
171 3300009551 Ga0105238_10007923 Ga0105238_100079237 195
172 3300010375 Ga0105239_11546391 Ga0105239_115463912 195
173 3300013100 Ga0157373_10012629 Ga0157373_100126299 195
174 3300013102 Ga0157371_10093030 Ga0157371_100930302 195
175 3300013105 Ga0157369_10385708 Ga0157369_103857082 195
176 3300014325 Ga0163163_10195392 Ga0163163_101953922 195
177 3300014745 Ga0157377_10336336 Ga0157377_103363362 195
178 3300014968 Ga0157379_10044813 Ga0157379_100448133 195
179 3300014969 Ga0157376_10009190 Ga0157376_100091905 195
180 3300025900 Ga0207710_10152658 Ga0207710_101526582 195
181 3300025907 Ga0207645_10106030 Ga0207645_101060302 195
182 3300025907 Ga0207645_10110282 Ga0207645_101102822 195
183 3300025921 Ga0207652_10263632 Ga0207652_102636322 195
184 3300025927 Ga0207687_10502518 Ga0207687_105025182 195
185 3300025931 Ga0207644_10001636 Ga0207644_1000163616 195
186 3300025933 Ga0207706_10013494 Ga0207706_100134947 195
187 3300025933 Ga0207706_10274752 Ga0207706_102747522 195
188 3300025934 Ga0207686_10094891 Ga0207686_100948913 195
189 3300025935 Ga0207709_10026074 Ga0207709_100260743 195
190 3300025938 Ga0207704_10020531 Ga0207704_100205312 195
191 3300025940 Ga0207691_10012138 Ga0207691_100121387 195
192 3300025941 Ga0207711_10003505 Ga0207711_1000350515 195
193 3300025949 Ga0207667_10092864 Ga0207667_100928646 195
194 3300025960 Ga0207651_10016809 Ga0207651_100168093 195
195 3300025986 Ga0207658_10007456 Ga0207658_100074565 195
196 3300026023 Ga0207677_10246944 Ga0207677_102469442 195
197 3300026075 Ga0207708_10311465 Ga0207708_103114652 195
198 3300026088 Ga0207641_10252820 Ga0207641_102528202 195
199 3300026089 Ga0207648_10024720 Ga0207648_100247202 195
200 3300026121 Ga0207683_10134893 Ga0207683_101348932 195
201 3300028379 Ga0268266_10148201 Ga0268266_101482012 195
202 3300028379 Ga0268266_10159135 Ga0268266_101591352 195
203 3300028380 Ga0268265_10125864 Ga0268265_101258642 195
204 3300031731 Ga0307405_10041480 Ga0307405_100414803 195
205 3300031731 Ga0307405_10052146 Ga0307405_100521462 195
206 3300031731 Ga0307405_10371915 Ga0307405_103719152 195
207 3300031824 Ga0307413_10137148 Ga0307413_101371483 195
208 3300031852 Ga0307410_10017727 Ga0307410_100177276 195
209 3300031995 Ga0307409_100143562 Ga0307409_1001435622 195
210 3300031995 Ga0307409_100441218 Ga0307409_1004412182 195
211 3300031995 Ga0307409_100963506 Ga0307409_1009635062 195
212 3300032002 Ga0307416_100003111 Ga0307416_1000031119 195
213 3300032002 Ga0307416_100360389 Ga0307416_1003603892 195
214 3300032004 Ga0307414_10175707 Ga0307414_101757071 195
215 3300032005 Ga0307411_10022197 Ga0307411_100221973 195
216 3300032005 Ga0307411_10150877 Ga0307411_101508772 195
217 3300032005 Ga0307411_10223119 Ga0307411_102231192 195
218 3300032126 Ga0307415_100007004 Ga0307415_1000070042 195
219 3300032126 Ga0307415_100014070 Ga0307415_1000140705 195
220 3300032126 Ga0307415_100220099 Ga0307415_1002200992 195
221 3300035170 Ga0373943_0003527 Ga0373943_0003527_6129_6725 195
222 3300035171 Ga0373946_0007909 Ga0373946_0007909_440_1036 195
223 3300035242 Ga0373962_0018930 Ga0373962_0018930_580_1170 195
224 3300035692 Ga0373935_0086806 Ga0373935_0086806_215_811 195
225 3300035695 Ga0373927_0161060 Ga0373927_0161060_34_630 195
226 3300035725 Ga0373947_0017985 Ga0373947_0017985_153_749 195
227 3300037068 Ga0373925_0011242 Ga0373925_0011242_945_1541 195
228 3300037418 Ga0395900_0069573 Ga0395900_0069573_2621_3220 195
229 3300037466 Ga0395898_0040456 Ga0395898_0040456_3732_4331 195
230 3300037471 Ga0395905_0033725 Ga0395905_0033725_3639_4235 195
231 3300037471 Ga0395905_0314565 Ga0395905_0314565_665_1264 195
232 3300038443 Ga0395901_0277449 Ga0395901_0277449_390_986 195
233 3300042122 Ga0450920_021114 Ga0450920_021114_480_1076 195
234 3300044719 Ga0466971_0277030 Ga0466971_0277030_90_686 195
235 3300045976 Ga0466967_0480518 Ga0466967_0480518_44_649 195
236 3300045976 Ga0466967_1091984 Ga0466967_1091984_86_685 195
237 3300046525 Ga0495663_0012638 Ga0495663_0012638_1230_1826 195
238 3300046684 Ga0495669_0007454 Ga0495669_0007454_1884_2480 195
239 3300047445 Ga0495677_0083752 Ga0495677_0083752_488_1084 195
240 3300048903 Ga0496100_0005962 Ga0496100_0005962_162_752 195
241 3300048904 Ga0496101_0013702 Ga0496101_0013702_4614_5204 195
242 3300048905 Ga0496102_0140848 Ga0496102_0140848_1317_1907 195
243 3300048906 Ga0496103_0034513 Ga0496103_0034513_2185_2775 195
244 3300048908 Ga0496105_0170391 Ga0496105_0170391_1073_1663 195
245 3300048911 Ga0496108_0059840 Ga0496108_0059840_2327_2917 195
246 3300048913 Ga0496110_0002065 Ga0496110_0002065_4443_5033 195
247 3300048913 Ga0496110_0237789 Ga0496110_0237789_105_698 195
248 3300048914 Ga0496111_0016078 Ga0496111_0016078_2105_2695 195
249 3300048915 Ga0496112_0009336 Ga0496112_0009336_3534_4124 195
250 3300048916 Ga0496113_0016450 Ga0496113_0016450_1250_1840 195
251 3300048917 Ga0496114_0798561 Ga0496114_0798561_145_735 195
252 3300048918 Ga0496115_0544149 Ga0496115_0544149_10_609 195
253 3300049583 Ga0501067_0440607 Ga0501067_0440607_66_668 195
254 3300049585 Ga0501069_0063071 Ga0501069_0063071_805_1407 195
255 3300049590 Ga0501074_0121877 Ga0501074_0121877_108_707 195
256 3300049742 Ga0501080_0069932 Ga0501080_0069932_2450_3049 195
257 3300001979 JGI24740J21852_10043667 JGI24740J21852_100436672 198
258 3300005327 Ga0070658_10016854 Ga0070658_100168548 198
259 3300005327 Ga0070658_10327129 Ga0070658_103271292 198
260 3300005339 Ga0070660_100132077 Ga0070660_1001320772 198
261 3300005435 Ga0070714_100023027 Ga0070714_1000230276 198
262 3300005548 Ga0070665_100007268 Ga0070665_1000072689 198
263 3300005548 Ga0070665_100263282 Ga0070665_1002632823 198
264 3300005614 Ga0068856_100390342 Ga0068856_1003903422 198
265 3300005616 Ga0068852_100000998 Ga0068852_10000099814 198
266 3300005616 Ga0068852_100369666 Ga0068852_1003696661 198
267 3300025929 Ga0207664_10202868 Ga0207664_102028682 198
268 3300026078 Ga0207702_10392165 Ga0207702_103921652 198
269 3300026142 Ga0207698_10012042 Ga0207698_100120424 198
270 3300028379 Ga0268266_10041245 Ga0268266_100412457 198
271 3300031548 Ga0307408_100014795 Ga0307408_1000147957 198
272 3300031548 Ga0307408_100115167 Ga0307408_1001151673 198
273 3300031731 Ga0307405_10091889 Ga0307405_100918892 198
274 3300031824 Ga0307413_10152017 Ga0307413_101520172 198
275 3300031852 Ga0307410_10037329 Ga0307410_100373296 198
276 3300031852 Ga0307410_10407027 Ga0307410_104070272 198
277 3300031901 Ga0307406_10596058 Ga0307406_105960582 198
278 3300031903 Ga0307407_10126561 Ga0307407_101265612 198
279 3300031995 Ga0307409_100345227 Ga0307409_1003452272 198
280 3300032002 Ga0307416_100557362 Ga0307416_1005573622 198
281 3300032005 Ga0307411_10004664 Ga0307411_100046642 198
282 3300032126 Ga0307415_100738161 Ga0307415_1007381612 198
283 3300046537 Ga0495598_0015780 Ga0495598_0015780_935_1543 198
284 3300046539 Ga0495621_0004973 Ga0495621_0004973_502_1110 198
285 3300046558 Ga0495633_0116088 Ga0495633_0116088_96_704 198
286 3300046664 Ga0495659_0039385 Ga0495659_0039385_772_1380 198
287 3300046691 Ga0495670_0023580 Ga0495670_0023580_2176_2784 198
288 3300047445 Ga0495677_0093692 Ga0495677_0093692_19_627 198
289 3300048908 Ga0496105_0141691 Ga0496105_0141691_703_1299 198
290 3300001904 JGI24736J21556_1026161 JGI24736J21556_10261612 199
291 3300001979 JGI24740J21852_10001443 JGI24740J21852_100014432 199
292 3300001989 JGI24739J22299_10001357 JGI24739J22299_100013577 199
293 3300001990 JGI24737J22298_10001192 JGI24737J22298_100011928 199
294 3300001991 JGI24743J22301_10030010 JGI24743J22301_100300102 199
295 3300002075 JGI24738J21930_10000809 JGI24738J21930_100008098 199
296 3300005327 Ga0070658_10077795 Ga0070658_100777954 199
297 3300005327 Ga0070658_10261840 Ga0070658_102618401 199
298 3300005327 Ga0070658_10938556 Ga0070658_109385561 199
299 3300005328 Ga0070676_10012034 Ga0070676_100120347 199
300 3300005328 Ga0070676_10087679 Ga0070676_100876792 199
301 3300005330 Ga0070690_100057090 Ga0070690_1000570903 199
302 3300005331 Ga0070670_100011035 Ga0070670_1000110352 199
303 3300005333 Ga0070677_10009109 Ga0070677_100091092 199
304 3300005334 Ga0068869_100000037 Ga0068869_10000003742 199
305 3300005338 Ga0068868_100003289 Ga0068868_10000328912 199
306 3300005339 Ga0070660_100009220 Ga0070660_1000092208 199
307 3300005339 Ga0070660_100416512 Ga0070660_1004165122 199
308 3300005340 Ga0070689_100321673 Ga0070689_1003216732 199
309 3300005341 Ga0070691_10217353 Ga0070691_102173532 199
310 3300005344 Ga0070661_100013925 Ga0070661_1000139253 199
311 3300005347 Ga0070668_100064049 Ga0070668_1000640493 199
312 3300005353 Ga0070669_100000553 Ga0070669_10000055331 199
313 3300005354 Ga0070675_100068006 Ga0070675_1000680063 199
314 3300005355 Ga0070671_100017714 Ga0070671_1000177147 199
315 3300005356 Ga0070674_100064445 Ga0070674_1000644452 199
316 3300005364 Ga0070673_100000617 Ga0070673_10000061712 199
317 3300005366 Ga0070659_100000226 Ga0070659_10000022640 199
318 3300005366 Ga0070659_100263381 Ga0070659_1002633812 199
319 3300005367 Ga0070667_100006736 Ga0070667_1000067369 199
320 3300005434 Ga0070709_10014724 Ga0070709_100147247 199
321 3300005435 Ga0070714_100246861 Ga0070714_1002468612 199
322 3300005436 Ga0070713_100006462 Ga0070713_1000064623 199
323 3300005444 Ga0070694_100299335 Ga0070694_1002993352 199
324 3300005455 Ga0070663_100487158 Ga0070663_1004871582 199
325 3300005457 Ga0070662_100000705 Ga0070662_10000070521 199
326 3300005458 Ga0070681_10548143 Ga0070681_105481432 199
327 3300005459 Ga0068867_100000435 Ga0068867_1000004358 199
328 3300005459 Ga0068867_100014022 Ga0068867_1000140228 199
329 3300005466 Ga0070685_10248576 Ga0070685_102485762 199
330 3300005530 Ga0070679_100560344 Ga0070679_1005603442 199
331 3300005539 Ga0068853_100007949 Ga0068853_1000079498 199
332 3300005543 Ga0070672_100001515 Ga0070672_1000015158 199
333 3300005546 Ga0070696_100009811 Ga0070696_1000098118 199
334 3300005549 Ga0070704_100260675 Ga0070704_1002606752 199
335 3300005563 Ga0068855_100021630 Ga0068855_1000216304 199
336 3300005563 Ga0068855_100501648 Ga0068855_1005016482 199
337 3300005564 Ga0070664_100026955 Ga0070664_1000269553 199
338 3300005577 Ga0068857_100004366 Ga0068857_10000436610 199
339 3300005578 Ga0068854_100000415 Ga0068854_10000041530 199
340 3300005578 Ga0068854_100090105 Ga0068854_1000901052 199
341 3300005616 Ga0068852_100002226 Ga0068852_10000222612 199
342 3300005617 Ga0068859_100003734 Ga0068859_10000373416 199
343 3300005618 Ga0068864_100003081 Ga0068864_1000030817 199
344 3300005718 Ga0068866_10233774 Ga0068866_102337742 199
345 3300005719 Ga0068861_100087623 Ga0068861_1000876232 199
346 3300005840 Ga0068870_10401642 Ga0068870_104016422 199
347 3300005841 Ga0068863_100024831 Ga0068863_1000248318 199
348 3300005842 Ga0068858_100019406 Ga0068858_1000194068 199
349 3300005843 Ga0068860_100003826 Ga0068860_10000382613 199
350 3300006028 Ga0070717_10073969 Ga0070717_100739692 199
351 3300006175 Ga0070712_100137711 Ga0070712_1001377113 199
352 3300006237 Ga0097621_100062133 Ga0097621_1000621335 199
353 3300006353 Ga0075370_10113979 Ga0075370_101139792 199
354 3300006358 Ga0068871_100034536 Ga0068871_1000345366 199
355 3300006881 Ga0068865_100004950 Ga0068865_1000049502 199
356 3300006931 Ga0097620_100003734 Ga0097620_10000373416 199
357 3300009098 Ga0105245_10003832 Ga0105245_1000383212 199
358 3300009148 Ga0105243_10172765 Ga0105243_101727652 199
359 3300009177 Ga0105248_10004678 Ga0105248_1000467813 199
360 3300009551 Ga0105238_10429791 Ga0105238_104297912 199
361 3300010375 Ga0105239_10148095 Ga0105239_101480953 199
362 3300011119 Ga0105246_10006203 Ga0105246_100062036 199
363 3300013100 Ga0157373_10014762 Ga0157373_100147628 199
364 3300013100 Ga0157373_10183217 Ga0157373_101832173 199
365 3300013102 Ga0157371_10004280 Ga0157371_1000428011 199
366 3300013297 Ga0157378_10008452 Ga0157378_100084528 199
367 3300013307 Ga0157372_10035290 Ga0157372_100352909 199
368 3300025315 Ga0207697_10002743 Ga0207697_100027437 199
369 3300025893 Ga0207682_10020918 Ga0207682_100209182 199
370 3300025903 Ga0207680_10019300 Ga0207680_100193005 199
371 3300025904 Ga0207647_10000106 Ga0207647_1000010613 199
372 3300025906 Ga0207699_10152465 Ga0207699_101524652 199
373 3300025907 Ga0207645_10019552 Ga0207645_100195522 199
374 3300025907 Ga0207645_10095178 Ga0207645_100951782 199
375 3300025908 Ga0207643_10095734 Ga0207643_100957342 199
376 3300025912 Ga0207707_10402422 Ga0207707_104024221 199
377 3300025915 Ga0207693_10027346 Ga0207693_100273466 199
378 3300025919 Ga0207657_10003988 Ga0207657_100039887 199
379 3300025923 Ga0207681_10002495 Ga0207681_1000249514 199
380 3300025924 Ga0207694_10175482 Ga0207694_101754822 199
381 3300025925 Ga0207650_10007073 Ga0207650_100070733 199
382 3300025926 Ga0207659_10023419 Ga0207659_100234195 199
383 3300025927 Ga0207687_10011982 Ga0207687_100119828 199
384 3300025929 Ga0207664_10528655 Ga0207664_105286552 199
385 3300025931 Ga0207644_10010797 Ga0207644_100107978 199
386 3300025931 Ga0207644_10497742 Ga0207644_104977422 199
387 3300025932 Ga0207690_10082068 Ga0207690_100820682 199
388 3300025932 Ga0207690_10243023 Ga0207690_102430232 199
389 3300025933 Ga0207706_10003248 Ga0207706_100032487 199
390 3300025935 Ga0207709_10102992 Ga0207709_101029922 199
391 3300025936 Ga0207670_10064072 Ga0207670_100640723 199
392 3300025937 Ga0207669_10039775 Ga0207669_100397752 199
393 3300025938 Ga0207704_10081239 Ga0207704_100812392 199
394 3300025940 Ga0207691_10003928 Ga0207691_1000392813 199
395 3300025941 Ga0207711_10002755 Ga0207711_100027558 199
396 3300025942 Ga0207689_10001967 Ga0207689_1000196716 199
397 3300025945 Ga0207679_10145449 Ga0207679_101454493 199
398 3300025949 Ga0207667_10018478 Ga0207667_100184788 199
399 3300025960 Ga0207651_10000825 Ga0207651_100008256 199
400 3300025972 Ga0207668_10047140 Ga0207668_100471402 199
401 3300025986 Ga0207658_10087569 Ga0207658_100875692 199
402 3300026023 Ga0207677_10000925 Ga0207677_1000092519 199
403 3300026035 Ga0207703_10101913 Ga0207703_101019133 199
404 3300026041 Ga0207639_10100213 Ga0207639_101002133 199
405 3300026067 Ga0207678_10014368 Ga0207678_100143682 199
406 3300026088 Ga0207641_10010069 Ga0207641_100100693 199
407 3300026089 Ga0207648_10002130 Ga0207648_1000213013 199
408 3300026089 Ga0207648_10009403 Ga0207648_100094038 199
409 3300026095 Ga0207676_10001969 Ga0207676_100019698 199
410 3300026116 Ga0207674_10005518 Ga0207674_100055188 199
411 3300026118 Ga0207675_100051646 Ga0207675_1000516463 199
412 3300026142 Ga0207698_10021641 Ga0207698_100216415 199
413 3300026142 Ga0207698_10046740 Ga0207698_100467404 199
414 3300028381 Ga0268264_10003563 Ga0268264_100035638 199
415 3300037418 Ga0395900_0133180 Ga0395900_0133180_37_642 199
416 3300037418 Ga0395900_0782929 Ga0395900_0782929_79_690 199
417 3300037471 Ga0395905_0389065 Ga0395905_0389065_531_1130 199
418 3300042142 Ga0450905_003312 Ga0450905_003312_1434_2036 199
419 3300050496 nmdc:mga07m45_127601_c1 nmdc:mga07m45_127601_c1_753_1352 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02104

SURF1

SURF1 family

24

192

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6h-assembly1.cif.gz_Dw cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.6994 9 189
8b6h-assembly1.cif.gz_Dw cryo-em structure of cytochrome c oxidase dimer (complex iv) from respiratory supercomplex of tetrahymena thermophila 0.6428 9 189
6d3q-assembly2.cif.gz_C crystal structure of escherichia coli enolase complexed with a natural inhibitor sf2312. 0.601 72 108
4r9i-assembly1.cif.gz_A crystal structure of cysteine proteinase inhibitor serpin18 from bombyx mori 0.5883 74 97
7e2q-assembly1.cif.gz_A crystal structure of mycoplasma pneumoniae enolase 0.5815 73 114
ID Description Score Start End Superfamily
af_Q2G065_1_109_3.40.50.10350 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycerate kinase; domain 1 0.6986 77 108 3.40.50.10350
af_Q9CQF9_34_350_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6871 74 108 3.50.50.60
af_Q3L8U1_691_750_2.40.50.40 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.671 72 100 2.40.50.40
af_Q2G065_49_259_3.90.1510.10 Alpha Beta;Alpha-Beta Complex;Glycerate kinase, domain 2;Glycerate kinase, domain 2 0.6643 77 109 3.90.1510.10
af_Q9HCI6_295_449_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6385 78 114 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A7H0GBL5-F1-model_v4 deleted 0.9817 1 198
AF-A0A7H0GBL5-F1-model_v4 deleted 0.9573 1 198
AF-A0A7W0D0Q6-F1-model_v4 SURF1-like protein 0.9507 2 196 GO:0005886
AF-A0A520YAK5-F1-model_v4 SURF1-like protein 0.9422 5 182 GO:0005886
AF-A0A7W0D0Q6-F1-model_v4 SURF1-like protein 0.9411 2 196 GO:0005886

Feature Viewer

pLDDT pTM Quality
88.77 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map