F439423

General Info

Members Datasets Scaffolds Average Seq Length
418 271 837 142

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2863404153|2863407258
Length 159
Sequence VRILEFQVVPWPPWWDPIMTDLRIRAATPDDLDAVLAFWKVAAEGTSISDDRDGVERLVARDPESLILAELDGELVGTVIAGFDGWRCHLYRLAVHPGRRRRGIGSALLTAAEERFLRLGGRRGDAMVLVRNETAQHAWRAAGYAPEEKWRRWVKPLGD

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
12 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
13 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
14 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
15 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
16 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
17 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
22 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
29 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
30 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
31 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
32 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
33 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
34 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
35 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
36 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
37 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
38 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
39 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
40 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
41 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
42 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
43 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
44 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
45 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
46 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
47 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
48 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
49 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
50 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
51 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
54 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
57 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
58 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
59 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
60 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
61 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
62 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
63 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
64 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
65 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
66 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
67 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
70 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
71 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
87 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
88 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
99 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
114 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
115 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
123 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
124 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
125 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
130 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
142 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
143 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
144 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
145 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
148 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
149 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
152 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
153 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
154 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
161 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
201 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
202 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
203 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
209 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
210 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
211 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
212 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
213 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
214 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
215 2643221548 Streptomyces sp. Root55 Isolate Unclassified
216 2643221578 Streptomyces sp. Root63 Isolate Unclassified
217 2643221647 Streptomyces sp. Root369 Isolate Unclassified
218 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
219 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
220 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
221 2643221714 Streptomyces sp. Root264 Isolate Unclassified
222 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
223 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
224 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
225 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
226 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
227 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
228 2808606448 Streptomyces sp. 193411 Isolate Unclassified
229 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
230 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
231 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
232 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
233 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
234 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
235 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
236 2862574272 Streptomyces sp. AcE210 Isolate Nodule
237 2867428634 Streptomyces sp. RP5T Isolate Unclassified
238 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
239 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
240 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
241 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
242 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
243 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
244 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
245 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
246 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
247 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
248 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
249 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
250 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
251 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
252 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
253 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
254 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
255 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
256 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
257 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
258 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
259 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
260 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
261 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
262 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
263 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
264 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
265 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
266 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
267 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
268 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
269 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
270 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
271 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.97
Metatranscriptomes 0.72
Isolates 15.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.78
Nodule 0.72
Rhizoplane 1.44
Rhizosphere 78.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10063577 3300003215 Bacteria 989
2 rootH1_10021815 3300003316 Bacteria 7368
3 rootL2_10065160 3300003322 Bacteria 4686
4 rootL2_10070998 3300003322 Bacteria 1818
5 rootH1_10001410 3300003316 Bacteria 21672
6 rootH1_10001410 3300003323 Bacteria 4985
7 Ga0006562J51391_1036996 3300003578 Bacteria 2020
8 Ga0006562J51391_1037925 3300003578 Bacteria 1140
9 Ga0006562J51391_1037926 3300003578 Bacteria 4100
10 Ga0070665_100073243 3300005548 Bacteria 3432
11 Ga0068855_100874910 3300005563 Bacteria 951
12 Ga0081455_10156128 3300005937 Bacteria 1754
13 Ga0075365_10111242 3300006038 Bacteria 1882
14 Ga0075368_10002312 3300006042 Bacteria 6190
15 Ga0075363_100022276 3300006048 Bacteria 3202
16 Ga0075370_10166715 3300006353 Bacteria 1294
17 Ga0105251_10087626 3300009011 Bacteria 1432
18 Ga0105250_10025854 3300009092 Bacteria 2365
19 Ga0105239_11062562 3300010375 Bacteria 932
20 Ga0105246_10042286 3300011119 Bacteria 3085
21 Ga0157372_10723129 3300013307 Bacteria 1158
22 Ga0182008_10001088 3300014497 Bacteria 18738
23 Ga0157376_11307104 3300014969 Bacteria 755
24 Ga0182007_10000170 3300015262 Bacteria 44373
25 Ga0183367_1003 3300015688 Bacteria 814276
26 Ga0209758_1005838 3300025297 Bacteria 9192
27 Ga0207426_1042919 3300025302 Bacteria 1392
28 Ga0207713_1064845 3300025735 Bacteria 1373
29 Ga0207709_10668097 3300025935 Bacteria 829
30 Ga0207640_10679353 3300025981 Bacteria 880
31 Ga0209371_1033278 3300027312 Bacteria 1101
32 Ga0209813_10002205 3300027866 Bacteria 4448
33 Ga0307517_10097984 3300028786 Bacteria 2336
34 Ga0307515_10005754 3300028794 Bacteria 25051
35 Ga0307515_10081744 3300028794 Bacteria 4191
36 Ga0268256_1037870 3300030500 Bacteria 1101
37 Ga0307511_10014403 3300030521 Bacteria 7700
38 Ga0307512_10002929 3300030522 Bacteria 20641
39 Ga0307512_10157415 3300030522 Bacteria 1341
40 Ga0307513_10017336 3300031456 Bacteria 8638
41 Ga0307509_10010609 3300031507 Bacteria 11257
42 Ga0307509_10030678 3300031507 Bacteria 5943
43 Ga0307509_10047279 3300031507 Bacteria 4629
44 Ga0307509_10931391 3300031507 Bacteria 534
45 Ga0307508_10008501 3300031616 Bacteria 9483
46 Ga0307508_10021164 3300031616 Bacteria 5913
47 Ga0307508_10033882 3300031616 Bacteria 4605
48 Ga0307508_10171066 3300031616 Bacteria 1776
49 Ga0307508_10293644 3300031616 Bacteria 1218
50 Ga0307514_10079815 3300031649 Bacteria 2424
51 Ga0307514_10218819 3300031649 Bacteria 1171
52 Ga0307516_10008353 3300031730 Bacteria 11732
53 Ga0307413_10283772 3300031824 Bacteria 1247
54 Ga0307518_10045790 3300031838 Bacteria 3180
55 Ga0307518_10540437 3300031838 Bacteria 582
56 Ga0307416_100923432 3300032002 Bacteria 974
57 Ga0307507_10041810 3300033179 Bacteria 4580
58 Ga0307507_10059591 3300033179 Bacteria 3572
59 Ga0307510_10010023 3300033180 Bacteria 11260
60 Ga0307510_10040268 3300033180 Bacteria 5132
61 Ga0307510_10211918 3300033180 Bacteria 1458
62 Ga0395900_0207557 3300037418 Bacteria 1979
63 Ga0395898_0011027 3300037466 Bacteria 9416
64 Ga0395898_0023499 3300037466 Bacteria 6227
65 Ga0439436_0002848 3300041404 Bacteria 5243
66 Ga0439439_0004684 3300041406 Bacteria 3090
67 Ga0439439_0145100 3300041406 Bacteria 672
68 Ga0451800_1179855 3300041459 Bacteria 909
69 Ga0451837_0094042 3300041494 Bacteria 3853
70 Ga0451851_0299205 3300041507 Bacteria 601
71 Ga0451855_1190925 3300041511 Bacteria 1608
72 Ga0451853_1135248 3300041512 Bacteria 8759
73 Ga0451853_1790268 3300041512 Bacteria 1954
74 Ga0439433_0027059 3300041999 Bacteria 1299
75 Ga0439442_016627 3300042002 Bacteria 1517
76 Ga0439448_0001291 3300042005 Bacteria 6404
77 Ga0439432_098466 3300042006 Bacteria 876
78 Ga0439449_0002456 3300042007 Bacteria 7245
79 Ga0439449_0022468 3300042007 Bacteria 2362
80 Ga0439449_0050568 3300042007 Bacteria 1537
81 Ga0439455_0001321 3300042012 Bacteria 4085
82 Ga0439457_000891 3300042014 Bacteria 9016
83 Ga0450894_000067 3300042131 Bacteria 16376
84 Ga0450896_000515 3300042133 Bacteria 4057
85 Ga0450898_039166 3300042134 Bacteria 891
86 Ga0450899_003115 3300042135 Bacteria 1785
87 Ga0450900_008171 3300042136 Bacteria 1303
88 Ga0450900_059329 3300042136 Bacteria 595
89 Ga0450902_047530 3300042137 Bacteria 734
90 Ga0450903_000071 3300042138 Bacteria 20404
91 Ga0450906_009904 3300042145 Bacteria 1809
92 Ga0439458_0000542 3300042157 Bacteria 9700
93 Ga0439458_0015273 3300042157 Bacteria 1739
94 Ga0439458_0029808 3300042157 Bacteria 1296
95 Ga0450908_001762 3300042184 Bacteria 4216
96 Ga0450901_003085 3300042533 Bacteria 1751
97 Ga0466969_0020827 3300044656 Bacteria 3393
98 Ga0466969_0097706 3300044656 Bacteria 1385
99 Ga0466972_0002102 3300044658 Bacteria 9775
100 Ga0466972_0009081 3300044658 Bacteria 4992
101 Ga0466965_0061909 3300044683 Bacteria 1871
102 Ga0466965_0190253 3300044683 Bacteria 1085
103 Ga0466966_0009029 3300044684 Bacteria 6605
104 Ga0466961_0001765 3300044693 Bacteria 13416
105 Ga0466961_0091016 3300044693 Bacteria 1926
106 Ga0466961_0166051 3300044693 Bacteria 1374
107 Ga0466963_0027310 3300044694 Bacteria 3654
108 Ga0466964_0457552 3300044706 Bacteria 678
109 Ga0466971_0063227 3300044719 Bacteria 1675
110 Ga0466971_0364316 3300044719 Bacteria 701
111 Ga0466968_0005069 3300044735 Bacteria 4936
112 Ga0466970_0015382 3300044765 Bacteria 3933
113 Ga0466970_0063322 3300044765 Bacteria 1983
114 Ga0466970_0210632 3300044765 Bacteria 1083
115 Ga0466957_0028131 3300044842 Bacteria 3346
116 Ga0466960_0004331 3300044901 Bacteria 5537
117 Ga0466959_0707391 3300045049 Bacteria 675
118 Ga0466958_0220078 3300045836 Bacteria 1211
119 Ga0466967_0007818 3300045976 Bacteria 7767
120 Ga0466967_0017437 3300045976 Bacteria 5701
121 Ga0495617_013203 3300046452 Bacteria 2812
122 Ga0495592_0023782 3300046454 Bacteria 4660
123 Ga0495592_0187217 3300046454 Bacteria 1405
124 Ga0495603_0007224 3300046455 Bacteria 6668
125 Ga0495603_0008495 3300046455 Bacteria 6204
126 Ga0495603_0009085 3300046455 Bacteria 6007
127 Ga0495603_0024010 3300046455 Bacteria 3688
128 Ga0495603_0041749 3300046455 Bacteria 2742
129 Ga0495603_0165125 3300046455 Bacteria 1283
130 Ga0495603_0389767 3300046455 Bacteria 798
131 Ga0495629_0004593 3300046459 Bacteria 10334
132 Ga0495629_0007676 3300046459 Bacteria 7941
133 Ga0495629_0013234 3300046459 Bacteria 5957
134 Ga0495629_0013449 3300046459 Bacteria 5902
135 Ga0495629_0014160 3300046459 Bacteria 5745
136 Ga0495629_0035726 3300046459 Bacteria 3511
137 Ga0495638_0075750 3300046460 Bacteria 2050
138 Ga0495638_0234962 3300046460 Bacteria 1018
139 Ga0495651_0104644 3300046462 Bacteria 2101
140 Ga0495582_0034359 3300046473 Bacteria 2787
141 Ga0495605_0027065 3300046474 Bacteria 2974
142 Ga0495605_0069075 3300046474 Bacteria 1673
143 Ga0495639_0001505 3300046475 Bacteria 10391
144 Ga0495662_0118403 3300046476 Bacteria 1299
145 Ga0495664_0607886 3300046477 Bacteria 649
146 Ga0495585_0005128 3300046492 Bacteria 8333
147 Ga0495585_0164025 3300046492 Bacteria 1151
148 Ga0495585_0251919 3300046492 Bacteria 881
149 Ga0495594_0004049 3300046499 Bacteria 7532
150 Ga0495594_0023118 3300046499 Bacteria 3329
151 Ga0495594_0023739 3300046499 Bacteria 3288
152 Ga0495596_0083961 3300046500 Bacteria 1236
153 Ga0495607_0075691 3300046501 Bacteria 1864
154 Ga0495607_0321241 3300046501 Bacteria 722
155 Ga0495583_0006352 3300046506 Bacteria 7748
156 Ga0495583_0027704 3300046506 Bacteria 2793
157 Ga0495583_0230465 3300046506 Bacteria 746
158 Ga0495606_0005990 3300046507 Bacteria 11397
159 Ga0495608_0067133 3300046511 Bacteria 2347
160 Ga0495610_0170943 3300046512 Bacteria 911
161 Ga0495610_0236714 3300046512 Bacteria 730
162 Ga0495610_0375112 3300046512 Bacteria 530
163 Ga0495616_0005572 3300046513 Bacteria 7725
164 Ga0495620_0013870 3300046515 Bacteria 4113
165 Ga0495628_0105141 3300046516 Bacteria 2175
166 Ga0495628_0394771 3300046516 Bacteria 1011
167 Ga0495631_0041942 3300046518 Bacteria 2024
168 Ga0495631_0149990 3300046518 Bacteria 1000
169 Ga0495643_0001589 3300046522 Bacteria 20162
170 Ga0495648_0031740 3300046524 Bacteria 3475
171 Ga0495648_0050582 3300046524 Bacteria 2537
172 Ga0495666_0085384 3300046526 Bacteria 1490
173 Ga0495652_0051439 3300046529 Bacteria 3518
174 Ga0495652_0179292 3300046529 Bacteria 1627
175 Ga0495654_0021092 3300046530 Bacteria 3392
176 Ga0495587_0270226 3300046536 Bacteria 954
177 Ga0495597_0185214 3300046542 Bacteria 839
178 Ga0495645_0066514 3300046543 Bacteria 2605
179 Ga0495622_0002962 3300046557 Bacteria 8080
180 Ga0495622_0133178 3300046557 Bacteria 1131
181 Ga0495622_0338689 3300046557 Bacteria 652
182 Ga0495633_0141659 3300046558 Bacteria 1111
183 Ga0495667_0121623 3300046559 Bacteria 1685
184 Ga0495668_0025011 3300046616 Bacteria 3394
185 Ga0495668_0080917 3300046616 Bacteria 1783
186 Ga0495668_0242624 3300046616 Bacteria 986
187 Ga0495634_0004602 3300046642 Bacteria 10774
188 Ga0495634_0097707 3300046642 Bacteria 1900
189 Ga0495634_0556791 3300046642 Bacteria 668
190 Ga0495611_0050660 3300046648 Bacteria 1870
191 Ga0495611_0070674 3300046648 Bacteria 1595
192 Ga0495611_0275702 3300046648 Bacteria 777
193 Ga0495611_0313341 3300046648 Bacteria 722
194 Ga0495625_0002211 3300046660 Bacteria 21506
195 Ga0495635_0200296 3300046663 Bacteria 1354
196 Ga0495635_0818771 3300046663 Bacteria 599
197 Ga0495588_0008100 3300046674 Bacteria 4805
198 Ga0495588_0015505 3300046674 Bacteria 3668
199 Ga0495588_0071019 3300046674 Bacteria 1810
200 Ga0495657_0005957 3300046675 Bacteria 9577
201 Ga0495657_0015209 3300046675 Bacteria 5635
202 Ga0495657_0034456 3300046675 Bacteria 3516
203 Ga0495657_0225989 3300046675 Bacteria 1133
204 Ga0495623_0021107 3300046679 Bacteria 4208
205 Ga0495646_0478136 3300046680 Bacteria 641
206 Ga0495613_0002503 3300046689 Bacteria 13859
207 Ga0495613_0004316 3300046689 Bacteria 10645
208 Ga0495613_0015363 3300046689 Bacteria 5692
209 Ga0495613_0079399 3300046689 Bacteria 2386
210 Ga0495613_0088085 3300046689 Bacteria 2249
211 Ga0495613_0146263 3300046689 Bacteria 1686
212 Ga0495613_0704025 3300046689 Bacteria 665
213 Ga0495624_0041300 3300046690 Bacteria 2951
214 Ga0495624_0285942 3300046690 Bacteria 995
215 Ga0495624_0406257 3300046690 Bacteria 817
216 Ga0495670_0162480 3300046691 Bacteria 1174
217 Ga0495671_0015130 3300046692 Bacteria 4141
218 Ga0495649_0034078 3300046694 Bacteria 2802
219 Ga0495589_0009712 3300046794 Bacteria 4998
220 Ga0495589_0015528 3300046794 Bacteria 3916
221 Ga0495589_0039298 3300046794 Bacteria 2365
222 Ga0495589_0049774 3300046794 Bacteria 2074
223 Ga0495600_0147685 3300046809 Bacteria 1523
224 Ga0495600_0299234 3300046809 Bacteria 1015
225 Ga0495600_0336440 3300046809 Bacteria 947
226 Ga0495600_0352522 3300046809 Bacteria 922
227 Ga0495600_0363236 3300046809 Bacteria 905
228 Ga0495660_0065118 3300046810 Bacteria 1946
229 Ga0495660_0333381 3300046810 Bacteria 678
230 Ga0495581_0016359 3300047315 Bacteria 4314
231 Ga0495581_0127859 3300047315 Bacteria 1480
232 Ga0495604_0040360 3300047317 Bacteria 3665
233 Ga0495604_0062664 3300047317 Bacteria 2839
234 Ga0495604_0100862 3300047317 Bacteria 2121
235 Ga0495636_0003352 3300047318 Bacteria 6211
236 Ga0495636_0003420 3300047318 Bacteria 6158
237 Ga0495636_0005460 3300047318 Bacteria 4997
238 Ga0495636_0081100 3300047318 Bacteria 1397
239 Ga0495674_0062018 3300047319 Bacteria 3256
240 Ga0495672_0026003 3300047320 Bacteria 3740
241 Ga0495676_0001163 3300047321 Bacteria 22412
242 Ga0495676_0009368 3300047321 Bacteria 8920
243 Ga0495676_0237168 3300047321 Bacteria 1250
244 Ga0495676_0353143 3300047321 Bacteria 982
245 Ga0495680_0026560 3300047322 Bacteria 4771
246 Ga0495680_0097902 3300047322 Bacteria 2189
247 Ga0495683_0092805 3300047323 Bacteria 1460
248 Ga0495687_000668 3300047443 Bacteria 39207
249 Ga0495687_001421 3300047443 Bacteria 22043
250 Ga0495687_068615 3300047443 Bacteria 1430
251 Ga0495687_074501 3300047443 Bacteria 1349
252 Ga0495687_123378 3300047443 Bacteria 930
253 Ga0495675_0050825 3300047444 Bacteria 2634
254 Ga0495677_0414251 3300047445 Bacteria 533
255 Ga0495685_002010 3300047447 Bacteria 6312
256 Ga0495685_017826 3300047447 Bacteria 2433
257 Ga0495685_021349 3300047447 Bacteria 2228
258 Ga0495685_030678 3300047447 Bacteria 1848
259 Ga0495685_036726 3300047447 Bacteria 1681
260 Ga0495685_042905 3300047447 Bacteria 1543
261 Ga0495685_059288 3300047447 Bacteria 1291
262 Ga0495685_201313 3300047447 Bacteria 638
263 Ga0495681_0024559 3300047470 Bacteria 3171
264 Ga0495686_0148582 3300047472 Bacteria 1377
265 Ga0495686_0294803 3300047472 Bacteria 897
266 Ga0495593_0059882 3300047673 Bacteria 1994
267 Ga0495593_0179634 3300047673 Bacteria 1066
268 Ga0495593_0435424 3300047673 Bacteria 656
269 Ga0495602_0080756 3300048088 Bacteria 2738
270 Ga0495614_0172223 3300048089 Bacteria 971
271 Ga0495614_0228414 3300048089 Bacteria 847
272 Ga0495626_0059784 3300048091 Bacteria 1738
273 Ga0496105_0126547 3300048908 Bacteria 2106
274 Ga0496108_0266605 3300048911 Bacteria 1490
275 Ga0496109_0089624 3300048912 Bacteria 2844
276 Ga0496113_0785533 3300048916 Bacteria 757
277 Ga0496121_0623151 3300048924 Bacteria 662
278 Ga0495678_098368 3300049459 Bacteria 1017
279 Ga0495678_100494 3300049459 Bacteria 1002
280 Ga0495682_0365617 3300049460 Bacteria 508
281 Ga0501031_0009611 3300049568 Bacteria 6296
282 Ga0501031_0143501 3300049568 Bacteria 1560
283 Ga0501031_0332177 3300049568 Bacteria 984
284 Ga0501032_0077136 3300049569 Bacteria 2218
285 Ga0501032_0883050 3300049569 Bacteria 563
286 Ga0501033_0052196 3300049570 Bacteria 3030
287 Ga0501033_0224075 3300049570 Bacteria 1337
288 Ga0501033_0572508 3300049570 Bacteria 776
289 Ga0501034_0041278 3300049571 Bacteria 4667
290 Ga0501034_0080777 3300049571 Bacteria 3254
291 Ga0501034_0115484 3300049571 Bacteria 2673
292 Ga0501036_0001722 3300049572 Bacteria 17004
293 Ga0501036_0013575 3300049572 Bacteria 6770
294 Ga0501037_0000829 3300049573 Bacteria 23083
295 Ga0501037_0007524 3300049573 Bacteria 7975
296 Ga0501037_0102194 3300049573 Bacteria 2068
297 Ga0501038_0000639 3300049574 Bacteria 31108
298 Ga0501038_0274483 3300049574 Bacteria 1328
299 Ga0501038_0544407 3300049574 Bacteria 883
300 Ga0501039_0139871 3300049575 Bacteria 1901
301 Ga0501039_1048806 3300049575 Bacteria 633
302 Ga0501040_0240028 3300049576 Bacteria 1291
303 Ga0501041_0000324 3300049577 Bacteria 23255
304 Ga0501042_0002035 3300049578 Bacteria 12252
305 Ga0501043_0026184 3300049579 Bacteria 4575
306 Ga0501043_0034354 3300049579 Bacteria 3988
307 Ga0501046_0011680 3300049580 Bacteria 7506
308 Ga0501047_0010245 3300049581 Bacteria 8867
309 Ga0501047_0015688 3300049581 Bacteria 7218
310 Ga0501047_0228641 3300049581 Bacteria 1714
311 Ga0501048_0053377 3300049582 Bacteria 2874
312 Ga0501048_0851496 3300049582 Bacteria 655
313 Ga0501067_0010227 3300049583 Bacteria 5189
314 Ga0501068_0000686 3300049584 Bacteria 17319
315 Ga0501069_0111142 3300049585 Bacteria 1560
316 Ga0501069_0232612 3300049585 Bacteria 1073
317 Ga0501070_0124918 3300049586 Bacteria 2126
318 Ga0501070_0440338 3300049586 Bacteria 1051
319 Ga0501070_0708451 3300049586 Bacteria 796
320 Ga0501071_0000976 3300049587 Bacteria 15635
321 Ga0501072_0000664 3300049588 Bacteria 24821
322 Ga0501073_0083704 3300049589 Bacteria 2219
323 Ga0501074_0072883 3300049590 Bacteria 2466
324 Ga0501076_0041921 3300049592 Bacteria 3604
325 Ga0501077_0011007 3300049593 Bacteria 5639
326 Ga0501079_0011231 3300049741 Bacteria 6830
327 Ga0501080_0455482 3300049742 Bacteria 1146
328 Ga0501083_0016263 3300049744 Bacteria 5209
329 Ga0501035_0001216 3300049822 Bacteria 26831
330 Ga0501035_0010980 3300049822 Bacteria 8384
331 Ga0501035_0185171 3300049822 Bacteria 1792
332 Ga0501035_0313231 3300049822 Bacteria 1320
333 Ga0501044_0001566 3300049823 Bacteria 26801
334 Ga0501044_0042388 3300049823 Bacteria 4734
335 Ga0501044_0095128 3300049823 Bacteria 3002
336 Ga0501044_0281777 3300049823 Bacteria 1595
337 Ga0501044_0613778 3300049823 Bacteria 980
338 Ga0501045_0076291 3300049824 Bacteria 2469
339 nmdc:mga03n38_1204_c1 3300050490 Bacteria 7238
340 nmdc:mga03n38_76037_c1 3300050490 Bacteria 1565
341 nmdc:mga0yw44_133765_c1 3300050492 Bacteria 1607
342 nmdc:mga06z11_1454_c1 3300050494 Bacteria 8806
343 nmdc:mga04h51_1371_c1 3300050495 Bacteria 5606
344 nmdc:mga07m45_120137_c1 3300050496 Bacteria 1517
345 Ga0500578_0196841 3300053086 Bacteria 1235
346 Ga0500644_0035230 3300053088 Bacteria 1620
347 Ga0500566_0006637 3300053094 Bacteria 6852
348 Ga0500650_0080737 3300053098 Bacteria 1521
349 Ga0500560_037319 3300053107 Bacteria 1505
350 Ga0500573_0081366 3300053140 Bacteria 1840
351 Ga0501084_0111614 3300054114 Bacteria 2297
352 Ga0501082_0003556 3300060353 Bacteria 13608
353 Ga0466962_0099434 3300061719 Bacteria 1396
354 Ga0466962_0262027 3300061719 Bacteria 851
355 Ga0530510_0146029 3300061734 Bacteria 1744
356 2863407258 2863404153 Bacteria 9672205
357 2547409118 2547132111 Bacteria 8013147
358 2554259790 2554235005 Bacteria 6457341
359 2585297752 2582581312 Bacteria 7308206
360 2585309711 2582581313 Bacteria 10042643
361 2585315938 2582581314 Bacteria 11452267
362 2616693010 2616644814 Bacteria 11555299
363 2643764438 2643221548 Bacteria 8053412
364 2643905115 2643221578 Bacteria 9213798
365 2644264257 2643221647 Bacteria 10741251
366 2644403173 2643221673 Bacteria 9196637
367 2644438283 2643221678 Bacteria 9540101
368 2644458503 2643221682 Bacteria 6743283
369 2644630039 2643221714 Bacteria 9015452
370 2784586510 2784132148 Bacteria 8627943
371 2785366914 2784746768 Bacteria 10036182
372 2786667950 2786546132 Bacteria 10419719
373 2793976566 2791355406 Bacteria 11364898
374 2808847412 2808606359 Bacteria 9866990
375 2808918132 2808606375 Bacteria 9466072
376 2809230022 2808606448 Bacteria 8656184
377 2812360555 2811994879 Bacteria 9313447
378 2812482627 2811994917 Bacteria 7761064
379 2852641379 2852635781 Bacteria 8251373
380 2862181331 2862178590 Bacteria 8583590
381 2862289955 2862281513 Bacteria 9621493
382 2862296548 2862290372 Bacteria 7471434
383 2862391344 2862382967 Bacteria 10317375
384 2862580260 2862574272 Bacteria 10567477
385 2867435991 2867428634 Bacteria 9590268
386 2873158190 2873151551 Bacteria 8625867
387 2875392487 2875391855 Bacteria 7600475
388 2877683628 2877676314 Bacteria 9512378
389 2912726412 2912723979 Bacteria 8557534
390 2912758544 2912757875 Bacteria 7940295
391 2919474370 2919468124 Bacteria 9133025
392 2935394077 2935390628 Bacteria 7043367
393 2946052253 2946045630 Bacteria 8527308
394 2946065331 2946064051 Bacteria 8957905
395 2946073698 2946072368 Bacteria 8999607
396 2947232114 2947224130 Bacteria 9938529
397 2954388889 2954380949 Bacteria 10050426
398 2954674236 2954673503 Bacteria 9685905
399 2954689896 2954682443 Bacteria 9862841
400 2954699678 2954691527 Bacteria 10720516
401 2954702522 2954701450 Bacteria 10834262
402 2954718619 2954711539 Bacteria 10867210
403 2954728590 2954721474 Bacteria 10456478
404 2954733222 2954731030 Bacteria 10243860
405 2954747486 2954740390 Bacteria 10229294
406 2954752103 2954749733 Bacteria 10366972
407 2954766602 2954759201 Bacteria 9358192
408 2990063563 2990059506 Bacteria 9321252
409 2990091821 2990088156 Bacteria 6657676
410 2997600871 2997600082 Bacteria 9896405
411 3006497143 3006493962 Bacteria 8825450
412 8008560998 8008558824 Bacteria 10610750
413 8008581023 8008574985 Bacteria 7815457
414 8023628634 8023623736 Bacteria 8593882
415 8047894478 8047893842 Bacteria 11723082
416 8048364574 8048356638 Bacteria 11044339
417 8048371495 8048369669 Bacteria 11666822
418 8048380296 8048379754 Bacteria 11877923
419 8054164269 8054160619 Bacteria 7783213
420 JGI25153J46596_10063577
421 rootH1_10021815
422 rootL2_10065160
423 rootL2_10070998
424 rootH1_10001410
425 Ga0006562J51391_1036996
426 Ga0006562J51391_1037925
427 Ga0006562J51391_1037926
428 Ga0070665_100073243
429 Ga0068855_100874910
430 Ga0081455_10156128
431 Ga0075365_10111242
432 Ga0075368_10002312
433 Ga0075363_100022276
434 Ga0075370_10166715
435 Ga0105251_10087626
436 Ga0105250_10025854
437 Ga0105239_11062562
438 Ga0105246_10042286
439 Ga0157372_10723129
440 Ga0182008_10001088
441 Ga0157376_11307104
442 Ga0182007_10000170
443 Ga0183367_1003
444 Ga0209758_1005838
445 Ga0207426_1042919
446 Ga0207713_1064845
447 Ga0207709_10668097
448 Ga0207640_10679353
449 Ga0209371_1033278
450 Ga0209813_10002205
451 Ga0307517_10097984
452 Ga0307515_10005754
453 Ga0307515_10081744
454 Ga0268256_1037870
455 Ga0307511_10014403
456 Ga0307512_10002929
457 Ga0307512_10157415
458 Ga0307513_10017336
459 Ga0307509_10010609
460 Ga0307509_10030678
461 Ga0307509_10047279
462 Ga0307509_10931391
463 Ga0307508_10008501
464 Ga0307508_10021164
465 Ga0307508_10033882
466 Ga0307508_10171066
467 Ga0307508_10293644
468 Ga0307514_10079815
469 Ga0307514_10218819
470 Ga0307516_10008353
471 Ga0307413_10283772
472 Ga0307518_10045790
473 Ga0307518_10540437
474 Ga0307416_100923432
475 Ga0307507_10041810
476 Ga0307507_10059591
477 Ga0307510_10010023
478 Ga0307510_10040268
479 Ga0307510_10211918
480 Ga0395900_0207557
481 Ga0395898_0011027
482 Ga0395898_0023499
483 Ga0439436_0002848
484 Ga0439439_0004684
485 Ga0439439_0145100
486 Ga0451800_1179855
487 Ga0451837_0094042
488 Ga0451851_0299205
489 Ga0451855_1190925
490 Ga0451853_1135248
491 Ga0451853_1790268
492 Ga0439433_0027059
493 Ga0439442_016627
494 Ga0439448_0001291
495 Ga0439432_098466
496 Ga0439449_0002456
497 Ga0439449_0022468
498 Ga0439449_0050568
499 Ga0439455_0001321
500 Ga0439457_000891
501 Ga0450894_000067
502 Ga0450896_000515
503 Ga0450898_039166
504 Ga0450899_003115
505 Ga0450900_008171
506 Ga0450900_059329
507 Ga0450902_047530
508 Ga0450903_000071
509 Ga0450906_009904
510 Ga0439458_0000542
511 Ga0439458_0015273
512 Ga0439458_0029808
513 Ga0450908_001762
514 Ga0450901_003085
515 Ga0466969_0020827
516 Ga0466969_0097706
517 Ga0466972_0002102
518 Ga0466972_0009081
519 Ga0466965_0061909
520 Ga0466965_0190253
521 Ga0466966_0009029
522 Ga0466961_0001765
523 Ga0466961_0091016
524 Ga0466961_0166051
525 Ga0466963_0027310
526 Ga0466964_0457552
527 Ga0466971_0063227
528 Ga0466971_0364316
529 Ga0466968_0005069
530 Ga0466970_0015382
531 Ga0466970_0063322
532 Ga0466970_0210632
533 Ga0466957_0028131
534 Ga0466960_0004331
535 Ga0466959_0707391
536 Ga0466958_0220078
537 Ga0466967_0007818
538 Ga0466967_0017437
539 Ga0495617_013203
540 Ga0495592_0023782
541 Ga0495592_0187217
542 Ga0495603_0007224
543 Ga0495603_0008495
544 Ga0495603_0009085
545 Ga0495603_0024010
546 Ga0495603_0041749
547 Ga0495603_0165125
548 Ga0495603_0389767
549 Ga0495629_0004593
550 Ga0495629_0007676
551 Ga0495629_0013234
552 Ga0495629_0013449
553 Ga0495629_0014160
554 Ga0495629_0035726
555 Ga0495638_0075750
556 Ga0495638_0234962
557 Ga0495651_0104644
558 Ga0495582_0034359
559 Ga0495605_0027065
560 Ga0495605_0069075
561 Ga0495639_0001505
562 Ga0495662_0118403
563 Ga0495664_0607886
564 Ga0495585_0005128
565 Ga0495585_0164025
566 Ga0495585_0251919
567 Ga0495594_0004049
568 Ga0495594_0023118
569 Ga0495594_0023739
570 Ga0495596_0083961
571 Ga0495607_0075691
572 Ga0495607_0321241
573 Ga0495583_0006352
574 Ga0495583_0027704
575 Ga0495583_0230465
576 Ga0495606_0005990
577 Ga0495608_0067133
578 Ga0495610_0170943
579 Ga0495610_0236714
580 Ga0495610_0375112
581 Ga0495616_0005572
582 Ga0495620_0013870
583 Ga0495628_0105141
584 Ga0495628_0394771
585 Ga0495631_0041942
586 Ga0495631_0149990
587 Ga0495643_0001589
588 Ga0495648_0031740
589 Ga0495648_0050582
590 Ga0495666_0085384
591 Ga0495652_0051439
592 Ga0495652_0179292
593 Ga0495654_0021092
594 Ga0495587_0270226
595 Ga0495597_0185214
596 Ga0495645_0066514
597 Ga0495622_0002962
598 Ga0495622_0133178
599 Ga0495622_0338689
600 Ga0495633_0141659
601 Ga0495667_0121623
602 Ga0495668_0025011
603 Ga0495668_0080917
604 Ga0495668_0242624
605 Ga0495634_0004602
606 Ga0495634_0097707
607 Ga0495634_0556791
608 Ga0495611_0050660
609 Ga0495611_0070674
610 Ga0495611_0275702
611 Ga0495611_0313341
612 Ga0495625_0002211
613 Ga0495635_0200296
614 Ga0495635_0818771
615 Ga0495588_0008100
616 Ga0495588_0015505
617 Ga0495588_0071019
618 Ga0495657_0005957
619 Ga0495657_0015209
620 Ga0495657_0034456
621 Ga0495657_0225989
622 Ga0495623_0021107
623 Ga0495646_0478136
624 Ga0495613_0002503
625 Ga0495613_0004316
626 Ga0495613_0015363
627 Ga0495613_0079399
628 Ga0495613_0088085
629 Ga0495613_0146263
630 Ga0495613_0704025
631 Ga0495624_0041300
632 Ga0495624_0285942
633 Ga0495624_0406257
634 Ga0495670_0162480
635 Ga0495671_0015130
636 Ga0495649_0034078
637 Ga0495589_0009712
638 Ga0495589_0015528
639 Ga0495589_0039298
640 Ga0495589_0049774
641 Ga0495600_0147685
642 Ga0495600_0299234
643 Ga0495600_0336440
644 Ga0495600_0352522
645 Ga0495600_0363236
646 Ga0495660_0065118
647 Ga0495660_0333381
648 Ga0495581_0016359
649 Ga0495581_0127859
650 Ga0495604_0040360
651 Ga0495604_0062664
652 Ga0495604_0100862
653 Ga0495636_0003352
654 Ga0495636_0003420
655 Ga0495636_0005460
656 Ga0495636_0081100
657 Ga0495674_0062018
658 Ga0495672_0026003
659 Ga0495676_0001163
660 Ga0495676_0009368
661 Ga0495676_0237168
662 Ga0495676_0353143
663 Ga0495680_0026560
664 Ga0495680_0097902
665 Ga0495683_0092805
666 Ga0495687_000668
667 Ga0495687_001421
668 Ga0495687_068615
669 Ga0495687_074501
670 Ga0495687_123378
671 Ga0495675_0050825
672 Ga0495677_0414251
673 Ga0495685_002010
674 Ga0495685_017826
675 Ga0495685_021349
676 Ga0495685_030678
677 Ga0495685_036726
678 Ga0495685_042905
679 Ga0495685_059288
680 Ga0495685_201313
681 Ga0495681_0024559
682 Ga0495686_0148582
683 Ga0495686_0294803
684 Ga0495593_0059882
685 Ga0495593_0179634
686 Ga0495593_0435424
687 Ga0495602_0080756
688 Ga0495614_0172223
689 Ga0495614_0228414
690 Ga0495626_0059784
691 Ga0496105_0126547
692 Ga0496108_0266605
693 Ga0496109_0089624
694 Ga0496113_0785533
695 Ga0496121_0623151
696 Ga0495678_098368
697 Ga0495678_100494
698 Ga0495682_0365617
699 Ga0501031_0009611
700 Ga0501031_0143501
701 Ga0501031_0332177
702 Ga0501032_0077136
703 Ga0501032_0883050
704 Ga0501033_0052196
705 Ga0501033_0224075
706 Ga0501033_0572508
707 Ga0501034_0041278
708 Ga0501034_0080777
709 Ga0501034_0115484
710 Ga0501036_0001722
711 Ga0501036_0013575
712 Ga0501037_0000829
713 Ga0501037_0007524
714 Ga0501037_0102194
715 Ga0501038_0000639
716 Ga0501038_0274483
717 Ga0501038_0544407
718 Ga0501039_0139871
719 Ga0501039_1048806
720 Ga0501040_0240028
721 Ga0501041_0000324
722 Ga0501042_0002035
723 Ga0501043_0026184
724 Ga0501043_0034354
725 Ga0501046_0011680
726 Ga0501047_0010245
727 Ga0501047_0015688
728 Ga0501047_0228641
729 Ga0501048_0053377
730 Ga0501048_0851496
731 Ga0501067_0010227
732 Ga0501068_0000686
733 Ga0501069_0111142
734 Ga0501069_0232612
735 Ga0501070_0124918
736 Ga0501070_0440338
737 Ga0501070_0708451
738 Ga0501071_0000976
739 Ga0501072_0000664
740 Ga0501073_0083704
741 Ga0501074_0072883
742 Ga0501076_0041921
743 Ga0501077_0011007
744 Ga0501079_0011231
745 Ga0501080_0455482
746 Ga0501083_0016263
747 Ga0501035_0001216
748 Ga0501035_0010980
749 Ga0501035_0185171
750 Ga0501035_0313231
751 Ga0501044_0001566
752 Ga0501044_0042388
753 Ga0501044_0095128
754 Ga0501044_0281777
755 Ga0501044_0613778
756 Ga0501045_0076291
757 nmdc:mga03n38_1204_c1
758 nmdc:mga03n38_76037_c1
759 nmdc:mga0yw44_133765_c1
760 nmdc:mga06z11_1454_c1
761 nmdc:mga04h51_1371_c1
762 nmdc:mga07m45_120137_c1
763 Ga0500578_0196841
764 Ga0500644_0035230
765 Ga0500566_0006637
766 Ga0500650_0080737
767 Ga0500560_037319
768 Ga0500573_0081366
769 Ga0501084_0111614
770 Ga0501082_0003556
771 Ga0466962_0099434
772 Ga0466962_0262027
773 Ga0530510_0146029
774 2863407258
775 2547409118
776 2554259790
777 2585297752
778 2585309711
779 2585315938
780 2616693010
781 2643764438
782 2643905115
783 2644264257
784 2644403173
785 2644438283
786 2644458503
787 2644630039
788 2784586510
789 2785366914
790 2786667950
791 2793976566
792 2808847412
793 2808918132
794 2809230022
795 2812360555
796 2812482627
797 2852641379
798 2862181331
799 2862289955
800 2862296548
801 2862391344
802 2862580260
803 2867435991
804 2873158190
805 2875392487
806 2877683628
807 2912726412
808 2912758544
809 2919474370
810 2935394077
811 2946052253
812 2946065331
813 2946073698
814 2947232114
815 2954388889
816 2954674236
817 2954689896
818 2954699678
819 2954702522
820 2954718619
821 2954728590
822 2954733222
823 2954747486
824 2954752103
825 2954766602
826 2990063563
827 2990091821
828 2997600871
829 3006497143
830 8008560998
831 8008581023
832 8023628634
833 8047894478
834 8048364574
835 8048371495
836 8048380296
837 8054164269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13480

Acetyltransf_6

Acetyltransferase (GNAT) domain

19

128

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

20

144

0.84

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

43

152

0.81

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

62

146

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qvt-assembly5.cif.gz_H crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9087 5 130
2pdo-assembly1.cif.gz_A crystal structure of the putative acetyltransferase of gnat family from shigella flexneri 0.9072 4 130
4qvt-assembly2.cif.gz_D crystal structure of predicted n-acyltransferase (ypea) in complex with acetyl-coa from escherichia coli 0.9064 5 130
5ib0-assembly1.cif.gz_A pa4534: acetyl coa complex 0.882 5 123
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8777 48 138
ID Description Score Start End Superfamily
4qvtA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9131 5 126 3.40.630.30
af_P76539_1_141_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.911 5 130 3.40.630.30
4qvtA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8992 5 126 3.40.630.30
4ubrB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8969 5 130 3.40.630.30
af_Q58604_70_226_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8864 3 138 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7Y6FQ06-F1-model_v4 deleted 0.9648 4 112
AF-A0A523Z472-F1-model_v4 GNAT family N-acetyltransferase 0.9437 1 131 GO:0016747
AF-A0A1H5PX30-F1-model_v4 Ribosomal protein S18 acetylase RimI 0.943 2 131 GO:0005840
GO:0016747
AF-A0A2N0LB63-F1-model_v4 N-acetyltransferase domain-containing protein 0.9427 1 125 GO:0016747
AF-A0A538K980-F1-model_v4 GNAT family N-acetyltransferase 0.9426 5 131 GO:0016747

Map