F439362
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 418 | 231 | 418 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300046474|Ga0495605_0154693|Ga0495605_0154693_72_677 |
| Length | 201 |
| Sequence | MSDKMSDIGALDTVHIGVLSVSDRASAGVYEDKGIPALQSWLQSAVRNPIVWEPRLIPDEQQLISDALIDLVDRAGCDLVLTTGAAARDVTPEATLAVATKVMPGFGEQMRQISLNFVPTAILSRQVAVIRHKALIINLPGQPKAIAETLGGIPNAQPPVGGIFAAVPYCVDLIGGPYIDTDPAVCKAFRPKSAQRPVASP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 135 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 136 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 137 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 138 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 139 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 140 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 141 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 144 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 145 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 146 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 149 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 152 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 153 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 154 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 155 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 157 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 158 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 159 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 162 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 163 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 164 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 165 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 166 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 167 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 168 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 169 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 170 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 171 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 197 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 213 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 215 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 216 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 217 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 218 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 219 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 224 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 225 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 226 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 228 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 229 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11 |
| Nodule | 0 |
| Rhizoplane | 1.67 |
| Rhizosphere | 83.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10018036 | 3300005328 | Bacteria | 3909 |
| 2 | Ga0070676_10186093 | 3300005328 | Bacteria | 1353 |
| 3 | Ga0070683_100237396 | 3300005329 | Bacteria | 1734 |
| 4 | Ga0070690_100029058 | 3300005330 | Bacteria | 3426 |
| 5 | Ga0070670_100003129 | 3300005331 | Bacteria | 13693 |
| 6 | Ga0070670_100079386 | 3300005331 | Bacteria | 2820 |
| 7 | Ga0070677_10067259 | 3300005333 | Bacteria | 1496 |
| 8 | Ga0068869_100046053 | 3300005334 | Bacteria | 3143 |
| 9 | Ga0068869_100050335 | 3300005334 | Bacteria | 3019 |
| 10 | Ga0070680_100001873 | 3300005336 | Bacteria | 15421 |
| 11 | Ga0070680_100149072 | 3300005336 | Bacteria | 1964 |
| 12 | Ga0068868_100126480 | 3300005338 | Bacteria | 2088 |
| 13 | Ga0068868_100594017 | 3300005338 | Bacteria | 980 |
| 14 | Ga0070689_100009503 | 3300005340 | Bacteria | 6894 |
| 15 | Ga0070689_100333187 | 3300005340 | Bacteria | 1270 |
| 16 | Ga0070691_10043452 | 3300005341 | Bacteria | 2129 |
| 17 | Ga0070692_10262172 | 3300005345 | Bacteria | 1039 |
| 18 | Ga0070668_100004749 | 3300005347 | Bacteria | 10080 |
| 19 | Ga0070669_100021017 | 3300005353 | Bacteria | 4664 |
| 20 | Ga0070669_100045796 | 3300005353 | Bacteria | 3188 |
| 21 | Ga0070669_100306118 | 3300005353 | Bacteria | 1279 |
| 22 | Ga0070675_100007695 | 3300005354 | Bacteria | 8339 |
| 23 | Ga0070675_100093079 | 3300005354 | Bacteria | 2528 |
| 24 | Ga0070675_100139624 | 3300005354 | Bacteria | 2070 |
| 25 | Ga0070671_100011653 | 3300005355 | Bacteria | 7073 |
| 26 | Ga0070671_100323279 | 3300005355 | Bacteria | 1315 |
| 27 | Ga0070674_100008402 | 3300005356 | Bacteria | 6147 |
| 28 | Ga0070674_100034557 | 3300005356 | Bacteria | 3377 |
| 29 | Ga0070674_100051467 | 3300005356 | Bacteria | 2838 |
| 30 | Ga0070674_100168973 | 3300005356 | Bacteria | 1666 |
| 31 | Ga0070674_100334175 | 3300005356 | Bacteria | 1219 |
| 32 | Ga0070673_100022540 | 3300005364 | Bacteria | 4586 |
| 33 | Ga0070673_100027067 | 3300005364 | Bacteria | 4246 |
| 34 | Ga0070673_100054663 | 3300005364 | Bacteria | 3142 |
| 35 | Ga0070673_100159435 | 3300005364 | Bacteria | 1918 |
| 36 | Ga0070673_100441904 | 3300005364 | Bacteria | 1169 |
| 37 | Ga0070659_100287722 | 3300005366 | Bacteria | 1368 |
| 38 | Ga0070667_100001171 | 3300005367 | Bacteria | 23847 |
| 39 | Ga0070667_100062553 | 3300005367 | Bacteria | 3153 |
| 40 | Ga0070705_100373752 | 3300005440 | Bacteria | 1047 |
| 41 | Ga0070700_100005633 | 3300005441 | Bacteria | 6642 |
| 42 | Ga0070700_100093275 | 3300005441 | Bacteria | 1969 |
| 43 | Ga0070694_100110885 | 3300005444 | Bacteria | 1954 |
| 44 | Ga0070708_100000040 | 3300005445 | Bacteria | 84054 |
| 45 | Ga0070663_100249969 | 3300005455 | Bacteria | 1403 |
| 46 | Ga0070678_100009576 | 3300005456 | Bacteria | 5877 |
| 47 | Ga0070678_100022866 | 3300005456 | Bacteria | 4154 |
| 48 | Ga0070678_100026712 | 3300005456 | Bacteria | 3908 |
| 49 | Ga0070662_100113728 | 3300005457 | Bacteria | 2065 |
| 50 | Ga0070662_100208267 | 3300005457 | Bacteria | 1555 |
| 51 | Ga0070662_100219943 | 3300005457 | Bacteria | 1515 |
| 52 | Ga0070662_100448923 | 3300005457 | Bacteria | 1070 |
| 53 | Ga0070681_10131220 | 3300005458 | Bacteria | 2438 |
| 54 | Ga0068867_100012224 | 3300005459 | Bacteria | 6067 |
| 55 | Ga0070679_100006195 | 3300005530 | Bacteria | 11138 |
| 56 | Ga0068853_100157319 | 3300005539 | Bacteria | 2048 |
| 57 | Ga0070672_100002003 | 3300005543 | Bacteria | 12792 |
| 58 | Ga0070672_100026453 | 3300005543 | Bacteria | 4318 |
| 59 | Ga0070672_100028846 | 3300005543 | Bacteria | 4155 |
| 60 | Ga0070672_100033634 | 3300005543 | Bacteria | 3884 |
| 61 | Ga0070672_100038231 | 3300005543 | Bacteria | 3666 |
| 62 | Ga0070672_100053569 | 3300005543 | Bacteria | 3154 |
| 63 | Ga0070672_100336441 | 3300005543 | Bacteria | 1285 |
| 64 | Ga0070686_100021059 | 3300005544 | Bacteria | 3869 |
| 65 | Ga0070695_100072495 | 3300005545 | Bacteria | 2258 |
| 66 | Ga0070704_100803639 | 3300005549 | Bacteria | 840 |
| 67 | Ga0070664_100458489 | 3300005564 | Bacteria | 1171 |
| 68 | Ga0068857_100068142 | 3300005577 | Bacteria | 3168 |
| 69 | Ga0068857_100337554 | 3300005577 | Bacteria | 1394 |
| 70 | Ga0068854_100066703 | 3300005578 | Bacteria | 2620 |
| 71 | Ga0070702_100006482 | 3300005615 | Bacteria | 5544 |
| 72 | Ga0068852_100081171 | 3300005616 | Bacteria | 2878 |
| 73 | Ga0068852_100199735 | 3300005616 | Bacteria | 1892 |
| 74 | Ga0068852_100444406 | 3300005616 | Bacteria | 1282 |
| 75 | Ga0068859_100059484 | 3300005617 | Bacteria | 3849 |
| 76 | Ga0068859_100098525 | 3300005617 | Bacteria | 2977 |
| 77 | Ga0068864_100125334 | 3300005618 | Bacteria | 2301 |
| 78 | Ga0068864_100153585 | 3300005618 | Bacteria | 2087 |
| 79 | Ga0068866_10002667 | 3300005718 | Bacteria | 7371 |
| 80 | Ga0068866_10032021 | 3300005718 | Bacteria | 2539 |
| 81 | Ga0068866_10352045 | 3300005718 | Bacteria | 936 |
| 82 | Ga0068861_100011784 | 3300005719 | Bacteria | 6085 |
| 83 | Ga0068861_100014098 | 3300005719 | Bacteria | 5604 |
| 84 | Ga0068851_10122710 | 3300005834 | Bacteria | 1398 |
| 85 | Ga0068851_10435552 | 3300005834 | Bacteria | 777 |
| 86 | Ga0068870_10009162 | 3300005840 | Bacteria | 4488 |
| 87 | Ga0068863_100031883 | 3300005841 | Bacteria | 5027 |
| 88 | Ga0068863_100047492 | 3300005841 | Bacteria | 4071 |
| 89 | Ga0068863_100273414 | 3300005841 | Bacteria | 1636 |
| 90 | Ga0068863_100342953 | 3300005841 | Bacteria | 1453 |
| 91 | Ga0068863_100845874 | 3300005841 | Bacteria | 914 |
| 92 | Ga0068858_100011483 | 3300005842 | Bacteria | 8358 |
| 93 | Ga0068858_100056552 | 3300005842 | Bacteria | 3625 |
| 94 | Ga0068858_101461249 | 3300005842 | Bacteria | 674 |
| 95 | Ga0068860_100014499 | 3300005843 | Bacteria | 7714 |
| 96 | Ga0068860_100034080 | 3300005843 | Bacteria | 4883 |
| 97 | Ga0068862_100014569 | 3300005844 | Bacteria | 6528 |
| 98 | Ga0075368_10120548 | 3300006042 | Bacteria | 1086 |
| 99 | Ga0075364_10146035 | 3300006051 | Bacteria | 1592 |
| 100 | Ga0070716_100482361 | 3300006173 | Bacteria | 911 |
| 101 | Ga0075362_10000766 | 3300006177 | Bacteria | 9569 |
| 102 | Ga0075362_10030335 | 3300006177 | Bacteria | 2335 |
| 103 | Ga0075367_10021765 | 3300006178 | Bacteria | 3588 |
| 104 | Ga0075367_10042138 | 3300006178 | Bacteria | 2670 |
| 105 | Ga0075367_10077658 | 3300006178 | Bacteria | 2005 |
| 106 | Ga0075369_10004800 | 3300006186 | Bacteria | 5026 |
| 107 | Ga0075366_10000673 | 3300006195 | Bacteria | 16127 |
| 108 | Ga0075366_10024219 | 3300006195 | Bacteria | 3541 |
| 109 | Ga0075366_10426888 | 3300006195 | Bacteria | 817 |
| 110 | Ga0097621_100005843 | 3300006237 | Bacteria | 8692 |
| 111 | Ga0097621_100100684 | 3300006237 | Bacteria | 2431 |
| 112 | Ga0097621_100207413 | 3300006237 | Bacteria | 1703 |
| 113 | Ga0075370_10000167 | 3300006353 | Bacteria | 22616 |
| 114 | Ga0075370_10001602 | 3300006353 | Bacteria | 9980 |
| 115 | Ga0075370_10087068 | 3300006353 | Bacteria | 1800 |
| 116 | Ga0068871_100086480 | 3300006358 | Bacteria | 2605 |
| 117 | Ga0068865_100031257 | 3300006881 | Bacteria | 3549 |
| 118 | Ga0097620_100059481 | 3300006931 | Bacteria | 3849 |
| 119 | Ga0097620_100098527 | 3300006931 | Bacteria | 2977 |
| 120 | Ga0105240_10004619 | 3300009093 | Bacteria | 20879 |
| 121 | Ga0111539_10654996 | 3300009094 | Bacteria | 1223 |
| 122 | Ga0105245_10001278 | 3300009098 | Bacteria | 22694 |
| 123 | Ga0114129_11553843 | 3300009147 | Bacteria | 811 |
| 124 | Ga0105243_10024526 | 3300009148 | Bacteria | 4600 |
| 125 | Ga0105243_10043131 | 3300009148 | Bacteria | 3535 |
| 126 | Ga0105243_10074563 | 3300009148 | Bacteria | 2752 |
| 127 | Ga0105243_10227152 | 3300009148 | Bacteria | 1654 |
| 128 | Ga0105243_10806944 | 3300009148 | Bacteria | 925 |
| 129 | Ga0105242_10021901 | 3300009176 | Bacteria | 5023 |
| 130 | Ga0105242_10058685 | 3300009176 | Bacteria | 3156 |
| 131 | Ga0105242_11080540 | 3300009176 | Bacteria | 815 |
| 132 | Ga0105248_10852450 | 3300009177 | Bacteria | 1028 |
| 133 | Ga0105237_10061045 | 3300009545 | Bacteria | 3770 |
| 134 | Ga0105237_10223900 | 3300009545 | Bacteria | 1881 |
| 135 | Ga0105249_10029780 | 3300009553 | Bacteria | 4932 |
| 136 | Ga0105249_10058080 | 3300009553 | Bacteria | 3546 |
| 137 | Ga0105249_11169257 | 3300009553 | Bacteria | 840 |
| 138 | Ga0105239_10026856 | 3300010375 | Bacteria | 6336 |
| 139 | Ga0105239_10067979 | 3300010375 | Bacteria | 3915 |
| 140 | Ga0157371_10376994 | 3300013102 | Bacteria | 1035 |
| 141 | Ga0157369_10556974 | 3300013105 | Bacteria | 1185 |
| 142 | Ga0157374_10276244 | 3300013296 | Bacteria | 1658 |
| 143 | Ga0157378_10010618 | 3300013297 | Bacteria | 8049 |
| 144 | Ga0157378_10518177 | 3300013297 | Bacteria | 1193 |
| 145 | Ga0163162_10009181 | 3300013306 | Bacteria | 9623 |
| 146 | Ga0163162_10113717 | 3300013306 | Bacteria | 2806 |
| 147 | Ga0163162_10496402 | 3300013306 | Bacteria | 1351 |
| 148 | Ga0163162_10650131 | 3300013306 | Bacteria | 1178 |
| 149 | Ga0157375_10015776 | 3300013308 | Bacteria | 6770 |
| 150 | Ga0157375_10024899 | 3300013308 | Bacteria | 5548 |
| 151 | Ga0157375_10039281 | 3300013308 | Bacteria | 4554 |
| 152 | Ga0163163_10347112 | 3300014325 | Bacteria | 1540 |
| 153 | Ga0157380_10011688 | 3300014326 | Bacteria | 6348 |
| 154 | Ga0157380_10031042 | 3300014326 | Bacteria | 4099 |
| 155 | Ga0157379_10017086 | 3300014968 | Bacteria | 6387 |
| 156 | Ga0157379_10108628 | 3300014968 | Bacteria | 2491 |
| 157 | Ga0157376_10720584 | 3300014969 | Bacteria | 1004 |
| 158 | Ga0163161_10017349 | 3300017792 | Bacteria | 5038 |
| 159 | Ga0163161_10377334 | 3300017792 | Bacteria | 1132 |
| 160 | Ga0163161_10652620 | 3300017792 | Bacteria | 872 |
| 161 | Ga0207666_1007034 | 3300025271 | Bacteria | 1472 |
| 162 | Ga0209051_1002574 | 3300025303 | Bacteria | 12777 |
| 163 | Ga0209051_1004247 | 3300025303 | Bacteria | 8926 |
| 164 | Ga0209257_1098525 | 3300025304 | Bacteria | 717 |
| 165 | Ga0207656_10095306 | 3300025321 | Bacteria | 1357 |
| 166 | Ga0207656_10306630 | 3300025321 | Bacteria | 787 |
| 167 | Ga0207682_10074524 | 3300025893 | Bacteria | 1443 |
| 168 | Ga0207682_10082870 | 3300025893 | Bacteria | 1378 |
| 169 | Ga0207642_10010087 | 3300025899 | Bacteria | 3313 |
| 170 | Ga0207642_10012923 | 3300025899 | Bacteria | 3029 |
| 171 | Ga0207688_10081357 | 3300025901 | Bacteria | 1850 |
| 172 | Ga0207688_10176792 | 3300025901 | Bacteria | 1271 |
| 173 | Ga0207680_10016228 | 3300025903 | Bacteria | 3905 |
| 174 | Ga0207645_10007602 | 3300025907 | Bacteria | 7638 |
| 175 | Ga0207645_10040637 | 3300025907 | Bacteria | 2979 |
| 176 | Ga0207643_10003209 | 3300025908 | Bacteria | 8811 |
| 177 | Ga0207643_10031468 | 3300025908 | Bacteria | 2958 |
| 178 | Ga0207707_10192524 | 3300025912 | Bacteria | 1779 |
| 179 | Ga0207695_10216235 | 3300025913 | Bacteria | 1825 |
| 180 | Ga0207671_10019714 | 3300025914 | Bacteria | 5151 |
| 181 | Ga0207671_10346966 | 3300025914 | Bacteria | 1177 |
| 182 | Ga0207662_10059408 | 3300025918 | Bacteria | 2291 |
| 183 | Ga0207652_10002539 | 3300025921 | Bacteria | 15323 |
| 184 | Ga0207681_10011771 | 3300025923 | Bacteria | 5381 |
| 185 | Ga0207681_10340857 | 3300025923 | Bacteria | 1197 |
| 186 | Ga0207650_10007691 | 3300025925 | Bacteria | 7340 |
| 187 | Ga0207650_10096119 | 3300025925 | Bacteria | 2272 |
| 188 | Ga0207650_10362409 | 3300025925 | Bacteria | 1194 |
| 189 | Ga0207650_10367434 | 3300025925 | Bacteria | 1186 |
| 190 | Ga0207659_10050556 | 3300025926 | Bacteria | 2953 |
| 191 | Ga0207659_10222695 | 3300025926 | Bacteria | 1518 |
| 192 | Ga0207659_10290174 | 3300025926 | Bacteria | 1340 |
| 193 | Ga0207687_10030625 | 3300025927 | Bacteria | 3629 |
| 194 | Ga0207644_10001435 | 3300025931 | Bacteria | 15350 |
| 195 | Ga0207644_10258179 | 3300025931 | Bacteria | 1392 |
| 196 | Ga0207690_10280831 | 3300025932 | Bacteria | 1297 |
| 197 | Ga0207690_10604058 | 3300025932 | Bacteria | 896 |
| 198 | Ga0207706_10000845 | 3300025933 | Bacteria | 31549 |
| 199 | Ga0207706_10021167 | 3300025933 | Bacteria | 5844 |
| 200 | Ga0207706_10113711 | 3300025933 | Bacteria | 2381 |
| 201 | Ga0207706_10687225 | 3300025933 | Bacteria | 875 |
| 202 | Ga0207686_10019153 | 3300025934 | Bacteria | 3887 |
| 203 | Ga0207686_10086564 | 3300025934 | Bacteria | 2058 |
| 204 | Ga0207686_10097221 | 3300025934 | Bacteria | 1958 |
| 205 | Ga0207709_10014445 | 3300025935 | Bacteria | 4361 |
| 206 | Ga0207709_10021946 | 3300025935 | Bacteria | 3618 |
| 207 | Ga0207709_10300056 | 3300025935 | Bacteria | 1194 |
| 208 | Ga0207709_10457692 | 3300025935 | Bacteria | 988 |
| 209 | Ga0207709_10521079 | 3300025935 | Bacteria | 930 |
| 210 | Ga0207670_10146931 | 3300025936 | Bacteria | 1744 |
| 211 | Ga0207669_10218690 | 3300025937 | Bacteria | 1396 |
| 212 | Ga0207704_10009470 | 3300025938 | Bacteria | 4701 |
| 213 | Ga0207704_10045846 | 3300025938 | Bacteria | 2600 |
| 214 | Ga0207665_10345241 | 3300025939 | Bacteria | 1123 |
| 215 | Ga0207691_10010194 | 3300025940 | Bacteria | 9015 |
| 216 | Ga0207691_10021773 | 3300025940 | Bacteria | 6051 |
| 217 | Ga0207691_10028125 | 3300025940 | Bacteria | 5266 |
| 218 | Ga0207691_10069901 | 3300025940 | Bacteria | 3171 |
| 219 | Ga0207691_10070074 | 3300025940 | Bacteria | 3167 |
| 220 | Ga0207691_10135301 | 3300025940 | Bacteria | 2174 |
| 221 | Ga0207691_10143124 | 3300025940 | Bacteria | 2106 |
| 222 | Ga0207691_10149866 | 3300025940 | Bacteria | 2051 |
| 223 | Ga0207691_10274034 | 3300025940 | Bacteria | 1452 |
| 224 | Ga0207711_10103709 | 3300025941 | Bacteria | 2519 |
| 225 | Ga0207711_10487187 | 3300025941 | Bacteria | 1149 |
| 226 | Ga0207711_10668795 | 3300025941 | Bacteria | 969 |
| 227 | Ga0207689_10005034 | 3300025942 | Bacteria | 11908 |
| 228 | Ga0207689_10015754 | 3300025942 | Bacteria | 6402 |
| 229 | Ga0207679_10801062 | 3300025945 | Bacteria | 859 |
| 230 | Ga0207651_10036901 | 3300025960 | Bacteria | 3196 |
| 231 | Ga0207651_10189531 | 3300025960 | Bacteria | 1639 |
| 232 | Ga0207651_10191647 | 3300025960 | Bacteria | 1631 |
| 233 | Ga0207651_10250122 | 3300025960 | Bacteria | 1450 |
| 234 | Ga0207651_10497733 | 3300025960 | Bacteria | 1053 |
| 235 | Ga0207651_10574790 | 3300025960 | Bacteria | 982 |
| 236 | Ga0207712_10068958 | 3300025961 | Bacteria | 2536 |
| 237 | Ga0207712_10740666 | 3300025961 | Bacteria | 860 |
| 238 | Ga0207668_10030247 | 3300025972 | Bacteria | 3557 |
| 239 | Ga0207668_10171801 | 3300025972 | Bacteria | 1701 |
| 240 | Ga0207668_10377747 | 3300025972 | Bacteria | 1192 |
| 241 | Ga0207640_10224264 | 3300025981 | Bacteria | 1441 |
| 242 | Ga0207658_10000959 | 3300025986 | Bacteria | 23778 |
| 243 | Ga0207658_10109869 | 3300025986 | Bacteria | 2177 |
| 244 | Ga0207658_11179249 | 3300025986 | Bacteria | 700 |
| 245 | Ga0207677_10087043 | 3300026023 | Bacteria | 2260 |
| 246 | Ga0207703_10035556 | 3300026035 | Bacteria | 3958 |
| 247 | Ga0207703_10038363 | 3300026035 | Bacteria | 3822 |
| 248 | Ga0207703_10718663 | 3300026035 | Bacteria | 951 |
| 249 | Ga0207639_10782098 | 3300026041 | Bacteria | 889 |
| 250 | Ga0207639_11007306 | 3300026041 | Bacteria | 780 |
| 251 | Ga0207708_10000767 | 3300026075 | Bacteria | 24167 |
| 252 | Ga0207708_10594943 | 3300026075 | Bacteria | 936 |
| 253 | Ga0207641_10029108 | 3300026088 | Bacteria | 4567 |
| 254 | Ga0207641_10085698 | 3300026088 | Bacteria | 2745 |
| 255 | Ga0207641_10342970 | 3300026088 | Bacteria | 1422 |
| 256 | Ga0207648_10003104 | 3300026089 | Bacteria | 17543 |
| 257 | Ga0207648_10005079 | 3300026089 | Bacteria | 13337 |
| 258 | Ga0207648_10112167 | 3300026089 | Bacteria | 2394 |
| 259 | Ga0207648_10126487 | 3300026089 | Bacteria | 2248 |
| 260 | Ga0207648_10218751 | 3300026089 | Bacteria | 1692 |
| 261 | Ga0207648_10365619 | 3300026089 | Bacteria | 1302 |
| 262 | Ga0207676_10019189 | 3300026095 | Bacteria | 4983 |
| 263 | Ga0207676_10070617 | 3300026095 | Bacteria | 2801 |
| 264 | Ga0207676_10208702 | 3300026095 | Bacteria | 1731 |
| 265 | Ga0207676_10232318 | 3300026095 | Bacteria | 1649 |
| 266 | Ga0207674_10027378 | 3300026116 | Bacteria | 6032 |
| 267 | Ga0207674_10205482 | 3300026116 | Bacteria | 1919 |
| 268 | Ga0207675_100002571 | 3300026118 | Bacteria | 17972 |
| 269 | Ga0207675_100004297 | 3300026118 | Bacteria | 13767 |
| 270 | Ga0207683_10014677 | 3300026121 | Bacteria | 6671 |
| 271 | Ga0207683_10029024 | 3300026121 | Bacteria | 4788 |
| 272 | Ga0207683_10040448 | 3300026121 | Bacteria | 4068 |
| 273 | Ga0207683_10092858 | 3300026121 | Bacteria | 2689 |
| 274 | Ga0207683_10137739 | 3300026121 | Bacteria | 2198 |
| 275 | Ga0207698_10001243 | 3300026142 | Bacteria | 14895 |
| 276 | Ga0207698_10017788 | 3300026142 | Bacteria | 4831 |
| 277 | Ga0207698_10083685 | 3300026142 | Bacteria | 2583 |
| 278 | Ga0207698_10385048 | 3300026142 | Bacteria | 1335 |
| 279 | Ga0207698_10422524 | 3300026142 | Bacteria | 1279 |
| 280 | Ga0207698_10603726 | 3300026142 | Bacteria | 1082 |
| 281 | Ga0209813_10117407 | 3300027866 | Bacteria | 923 |
| 282 | Ga0268265_10054973 | 3300028380 | Bacteria | 3023 |
| 283 | Ga0268264_10011851 | 3300028381 | Bacteria | 7185 |
| 284 | Ga0268264_10398200 | 3300028381 | Bacteria | 1322 |
| 285 | Ga0268264_10718574 | 3300028381 | Bacteria | 993 |
| 286 | Ga0307517_10315753 | 3300028786 | Bacteria | 867 |
| 287 | Ga0307515_10000020 | 3300028794 | Bacteria | 411735 |
| 288 | Ga0307515_10000053 | 3300028794 | Bacteria | 266512 |
| 289 | Ga0307515_10006495 | 3300028794 | Bacteria | 23397 |
| 290 | Ga0307515_10117949 | 3300028794 | Bacteria | 3033 |
| 291 | Ga0307513_10006695 | 3300031456 | Bacteria | 15034 |
| 292 | Ga0307513_10059231 | 3300031456 | Bacteria | 4065 |
| 293 | Ga0307513_10379345 | 3300031456 | Bacteria | 1154 |
| 294 | Ga0307509_10001851 | 3300031507 | Bacteria | 34975 |
| 295 | Ga0307408_100401301 | 3300031548 | Bacteria | 1177 |
| 296 | Ga0307508_10004920 | 3300031616 | Bacteria | 12859 |
| 297 | Ga0307514_10117885 | 3300031649 | Bacteria | 1861 |
| 298 | Ga0307516_10003104 | 3300031730 | Bacteria | 21606 |
| 299 | Ga0307516_10096888 | 3300031730 | Bacteria | 2770 |
| 300 | Ga0307405_10236260 | 3300031731 | Bacteria | 1351 |
| 301 | Ga0307413_10000382 | 3300031824 | Bacteria | 14204 |
| 302 | Ga0307518_10094086 | 3300031838 | Bacteria | 2153 |
| 303 | Ga0307410_10214634 | 3300031852 | Bacteria | 1476 |
| 304 | Ga0307407_10553340 | 3300031903 | Bacteria | 851 |
| 305 | Ga0307409_100110678 | 3300031995 | Bacteria | 2302 |
| 306 | Ga0307409_100297948 | 3300031995 | Bacteria | 1499 |
| 307 | Ga0307416_100464965 | 3300032002 | Bacteria | 1321 |
| 308 | Ga0307414_10400247 | 3300032004 | Bacteria | 1192 |
| 309 | Ga0307411_10046325 | 3300032005 | Bacteria | 2802 |
| 310 | Ga0307411_10075658 | 3300032005 | Bacteria | 2299 |
| 311 | Ga0307510_10009361 | 3300033180 | Bacteria | 11669 |
| 312 | Ga0373932_0009360 | 3300035112 | Bacteria | 2355 |
| 313 | Ga0373956_0217390 | 3300035119 | Bacteria | 907 |
| 314 | Ga0373943_0148064 | 3300035170 | Bacteria | 1270 |
| 315 | Ga0373946_0190814 | 3300035171 | Bacteria | 977 |
| 316 | Ga0373962_0071781 | 3300035242 | Bacteria | 1036 |
| 317 | Ga0373927_0231145 | 3300035695 | Bacteria | 1215 |
| 318 | Ga0373937_0122739 | 3300036401 | Bacteria | 2422 |
| 319 | Ga0373937_0184879 | 3300036401 | Bacteria | 1957 |
| 320 | Ga0373925_0058875 | 3300037068 | Bacteria | 2881 |
| 321 | Ga0373925_0404107 | 3300037068 | Bacteria | 1114 |
| 322 | Ga0395905_0071619 | 3300037471 | Bacteria | 3249 |
| 323 | Ga0395905_0104710 | 3300037471 | Bacteria | 2656 |
| 324 | Ga0395905_0148998 | 3300037471 | Bacteria | 2201 |
| 325 | Ga0451793_0570148 | 3300041452 | Bacteria | 767 |
| 326 | Ga0451577_0026925 | 3300042876 | Bacteria | 5205 |
| 327 | Ga0466969_0000385 | 3300044656 | Bacteria | 24302 |
| 328 | Ga0466972_0050146 | 3300044658 | Bacteria | 2015 |
| 329 | Ga0453683_0308144 | 3300044673 | Bacteria | 1013 |
| 330 | Ga0453684_0061734 | 3300044712 | Bacteria | 4808 |
| 331 | Ga0453684_0464706 | 3300044712 | Bacteria | 1406 |
| 332 | Ga0466970_0149302 | 3300044765 | Bacteria | 1290 |
| 333 | Ga0466960_0120325 | 3300044901 | Bacteria | 1374 |
| 334 | Ga0466959_0056397 | 3300045049 | Bacteria | 2866 |
| 335 | Ga0451576_0002187 | 3300045051 | Bacteria | 30196 |
| 336 | Ga0451576_0168520 | 3300045051 | Bacteria | 2285 |
| 337 | Ga0495592_0000028 | 3300046454 | Bacteria | 132590 |
| 338 | Ga0495590_0003199 | 3300046457 | Bacteria | 6694 |
| 339 | Ga0495629_0063966 | 3300046459 | Bacteria | 2569 |
| 340 | Ga0495629_0426595 | 3300046459 | Bacteria | 899 |
| 341 | Ga0495629_0723868 | 3300046459 | Bacteria | 660 |
| 342 | Ga0495605_0154693 | 3300046474 | Bacteria | 1021 |
| 343 | Ga0495664_0405456 | 3300046477 | Bacteria | 818 |
| 344 | Ga0495620_0212672 | 3300046515 | Bacteria | 741 |
| 345 | Ga0495628_0590250 | 3300046516 | Bacteria | 794 |
| 346 | Ga0495632_0049793 | 3300046519 | Bacteria | 2069 |
| 347 | Ga0495642_0018831 | 3300046528 | Bacteria | 2704 |
| 348 | Ga0495586_0315633 | 3300046535 | Bacteria | 896 |
| 349 | Ga0495621_0023670 | 3300046539 | Bacteria | 2044 |
| 350 | Ga0495645_0042282 | 3300046543 | Bacteria | 3323 |
| 351 | Ga0495645_0103562 | 3300046543 | Bacteria | 2022 |
| 352 | Ga0495668_0020830 | 3300046616 | Bacteria | 3766 |
| 353 | Ga0495668_0330294 | 3300046616 | Bacteria | 836 |
| 354 | Ga0495611_0089374 | 3300046648 | Bacteria | 1423 |
| 355 | Ga0495647_0009507 | 3300046681 | Bacteria | 3296 |
| 356 | Ga0495658_0075594 | 3300046683 | Bacteria | 1966 |
| 357 | Ga0495624_0016781 | 3300046690 | Bacteria | 4928 |
| 358 | Ga0495649_0001518 | 3300046694 | Bacteria | 17442 |
| 359 | Ga0495674_0265755 | 3300047319 | Bacteria | 1409 |
| 360 | Ga0495676_0038527 | 3300047321 | Bacteria | 3969 |
| 361 | Ga0495684_0091526 | 3300047471 | Bacteria | 2304 |
| 362 | Ga0495686_0083884 | 3300047472 | Bacteria | 1943 |
| 363 | Ga0495593_0019598 | 3300047673 | Bacteria | 3792 |
| 364 | Ga0495626_0061141 | 3300048091 | Bacteria | 1714 |
| 365 | Ga0496101_0566805 | 3300048904 | Bacteria | 898 |
| 366 | Ga0496102_0002801 | 3300048905 | Bacteria | 14872 |
| 367 | Ga0496108_0080372 | 3300048911 | Bacteria | 2761 |
| 368 | Ga0496109_0081688 | 3300048912 | Bacteria | 2978 |
| 369 | Ga0496110_0783820 | 3300048913 | Bacteria | 857 |
| 370 | Ga0496114_0294840 | 3300048917 | Bacteria | 1431 |
| 371 | Ga0496124_0000317 | 3300048927 | Bacteria | 89188 |
| 372 | Ga0496125_0009263 | 3300048928 | Bacteria | 10166 |
| 373 | Ga0501034_0000406 | 3300049571 | Bacteria | 72755 |
| 374 | Ga0501034_0095781 | 3300049571 | Bacteria | 2964 |
| 375 | Ga0501043_0000004 | 3300049579 | Bacteria | 291085 |
| 376 | Ga0501046_0000016 | 3300049580 | Bacteria | 234374 |
| 377 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 378 | Ga0501048_0007739 | 3300049582 | Bacteria | 8144 |
| 379 | Ga0501068_0000303 | 3300049584 | Bacteria | 24685 |
| 380 | Ga0501072_0004011 | 3300049588 | Bacteria | 11140 |
| 381 | Ga0501073_0017254 | 3300049589 | Bacteria | 5229 |
| 382 | Ga0501080_0114322 | 3300049742 | Bacteria | 2502 |
| 383 | Ga0501080_0200616 | 3300049742 | Bacteria | 1832 |
| 384 | Ga0501282_010596 | 3300049778 | Bacteria | 990 |
| 385 | nmdc:mga03683_306291_c1 | 3300050489 | Bacteria | 746 |
| 386 | nmdc:mga03683_59257_c1 | 3300050489 | Bacteria | 1615 |
| 387 | nmdc:mga03n38_399951_c1 | 3300050490 | Bacteria | 756 |
| 388 | nmdc:mga00v17_82966_c1 | 3300050491 | Bacteria | 2004 |
| 389 | nmdc:mga0k408_101244_c1 | 3300050493 | Bacteria | 1699 |
| 390 | nmdc:mga0k408_1729_c1 | 3300050493 | Bacteria | 11722 |
| 391 | nmdc:mga0k408_2776_c1 | 3300050493 | Bacteria | 9308 |
| 392 | nmdc:mga0k408_28506_c1 | 3300050493 | Bacteria | 3175 |
| 393 | nmdc:mga0k408_5832_c1 | 3300050493 | Bacteria | 6562 |
| 394 | nmdc:mga0k408_6487_c1 | 3300050493 | Bacteria | 6236 |
| 395 | nmdc:mga0k408_732_c1 | 3300050493 | Bacteria | 18001 |
| 396 | nmdc:mga0k408_82661_c1 | 3300050493 | Bacteria | 1882 |
| 397 | nmdc:mga06z11_105485_c1 | 3300050494 | Bacteria | 1553 |
| 398 | nmdc:mga06z11_123048_c1 | 3300050494 | Bacteria | 1449 |
| 399 | nmdc:mga06z11_43994_c1 | 3300050494 | Bacteria | 2250 |
| 400 | nmdc:mga07m45_13775_c1 | 3300050496 | Bacteria | 4295 |
| 401 | nmdc:mga07m45_1544_c1 | 3300050496 | Bacteria | 10590 |
| 402 | nmdc:mga07m45_434_c1 | 3300050496 | Bacteria | 17366 |
| 403 | nmdc:mga07m45_46676_c1 | 3300050496 | Bacteria | 2434 |
| 404 | nmdc:mga07m45_75677_c1 | 3300050496 | Bacteria | 1919 |
| 405 | nmdc:mga08y16_640133_c1 | 3300050511 | Bacteria | 1068 |
| 406 | Ga0495601_0031942 | 3300053077 | Bacteria | 3275 |
| 407 | Ga0495595_0012992 | 3300053084 | Bacteria | 3513 |
| 408 | Ga0495619_0046311 | 3300053085 | Bacteria | 2859 |
| 409 | Ga0500644_0022549 | 3300053088 | Bacteria | 1900 |
| 410 | Ga0500651_0006242 | 3300053093 | Bacteria | 6859 |
| 411 | Ga0500651_0088952 | 3300053093 | Bacteria | 1904 |
| 412 | Ga0500652_051194 | 3300053131 | Bacteria | 1687 |
| 413 | Ga0500658_0003009 | 3300053134 | Bacteria | 6470 |
| 414 | Ga0500559_0002434 | 3300053136 | Bacteria | 9633 |
| 415 | Ga0500568_0036624 | 3300053139 | Bacteria | 1995 |
| 416 | Ga0500622_0004444 | 3300053156 | Bacteria | 8804 |
| 417 | Ga0501084_0175005 | 3300054114 | Bacteria | 1811 |
| 418 | Ga0590071_000859 | 3300059421 | Bacteria | 8461 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026041 | Ga0207639_10782098 | Ga0207639_107820982 | 176 |
| 2 | 3300005445 | Ga0070708_100000040 | Ga0070708_10000004043 | 182 |
| 3 | 3300025321 | Ga0207656_10095306 | Ga0207656_100953062 | 183 |
| 4 | 3300009553 | Ga0105249_11169257 | Ga0105249_111692572 | 184 |
| 5 | 3300025918 | Ga0207662_10059408 | Ga0207662_100594082 | 184 |
| 6 | 3300025961 | Ga0207712_10740666 | Ga0207712_107406662 | 184 |
| 7 | 3300005353 | Ga0070669_100306118 | Ga0070669_1003061182 | 190 |
| 8 | 3300026142 | Ga0207698_10001243 | Ga0207698_100012435 | 193 |
| 9 | 3300037471 | Ga0395905_0104710 | Ga0395905_0104710_890_1471 | 193 |
| 10 | 3300049778 | Ga0501282_010596 | Ga0501282_010596_127_708 | 193 |
| 11 | 3300005841 | Ga0068863_100273414 | Ga0068863_1002734142 | 194 |
| 12 | 3300013297 | Ga0157378_10518177 | Ga0157378_105181772 | 194 |
| 13 | 3300025271 | Ga0207666_1007034 | Ga0207666_10070341 | 194 |
| 14 | 3300045051 | Ga0451576_0002187 | Ga0451576_0002187_14909_15493 | 194 |
| 15 | 3300050493 | nmdc:mga0k408_5832_c1 | nmdc:mga0k408_5832_c1_5629_6213 | 194 |
| 16 | 3300005330 | Ga0070690_100029058 | Ga0070690_1000290583 | 195 |
| 17 | 3300005334 | Ga0068869_100046053 | Ga0068869_1000460534 | 195 |
| 18 | 3300005336 | Ga0070680_100149072 | Ga0070680_1001490723 | 195 |
| 19 | 3300005340 | Ga0070689_100009503 | Ga0070689_1000095035 | 195 |
| 20 | 3300005341 | Ga0070691_10043452 | Ga0070691_100434523 | 195 |
| 21 | 3300005345 | Ga0070692_10262172 | Ga0070692_102621723 | 195 |
| 22 | 3300005440 | Ga0070705_100373752 | Ga0070705_1003737521 | 195 |
| 23 | 3300005441 | Ga0070700_100005633 | Ga0070700_1000056335 | 195 |
| 24 | 3300005444 | Ga0070694_100110885 | Ga0070694_1001108853 | 195 |
| 25 | 3300005544 | Ga0070686_100021059 | Ga0070686_1000210593 | 195 |
| 26 | 3300005545 | Ga0070695_100072495 | Ga0070695_1000724954 | 195 |
| 27 | 3300005549 | Ga0070704_100803639 | Ga0070704_1008036392 | 195 |
| 28 | 3300005615 | Ga0070702_100006482 | Ga0070702_1000064824 | 195 |
| 29 | 3300005617 | Ga0068859_100059484 | Ga0068859_1000594842 | 195 |
| 30 | 3300005718 | Ga0068866_10002667 | Ga0068866_100026674 | 195 |
| 31 | 3300005719 | Ga0068861_100014098 | Ga0068861_1000140983 | 195 |
| 32 | 3300005840 | Ga0068870_10009162 | Ga0068870_100091625 | 195 |
| 33 | 3300005842 | Ga0068858_100011483 | Ga0068858_1000114835 | 195 |
| 34 | 3300005843 | Ga0068860_100034080 | Ga0068860_1000340805 | 195 |
| 35 | 3300005844 | Ga0068862_100014569 | Ga0068862_1000145695 | 195 |
| 36 | 3300006195 | Ga0075366_10000673 | Ga0075366_100006732 | 195 |
| 37 | 3300006237 | Ga0097621_100005843 | Ga0097621_1000058436 | 195 |
| 38 | 3300006881 | Ga0068865_100031257 | Ga0068865_1000312573 | 195 |
| 39 | 3300006931 | Ga0097620_100059481 | Ga0097620_1000594812 | 195 |
| 40 | 3300009093 | Ga0105240_10004619 | Ga0105240_1000461918 | 195 |
| 41 | 3300009098 | Ga0105245_10001278 | Ga0105245_100012783 | 195 |
| 42 | 3300009147 | Ga0114129_11553843 | Ga0114129_115538431 | 195 |
| 43 | 3300009148 | Ga0105243_10024526 | Ga0105243_100245263 | 195 |
| 44 | 3300009176 | Ga0105242_10021901 | Ga0105242_100219015 | 195 |
| 45 | 3300009545 | Ga0105237_10223900 | Ga0105237_102239002 | 195 |
| 46 | 3300009553 | Ga0105249_10058080 | Ga0105249_100580802 | 195 |
| 47 | 3300010375 | Ga0105239_10026856 | Ga0105239_100268565 | 195 |
| 48 | 3300013297 | Ga0157378_10010618 | Ga0157378_100106184 | 195 |
| 49 | 3300014326 | Ga0157380_10011688 | Ga0157380_100116885 | 195 |
| 50 | 3300017792 | Ga0163161_10652620 | Ga0163161_106526202 | 195 |
| 51 | 3300025899 | Ga0207642_10012923 | Ga0207642_100129233 | 195 |
| 52 | 3300025908 | Ga0207643_10003209 | Ga0207643_100032093 | 195 |
| 53 | 3300025913 | Ga0207695_10216235 | Ga0207695_102162352 | 195 |
| 54 | 3300025914 | Ga0207671_10019714 | Ga0207671_100197145 | 195 |
| 55 | 3300025927 | Ga0207687_10030625 | Ga0207687_100306254 | 195 |
| 56 | 3300025934 | Ga0207686_10019153 | Ga0207686_100191533 | 195 |
| 57 | 3300025935 | Ga0207709_10457692 | Ga0207709_104576921 | 195 |
| 58 | 3300025936 | Ga0207670_10146931 | Ga0207670_101469311 | 195 |
| 59 | 3300025938 | Ga0207704_10009470 | Ga0207704_100094704 | 195 |
| 60 | 3300025942 | Ga0207689_10005034 | Ga0207689_100050345 | 195 |
| 61 | 3300025981 | Ga0207640_10224264 | Ga0207640_102242643 | 195 |
| 62 | 3300026035 | Ga0207703_10038363 | Ga0207703_100383635 | 195 |
| 63 | 3300026075 | Ga0207708_10000767 | Ga0207708_100007675 | 195 |
| 64 | 3300026089 | Ga0207648_10003104 | Ga0207648_100031045 | 195 |
| 65 | 3300026118 | Ga0207675_100002571 | Ga0207675_10000257118 | 195 |
| 66 | 3300028381 | Ga0268264_10718574 | Ga0268264_107185741 | 195 |
| 67 | 3300031649 | Ga0307514_10117885 | Ga0307514_101178852 | 195 |
| 68 | 3300031838 | Ga0307518_10094086 | Ga0307518_100940863 | 195 |
| 69 | 3300037471 | Ga0395905_0148998 | Ga0395905_0148998_25_612 | 195 |
| 70 | 3300044658 | Ga0466972_0050146 | Ga0466972_0050146_170_757 | 195 |
| 71 | 3300044901 | Ga0466960_0120325 | Ga0466960_0120325_435_1022 | 195 |
| 72 | 3300047472 | Ga0495686_0083884 | Ga0495686_0083884_1107_1694 | 195 |
| 73 | 3300049571 | Ga0501034_0000406 | Ga0501034_0000406_29026_29619 | 195 |
| 74 | 3300049571 | Ga0501034_0095781 | Ga0501034_0095781_207_800 | 195 |
| 75 | 3300049584 | Ga0501068_0000303 | Ga0501068_0000303_20099_20692 | 195 |
| 76 | 3300049588 | Ga0501072_0004011 | Ga0501072_0004011_10509_11102 | 195 |
| 77 | 3300049589 | Ga0501073_0017254 | Ga0501073_0017254_1593_2186 | 195 |
| 78 | 3300049742 | Ga0501080_0114322 | Ga0501080_0114322_1773_2366 | 195 |
| 79 | 3300049742 | Ga0501080_0200616 | Ga0501080_0200616_1209_1802 | 195 |
| 80 | 3300050493 | nmdc:mga0k408_101244_c1 | nmdc:mga0k408_101244_c1_824_1411 | 195 |
| 81 | 3300054114 | Ga0501084_0175005 | Ga0501084_0175005_1056_1649 | 195 |
| 82 | 3300005356 | Ga0070674_100168973 | Ga0070674_1001689733 | 196 |
| 83 | 3300025908 | Ga0207643_10031468 | Ga0207643_100314683 | 196 |
| 84 | 3300026121 | Ga0207683_10014677 | Ga0207683_100146773 | 196 |
| 85 | 3300028794 | Ga0307515_10117949 | Ga0307515_101179492 | 196 |
| 86 | 3300031456 | Ga0307513_10006695 | Ga0307513_1000669510 | 196 |
| 87 | 3300031730 | Ga0307516_10003104 | Ga0307516_100031049 | 196 |
| 88 | 3300031731 | Ga0307405_10236260 | Ga0307405_102362602 | 196 |
| 89 | 3300032002 | Ga0307416_100464965 | Ga0307416_1004649652 | 196 |
| 90 | 3300032005 | Ga0307411_10075658 | Ga0307411_100756583 | 196 |
| 91 | 3300044712 | Ga0453684_0464706 | Ga0453684_0464706_252_842 | 196 |
| 92 | 3300048927 | Ga0496124_0000317 | Ga0496124_0000317_10070_10660 | 196 |
| 93 | 3300048928 | Ga0496125_0009263 | Ga0496125_0009263_7789_8379 | 196 |
| 94 | 3300005367 | Ga0070667_100001171 | Ga0070667_10000117121 | 197 |
| 95 | 3300013308 | Ga0157375_10039281 | Ga0157375_100392815 | 197 |
| 96 | 3300014968 | Ga0157379_10108628 | Ga0157379_101086282 | 197 |
| 97 | 3300025986 | Ga0207658_10000959 | Ga0207658_1000095921 | 197 |
| 98 | 3300028794 | Ga0307515_10000020 | Ga0307515_10000020303 | 197 |
| 99 | 3300035112 | Ga0373932_0009360 | Ga0373932_0009360_339_932 | 197 |
| 100 | 3300035242 | Ga0373962_0071781 | Ga0373962_0071781_400_993 | 197 |
| 101 | 3300037068 | Ga0373925_0404107 | Ga0373925_0404107_106_711 | 197 |
| 102 | 3300046459 | Ga0495629_0063966 | Ga0495629_0063966_398_991 | 197 |
| 103 | 3300046459 | Ga0495629_0723868 | Ga0495629_0723868_34_627 | 197 |
| 104 | 3300046516 | Ga0495628_0590250 | Ga0495628_0590250_30_623 | 197 |
| 105 | 3300046690 | Ga0495624_0016781 | Ga0495624_0016781_1553_2146 | 197 |
| 106 | 3300047321 | Ga0495676_0038527 | Ga0495676_0038527_104_697 | 197 |
| 107 | 3300047673 | Ga0495593_0019598 | Ga0495593_0019598_593_1186 | 197 |
| 108 | 3300005616 | Ga0068852_100444406 | Ga0068852_1004444062 | 198 |
| 109 | 3300013306 | Ga0163162_10650131 | Ga0163162_106501312 | 198 |
| 110 | 3300025303 | Ga0209051_1004247 | Ga0209051_10042475 | 198 |
| 111 | 3300025933 | Ga0207706_10000845 | Ga0207706_1000084514 | 198 |
| 112 | 3300025986 | Ga0207658_11179249 | Ga0207658_111792491 | 198 |
| 113 | 3300026142 | Ga0207698_10385048 | Ga0207698_103850482 | 198 |
| 114 | 3300031456 | Ga0307513_10379345 | Ga0307513_103793452 | 198 |
| 115 | 3300031507 | Ga0307509_10001851 | Ga0307509_1000185118 | 198 |
| 116 | 3300031616 | Ga0307508_10004920 | Ga0307508_100049208 | 198 |
| 117 | 3300033180 | Ga0307510_10009361 | Ga0307510_100093614 | 198 |
| 118 | 3300042876 | Ga0451577_0026925 | Ga0451577_0026925_1982_2584 | 198 |
| 119 | 3300044673 | Ga0453683_0308144 | Ga0453683_0308144_318_920 | 198 |
| 120 | 3300044712 | Ga0453684_0061734 | Ga0453684_0061734_1407_2009 | 198 |
| 121 | 3300045051 | Ga0451576_0168520 | Ga0451576_0168520_726_1328 | 198 |
| 122 | 3300046454 | Ga0495592_0000028 | Ga0495592_0000028_40482_41090 | 198 |
| 123 | 3300046515 | Ga0495620_0212672 | Ga0495620_0212672_110_706 | 198 |
| 124 | 3300053088 | Ga0500644_0022549 | Ga0500644_0022549_727_1323 | 198 |
| 125 | 3300053093 | Ga0500651_0006242 | Ga0500651_0006242_2894_3490 | 198 |
| 126 | 3300053093 | Ga0500651_0088952 | Ga0500651_0088952_1076_1684 | 198 |
| 127 | 3300053136 | Ga0500559_0002434 | Ga0500559_0002434_4310_4906 | 198 |
| 128 | 3300053156 | Ga0500622_0004444 | Ga0500622_0004444_7904_8500 | 198 |
| 129 | 3300005331 | Ga0070670_100003129 | Ga0070670_10000312915 | 199 |
| 130 | 3300005353 | Ga0070669_100021017 | Ga0070669_1000210173 | 199 |
| 131 | 3300005354 | Ga0070675_100007695 | Ga0070675_10000769510 | 199 |
| 132 | 3300005364 | Ga0070673_100022540 | Ga0070673_1000225403 | 199 |
| 133 | 3300005364 | Ga0070673_100054663 | Ga0070673_1000546634 | 199 |
| 134 | 3300005456 | Ga0070678_100022866 | Ga0070678_1000228663 | 199 |
| 135 | 3300005457 | Ga0070662_100448923 | Ga0070662_1004489232 | 199 |
| 136 | 3300005543 | Ga0070672_100002003 | Ga0070672_10000200311 | 199 |
| 137 | 3300005543 | Ga0070672_100038231 | Ga0070672_1000382313 | 199 |
| 138 | 3300005564 | Ga0070664_100458489 | Ga0070664_1004584892 | 199 |
| 139 | 3300005841 | Ga0068863_100342953 | Ga0068863_1003429532 | 199 |
| 140 | 3300006237 | Ga0097621_100100684 | Ga0097621_1001006842 | 199 |
| 141 | 3300006353 | Ga0075370_10001602 | Ga0075370_100016029 | 199 |
| 142 | 3300006353 | Ga0075370_10087068 | Ga0075370_100870683 | 199 |
| 143 | 3300009094 | Ga0111539_10654996 | Ga0111539_106549962 | 199 |
| 144 | 3300014325 | Ga0163163_10347112 | Ga0163163_103471122 | 199 |
| 145 | 3300025303 | Ga0209051_1002574 | Ga0209051_10025747 | 199 |
| 146 | 3300025304 | Ga0209257_1098525 | Ga0209257_10985251 | 199 |
| 147 | 3300025925 | Ga0207650_10362409 | Ga0207650_103624092 | 199 |
| 148 | 3300025925 | Ga0207650_10367434 | Ga0207650_103674342 | 199 |
| 149 | 3300025926 | Ga0207659_10290174 | Ga0207659_102901742 | 199 |
| 150 | 3300025933 | Ga0207706_10687225 | Ga0207706_106872252 | 199 |
| 151 | 3300025940 | Ga0207691_10010194 | Ga0207691_100101942 | 199 |
| 152 | 3300025940 | Ga0207691_10021773 | Ga0207691_100217736 | 199 |
| 153 | 3300025941 | Ga0207711_10668795 | Ga0207711_106687951 | 199 |
| 154 | 3300025945 | Ga0207679_10801062 | Ga0207679_108010622 | 199 |
| 155 | 3300025960 | Ga0207651_10189531 | Ga0207651_101895312 | 199 |
| 156 | 3300025960 | Ga0207651_10191647 | Ga0207651_101916472 | 199 |
| 157 | 3300025960 | Ga0207651_10497733 | Ga0207651_104977332 | 199 |
| 158 | 3300026088 | Ga0207641_10342970 | Ga0207641_103429702 | 199 |
| 159 | 3300026095 | Ga0207676_10070617 | Ga0207676_100706173 | 199 |
| 160 | 3300026121 | Ga0207683_10029024 | Ga0207683_100290243 | 199 |
| 161 | 3300028794 | Ga0307515_10000053 | Ga0307515_10000053104 | 199 |
| 162 | 3300037471 | Ga0395905_0071619 | Ga0395905_0071619_1183_1782 | 199 |
| 163 | 3300044656 | Ga0466969_0000385 | Ga0466969_0000385_16279_16878 | 199 |
| 164 | 3300044765 | Ga0466970_0149302 | Ga0466970_0149302_368_967 | 199 |
| 165 | 3300045049 | Ga0466959_0056397 | Ga0466959_0056397_517_1116 | 199 |
| 166 | 3300046539 | Ga0495621_0023670 | Ga0495621_0023670_87_689 | 199 |
| 167 | 3300048905 | Ga0496102_0002801 | Ga0496102_0002801_2405_3004 | 199 |
| 168 | 3300048911 | Ga0496108_0080372 | Ga0496108_0080372_916_1515 | 199 |
| 169 | 3300048912 | Ga0496109_0081688 | Ga0496109_0081688_2176_2775 | 199 |
| 170 | 3300049579 | Ga0501043_0000004 | Ga0501043_0000004_137990_138589 | 199 |
| 171 | 3300049580 | Ga0501046_0000016 | Ga0501046_0000016_153247_153846 | 199 |
| 172 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_152927_153526 | 199 |
| 173 | 3300049582 | Ga0501048_0007739 | Ga0501048_0007739_52_651 | 199 |
| 174 | 3300050493 | nmdc:mga0k408_82661_c1 | nmdc:mga0k408_82661_c1_307_924 | 199 |
| 175 | 3300005338 | Ga0068868_100594017 | Ga0068868_1005940172 | 200 |
| 176 | 3300005364 | Ga0070673_100441904 | Ga0070673_1004419042 | 200 |
| 177 | 3300005366 | Ga0070659_100287722 | Ga0070659_1002877222 | 200 |
| 178 | 3300005455 | Ga0070663_100249969 | Ga0070663_1002499692 | 200 |
| 179 | 3300005457 | Ga0070662_100219943 | Ga0070662_1002199431 | 200 |
| 180 | 3300005539 | Ga0068853_100157319 | Ga0068853_1001573192 | 200 |
| 181 | 3300005577 | Ga0068857_100068142 | Ga0068857_1000681423 | 200 |
| 182 | 3300005578 | Ga0068854_100066703 | Ga0068854_1000667031 | 200 |
| 183 | 3300005616 | Ga0068852_100199735 | Ga0068852_1001997352 | 200 |
| 184 | 3300005842 | Ga0068858_101461249 | Ga0068858_1014612491 | 200 |
| 185 | 3300006051 | Ga0075364_10146035 | Ga0075364_101460352 | 200 |
| 186 | 3300006177 | Ga0075362_10030335 | Ga0075362_100303352 | 200 |
| 187 | 3300006178 | Ga0075367_10042138 | Ga0075367_100421382 | 200 |
| 188 | 3300006178 | Ga0075367_10077658 | Ga0075367_100776582 | 200 |
| 189 | 3300006195 | Ga0075366_10024219 | Ga0075366_100242193 | 200 |
| 190 | 3300006195 | Ga0075366_10426888 | Ga0075366_104268882 | 200 |
| 191 | 3300006353 | Ga0075370_10000167 | Ga0075370_1000016715 | 200 |
| 192 | 3300009148 | Ga0105243_10074563 | Ga0105243_100745632 | 200 |
| 193 | 3300009545 | Ga0105237_10061045 | Ga0105237_100610454 | 200 |
| 194 | 3300010375 | Ga0105239_10067979 | Ga0105239_100679793 | 200 |
| 195 | 3300025914 | Ga0207671_10346966 | Ga0207671_103469662 | 200 |
| 196 | 3300025932 | Ga0207690_10604058 | Ga0207690_106040581 | 200 |
| 197 | 3300025933 | Ga0207706_10113711 | Ga0207706_101137113 | 200 |
| 198 | 3300025935 | Ga0207709_10300056 | Ga0207709_103000562 | 200 |
| 199 | 3300025972 | Ga0207668_10377747 | Ga0207668_103777471 | 200 |
| 200 | 3300026035 | Ga0207703_10718663 | Ga0207703_107186631 | 200 |
| 201 | 3300026041 | Ga0207639_11007306 | Ga0207639_110073062 | 200 |
| 202 | 3300026089 | Ga0207648_10218751 | Ga0207648_102187512 | 200 |
| 203 | 3300026116 | Ga0207674_10027378 | Ga0207674_100273783 | 200 |
| 204 | 3300026142 | Ga0207698_10422524 | Ga0207698_104225242 | 200 |
| 205 | 3300027866 | Ga0209813_10117407 | Ga0209813_101174072 | 200 |
| 206 | 3300028786 | Ga0307517_10315753 | Ga0307517_103157532 | 200 |
| 207 | 3300050489 | nmdc:mga03683_59257_c1 | nmdc:mga03683_59257_c1_301_903 | 200 |
| 208 | 3300050490 | nmdc:mga03n38_399951_c1 | nmdc:mga03n38_399951_c1_128_730 | 200 |
| 209 | 3300050491 | nmdc:mga00v17_82966_c1 | nmdc:mga00v17_82966_c1_534_1136 | 200 |
| 210 | 3300050493 | nmdc:mga0k408_2776_c1 | nmdc:mga0k408_2776_c1_1028_1642 | 200 |
| 211 | 3300050493 | nmdc:mga0k408_6487_c1 | nmdc:mga0k408_6487_c1_1238_1840 | 200 |
| 212 | 3300050494 | nmdc:mga06z11_105485_c1 | nmdc:mga06z11_105485_c1_396_998 | 200 |
| 213 | 3300050494 | nmdc:mga06z11_123048_c1 | nmdc:mga06z11_123048_c1_711_1325 | 200 |
| 214 | 3300050496 | nmdc:mga07m45_13775_c1 | nmdc:mga07m45_13775_c1_2177_2779 | 200 |
| 215 | 3300050496 | nmdc:mga07m45_1544_c1 | nmdc:mga07m45_1544_c1_8035_8649 | 200 |
| 216 | 3300053131 | Ga0500652_051194 | Ga0500652_051194_718_1323 | 200 |
| 217 | 3300059421 | Ga0590071_000859 | Ga0590071_000859_5364_5966 | 200 |
| 218 | 3300005457 | Ga0070662_100208267 | Ga0070662_1002082672 | 201 |
| 219 | 3300005577 | Ga0068857_100337554 | Ga0068857_1003375541 | 201 |
| 220 | 3300005718 | Ga0068866_10352045 | Ga0068866_103520452 | 201 |
| 221 | 3300005834 | Ga0068851_10122710 | Ga0068851_101227101 | 201 |
| 222 | 3300006042 | Ga0075368_10120548 | Ga0075368_101205481 | 201 |
| 223 | 3300006177 | Ga0075362_10000766 | Ga0075362_100007667 | 201 |
| 224 | 3300006178 | Ga0075367_10021765 | Ga0075367_100217654 | 201 |
| 225 | 3300006186 | Ga0075369_10004800 | Ga0075369_100048004 | 201 |
| 226 | 3300009148 | Ga0105243_10227152 | Ga0105243_102271522 | 201 |
| 227 | 3300025935 | Ga0207709_10014445 | Ga0207709_100144455 | 201 |
| 228 | 3300026116 | Ga0207674_10205482 | Ga0207674_102054823 | 201 |
| 229 | 3300028381 | Ga0268264_10398200 | Ga0268264_103982002 | 201 |
| 230 | 3300028794 | Ga0307515_10006495 | Ga0307515_100064954 | 201 |
| 231 | 3300031730 | Ga0307516_10096888 | Ga0307516_100968883 | 201 |
| 232 | 3300046474 | Ga0495605_0154693 | Ga0495605_0154693_72_677 | 201 |
| 233 | 3300050493 | nmdc:mga0k408_28506_c1 | nmdc:mga0k408_28506_c1_2431_3036 | 201 |
| 234 | 3300050493 | nmdc:mga0k408_732_c1 | nmdc:mga0k408_732_c1_14054_14659 | 201 |
| 235 | 3300050494 | nmdc:mga06z11_43994_c1 | nmdc:mga06z11_43994_c1_1016_1621 | 201 |
| 236 | 3300050496 | nmdc:mga07m45_434_c1 | nmdc:mga07m45_434_c1_7711_8316 | 201 |
| 237 | 3300050496 | nmdc:mga07m45_46676_c1 | nmdc:mga07m45_46676_c1_270_875 | 201 |
| 238 | 3300050496 | nmdc:mga07m45_75677_c1 | nmdc:mga07m45_75677_c1_363_968 | 201 |
| 239 | 3300046457 | Ga0495590_0003199 | Ga0495590_0003199_983_1591 | 202 |
| 240 | 3300048904 | Ga0496101_0566805 | Ga0496101_0566805_213_821 | 202 |
| 241 | 3300048917 | Ga0496114_0294840 | Ga0496114_0294840_278_886 | 202 |
| 242 | 3300050489 | nmdc:mga03683_306291_c1 | nmdc:mga03683_306291_c1_18_626 | 202 |
| 243 | 3300050493 | nmdc:mga0k408_1729_c1 | nmdc:mga0k408_1729_c1_355_963 | 202 |
| 244 | 3300041452 | Ga0451793_0570148 | Ga0451793_0570148_76_687 | 203 |
| 245 | 3300005356 | Ga0070674_100034557 | Ga0070674_1000345572 | 204 |
| 246 | 3300005356 | Ga0070674_100334175 | Ga0070674_1003341752 | 204 |
| 247 | 3300005543 | Ga0070672_100028846 | Ga0070672_1000288462 | 204 |
| 248 | 3300005543 | Ga0070672_100336441 | Ga0070672_1003364412 | 204 |
| 249 | 3300005616 | Ga0068852_100081171 | Ga0068852_1000811712 | 204 |
| 250 | 3300006173 | Ga0070716_100482361 | Ga0070716_1004823612 | 204 |
| 251 | 3300025901 | Ga0207688_10081357 | Ga0207688_100813571 | 204 |
| 252 | 3300025939 | Ga0207665_10345241 | Ga0207665_103452412 | 204 |
| 253 | 3300025940 | Ga0207691_10070074 | Ga0207691_100700744 | 204 |
| 254 | 3300025940 | Ga0207691_10135301 | Ga0207691_101353012 | 204 |
| 255 | 3300025972 | Ga0207668_10030247 | Ga0207668_100302474 | 204 |
| 256 | 3300026142 | Ga0207698_10083685 | Ga0207698_100836853 | 204 |
| 257 | 3300031456 | Ga0307513_10059231 | Ga0307513_100592312 | 204 |
| 258 | 3300032004 | Ga0307414_10400247 | Ga0307414_104002472 | 204 |
| 259 | 3300046519 | Ga0495632_0049793 | Ga0495632_0049793_267_881 | 204 |
| 260 | 3300046528 | Ga0495642_0018831 | Ga0495642_0018831_443_1057 | 204 |
| 261 | 3300046543 | Ga0495645_0103562 | Ga0495645_0103562_747_1361 | 204 |
| 262 | 3300046616 | Ga0495668_0020830 | Ga0495668_0020830_435_1049 | 204 |
| 263 | 3300046616 | Ga0495668_0330294 | Ga0495668_0330294_134_748 | 204 |
| 264 | 3300046648 | Ga0495611_0089374 | Ga0495611_0089374_518_1132 | 204 |
| 265 | 3300046694 | Ga0495649_0001518 | Ga0495649_0001518_8079_8693 | 204 |
| 266 | 3300048091 | Ga0495626_0061141 | Ga0495626_0061141_118_732 | 204 |
| 267 | 3300053134 | Ga0500658_0003009 | Ga0500658_0003009_2153_2767 | 204 |
| 268 | 3300053139 | Ga0500568_0036624 | Ga0500568_0036624_1176_1790 | 204 |
| 269 | 3300005329 | Ga0070683_100237396 | Ga0070683_1002373962 | 205 |
| 270 | 3300005331 | Ga0070670_100079386 | Ga0070670_1000793862 | 205 |
| 271 | 3300005354 | Ga0070675_100139624 | Ga0070675_1001396242 | 205 |
| 272 | 3300005355 | Ga0070671_100011653 | Ga0070671_1000116535 | 205 |
| 273 | 3300005356 | Ga0070674_100051467 | Ga0070674_1000514672 | 205 |
| 274 | 3300005456 | Ga0070678_100026712 | Ga0070678_1000267124 | 205 |
| 275 | 3300005841 | Ga0068863_100845874 | Ga0068863_1008458742 | 205 |
| 276 | 3300006237 | Ga0097621_100207413 | Ga0097621_1002074132 | 205 |
| 277 | 3300009148 | Ga0105243_10806944 | Ga0105243_108069442 | 205 |
| 278 | 3300009176 | Ga0105242_11080540 | Ga0105242_110805402 | 205 |
| 279 | 3300013102 | Ga0157371_10376994 | Ga0157371_103769942 | 205 |
| 280 | 3300013105 | Ga0157369_10556974 | Ga0157369_105569742 | 205 |
| 281 | 3300013296 | Ga0157374_10276244 | Ga0157374_102762442 | 205 |
| 282 | 3300013306 | Ga0163162_10496402 | Ga0163162_104964022 | 205 |
| 283 | 3300025893 | Ga0207682_10074524 | Ga0207682_100745242 | 205 |
| 284 | 3300025893 | Ga0207682_10082870 | Ga0207682_100828702 | 205 |
| 285 | 3300025923 | Ga0207681_10340857 | Ga0207681_103408572 | 205 |
| 286 | 3300025925 | Ga0207650_10007691 | Ga0207650_100076915 | 205 |
| 287 | 3300025925 | Ga0207650_10096119 | Ga0207650_100961192 | 205 |
| 288 | 3300025926 | Ga0207659_10050556 | Ga0207659_100505563 | 205 |
| 289 | 3300025926 | Ga0207659_10222695 | Ga0207659_102226952 | 205 |
| 290 | 3300025931 | Ga0207644_10001435 | Ga0207644_100014358 | 205 |
| 291 | 3300025932 | Ga0207690_10280831 | Ga0207690_102808312 | 205 |
| 292 | 3300025935 | Ga0207709_10521079 | Ga0207709_105210792 | 205 |
| 293 | 3300025937 | Ga0207669_10218690 | Ga0207669_102186902 | 205 |
| 294 | 3300025940 | Ga0207691_10143124 | Ga0207691_101431241 | 205 |
| 295 | 3300025940 | Ga0207691_10274034 | Ga0207691_102740342 | 205 |
| 296 | 3300025941 | Ga0207711_10487187 | Ga0207711_104871872 | 205 |
| 297 | 3300025960 | Ga0207651_10250122 | Ga0207651_102501222 | 205 |
| 298 | 3300025972 | Ga0207668_10171801 | Ga0207668_101718012 | 205 |
| 299 | 3300026088 | Ga0207641_10085698 | Ga0207641_100856983 | 205 |
| 300 | 3300026089 | Ga0207648_10126487 | Ga0207648_101264872 | 205 |
| 301 | 3300026095 | Ga0207676_10208702 | Ga0207676_102087023 | 205 |
| 302 | 3300026121 | Ga0207683_10040448 | Ga0207683_100404485 | 205 |
| 303 | 3300026121 | Ga0207683_10092858 | Ga0207683_100928583 | 205 |
| 304 | 3300031548 | Ga0307408_100401301 | Ga0307408_1004013012 | 205 |
| 305 | 3300031824 | Ga0307413_10000382 | Ga0307413_100003822 | 205 |
| 306 | 3300031852 | Ga0307410_10214634 | Ga0307410_102146342 | 205 |
| 307 | 3300031903 | Ga0307407_10553340 | Ga0307407_105533401 | 205 |
| 308 | 3300031995 | Ga0307409_100110678 | Ga0307409_1001106783 | 205 |
| 309 | 3300031995 | Ga0307409_100297948 | Ga0307409_1002979483 | 205 |
| 310 | 3300032005 | Ga0307411_10046325 | Ga0307411_100463252 | 205 |
| 311 | 3300035119 | Ga0373956_0217390 | Ga0373956_0217390_190_807 | 205 |
| 312 | 3300035170 | Ga0373943_0148064 | Ga0373943_0148064_40_657 | 205 |
| 313 | 3300035171 | Ga0373946_0190814 | Ga0373946_0190814_222_839 | 205 |
| 314 | 3300036401 | Ga0373937_0122739 | Ga0373937_0122739_100_717 | 205 |
| 315 | 3300046543 | Ga0495645_0042282 | Ga0495645_0042282_519_1136 | 205 |
| 316 | 3300046683 | Ga0495658_0075594 | Ga0495658_0075594_644_1261 | 205 |
| 317 | 3300047319 | Ga0495674_0265755 | Ga0495674_0265755_640_1257 | 205 |
| 318 | 3300047471 | Ga0495684_0091526 | Ga0495684_0091526_66_683 | 205 |
| 319 | 3300048913 | Ga0496110_0783820 | Ga0496110_0783820_61_684 | 205 |
| 320 | 3300050511 | nmdc:mga08y16_640133_c1 | nmdc:mga08y16_640133_c1_92_709 | 205 |
| 321 | 3300005328 | Ga0070676_10186093 | Ga0070676_101860932 | 206 |
| 322 | 3300005364 | Ga0070673_100027067 | Ga0070673_1000270674 | 206 |
| 323 | 3300005543 | Ga0070672_100026453 | Ga0070672_1000264533 | 206 |
| 324 | 3300005618 | Ga0068864_100125334 | Ga0068864_1001253343 | 206 |
| 325 | 3300005841 | Ga0068863_100047492 | Ga0068863_1000474923 | 206 |
| 326 | 3300006358 | Ga0068871_100086480 | Ga0068871_1000864803 | 206 |
| 327 | 3300013308 | Ga0157375_10015776 | Ga0157375_100157763 | 206 |
| 328 | 3300025907 | Ga0207645_10040637 | Ga0207645_100406372 | 206 |
| 329 | 3300025941 | Ga0207711_10103709 | Ga0207711_101037093 | 206 |
| 330 | 3300025960 | Ga0207651_10036901 | Ga0207651_100369013 | 206 |
| 331 | 3300026088 | Ga0207641_10029108 | Ga0207641_100291083 | 206 |
| 332 | 3300026089 | Ga0207648_10112167 | Ga0207648_101121673 | 206 |
| 333 | 3300026095 | Ga0207676_10232318 | Ga0207676_102323182 | 206 |
| 334 | 3300035695 | Ga0373927_0231145 | Ga0373927_0231145_395_1015 | 206 |
| 335 | 3300036401 | Ga0373937_0184879 | Ga0373937_0184879_372_992 | 206 |
| 336 | 3300037068 | Ga0373925_0058875 | Ga0373925_0058875_926_1546 | 206 |
| 337 | 3300046459 | Ga0495629_0426595 | Ga0495629_0426595_185_805 | 206 |
| 338 | 3300046477 | Ga0495664_0405456 | Ga0495664_0405456_108_728 | 206 |
| 339 | 3300046535 | Ga0495586_0315633 | Ga0495586_0315633_144_764 | 206 |
| 340 | 3300046681 | Ga0495647_0009507 | Ga0495647_0009507_2224_2844 | 206 |
| 341 | 3300053077 | Ga0495601_0031942 | Ga0495601_0031942_435_1055 | 206 |
| 342 | 3300053084 | Ga0495595_0012992 | Ga0495595_0012992_2099_2719 | 206 |
| 343 | 3300053085 | Ga0495619_0046311 | Ga0495619_0046311_226_846 | 206 |
| 344 | 3300005328 | Ga0070676_10018036 | Ga0070676_100180363 | 207 |
| 345 | 3300005333 | Ga0070677_10067259 | Ga0070677_100672592 | 207 |
| 346 | 3300005334 | Ga0068869_100050335 | Ga0068869_1000503353 | 207 |
| 347 | 3300005336 | Ga0070680_100001873 | Ga0070680_10000187313 | 207 |
| 348 | 3300005338 | Ga0068868_100126480 | Ga0068868_1001264802 | 207 |
| 349 | 3300005340 | Ga0070689_100333187 | Ga0070689_1003331871 | 207 |
| 350 | 3300005347 | Ga0070668_100004749 | Ga0070668_10000474911 | 207 |
| 351 | 3300005353 | Ga0070669_100045796 | Ga0070669_1000457963 | 207 |
| 352 | 3300005354 | Ga0070675_100093079 | Ga0070675_1000930791 | 207 |
| 353 | 3300005355 | Ga0070671_100323279 | Ga0070671_1003232792 | 207 |
| 354 | 3300005356 | Ga0070674_100008402 | Ga0070674_1000084023 | 207 |
| 355 | 3300005364 | Ga0070673_100159435 | Ga0070673_1001594353 | 207 |
| 356 | 3300005367 | Ga0070667_100062553 | Ga0070667_1000625533 | 207 |
| 357 | 3300005441 | Ga0070700_100093275 | Ga0070700_1000932753 | 207 |
| 358 | 3300005456 | Ga0070678_100009576 | Ga0070678_1000095765 | 207 |
| 359 | 3300005457 | Ga0070662_100113728 | Ga0070662_1001137282 | 207 |
| 360 | 3300005458 | Ga0070681_10131220 | Ga0070681_101312203 | 207 |
| 361 | 3300005459 | Ga0068867_100012224 | Ga0068867_1000122243 | 207 |
| 362 | 3300005530 | Ga0070679_100006195 | Ga0070679_1000061955 | 207 |
| 363 | 3300005543 | Ga0070672_100033634 | Ga0070672_1000336344 | 207 |
| 364 | 3300005543 | Ga0070672_100053569 | Ga0070672_1000535694 | 207 |
| 365 | 3300005617 | Ga0068859_100098525 | Ga0068859_1000985252 | 207 |
| 366 | 3300005618 | Ga0068864_100153585 | Ga0068864_1001535852 | 207 |
| 367 | 3300005718 | Ga0068866_10032021 | Ga0068866_100320213 | 207 |
| 368 | 3300005719 | Ga0068861_100011784 | Ga0068861_1000117842 | 207 |
| 369 | 3300005834 | Ga0068851_10435552 | Ga0068851_104355522 | 207 |
| 370 | 3300005841 | Ga0068863_100031883 | Ga0068863_1000318835 | 207 |
| 371 | 3300005842 | Ga0068858_100056552 | Ga0068858_1000565524 | 207 |
| 372 | 3300005843 | Ga0068860_100014499 | Ga0068860_1000144993 | 207 |
| 373 | 3300006931 | Ga0097620_100098527 | Ga0097620_1000985272 | 207 |
| 374 | 3300009148 | Ga0105243_10043131 | Ga0105243_100431312 | 207 |
| 375 | 3300009176 | Ga0105242_10058685 | Ga0105242_100586853 | 207 |
| 376 | 3300009177 | Ga0105248_10852450 | Ga0105248_108524502 | 207 |
| 377 | 3300009553 | Ga0105249_10029780 | Ga0105249_100297804 | 207 |
| 378 | 3300013306 | Ga0163162_10009181 | Ga0163162_100091813 | 207 |
| 379 | 3300013306 | Ga0163162_10113717 | Ga0163162_101137172 | 207 |
| 380 | 3300013308 | Ga0157375_10024899 | Ga0157375_100248994 | 207 |
| 381 | 3300014326 | Ga0157380_10031042 | Ga0157380_100310422 | 207 |
| 382 | 3300014968 | Ga0157379_10017086 | Ga0157379_100170861 | 207 |
| 383 | 3300014969 | Ga0157376_10720584 | Ga0157376_107205842 | 207 |
| 384 | 3300017792 | Ga0163161_10017349 | Ga0163161_100173491 | 207 |
| 385 | 3300017792 | Ga0163161_10377334 | Ga0163161_103773342 | 207 |
| 386 | 3300025321 | Ga0207656_10306630 | Ga0207656_103066302 | 207 |
| 387 | 3300025899 | Ga0207642_10010087 | Ga0207642_100100874 | 207 |
| 388 | 3300025901 | Ga0207688_10176792 | Ga0207688_101767922 | 207 |
| 389 | 3300025903 | Ga0207680_10016228 | Ga0207680_100162284 | 207 |
| 390 | 3300025907 | Ga0207645_10007602 | Ga0207645_100076025 | 207 |
| 391 | 3300025912 | Ga0207707_10192524 | Ga0207707_101925243 | 207 |
| 392 | 3300025921 | Ga0207652_10002539 | Ga0207652_1000253919 | 207 |
| 393 | 3300025923 | Ga0207681_10011771 | Ga0207681_100117715 | 207 |
| 394 | 3300025931 | Ga0207644_10258179 | Ga0207644_102581792 | 207 |
| 395 | 3300025933 | Ga0207706_10021167 | Ga0207706_100211671 | 207 |
| 396 | 3300025934 | Ga0207686_10086564 | Ga0207686_100865642 | 207 |
| 397 | 3300025934 | Ga0207686_10097221 | Ga0207686_100972212 | 207 |
| 398 | 3300025935 | Ga0207709_10021946 | Ga0207709_100219465 | 207 |
| 399 | 3300025938 | Ga0207704_10045846 | Ga0207704_100458462 | 207 |
| 400 | 3300025940 | Ga0207691_10028125 | Ga0207691_100281253 | 207 |
| 401 | 3300025940 | Ga0207691_10069901 | Ga0207691_100699013 | 207 |
| 402 | 3300025940 | Ga0207691_10149866 | Ga0207691_101498662 | 207 |
| 403 | 3300025942 | Ga0207689_10015754 | Ga0207689_100157544 | 207 |
| 404 | 3300025960 | Ga0207651_10574790 | Ga0207651_105747902 | 207 |
| 405 | 3300025961 | Ga0207712_10068958 | Ga0207712_100689583 | 207 |
| 406 | 3300025986 | Ga0207658_10109869 | Ga0207658_101098692 | 207 |
| 407 | 3300026023 | Ga0207677_10087043 | Ga0207677_100870432 | 207 |
| 408 | 3300026035 | Ga0207703_10035556 | Ga0207703_100355563 | 207 |
| 409 | 3300026075 | Ga0207708_10594943 | Ga0207708_105949432 | 207 |
| 410 | 3300026089 | Ga0207648_10005079 | Ga0207648_1000507911 | 207 |
| 411 | 3300026089 | Ga0207648_10365619 | Ga0207648_103656192 | 207 |
| 412 | 3300026095 | Ga0207676_10019189 | Ga0207676_100191892 | 207 |
| 413 | 3300026118 | Ga0207675_100004297 | Ga0207675_10000429711 | 207 |
| 414 | 3300026121 | Ga0207683_10137739 | Ga0207683_101377392 | 207 |
| 415 | 3300026142 | Ga0207698_10017788 | Ga0207698_100177883 | 207 |
| 416 | 3300026142 | Ga0207698_10603726 | Ga0207698_106037262 | 207 |
| 417 | 3300028380 | Ga0268265_10054973 | Ga0268265_100549731 | 207 |
| 418 | 3300028381 | Ga0268264_10011851 | Ga0268264_100118517 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nwo-assembly1.cif.gz_A | computationally designed two-component self-assembling tetrahedral cage t33-15 | 0.9642 | 15 | 194 |
| 8cuw-assembly1.cif.gz_A | accurate computational design of genetically encoded 3d protein crystals | 0.9637 | 15 | 194 |
| 8cuu-assembly1.cif.gz_A | accurate computational design of genetically encoded 3d protein crystals | 0.9616 | 15 | 194 |
| 8cuv-assembly1.cif.gz_A | accurate computational design of genetically encoded 3d protein crystals | 0.9612 | 15 | 196 |
| 3k6a-assembly2.cif.gz_B | crystal structure of molybdenum cofactor biosynthesis protein mog from shewanella oneidensis | 0.9607 | 15 | 195 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1di6A00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9397 | 13 | 200 | 3.40.980.10 |
| af_P39205_1_179_3.40.980.10 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9373 | 13 | 179 | 3.40.980.10 |
| 4xcwB00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9372 | 10 | 196 | 3.40.980.10 |
| 1di6A00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9347 | 13 | 200 | 3.40.980.10 |
| 4xcwB00 | Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain | 0.9272 | 10 | 196 | 3.40.980.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q6T2B2-F1-model_v4 | MoaB/Mog domain-containing protein | 0.9781 | 12 | 202 |
GO:0006777
|
| AF-A0A401JHH7-F1-model_v4 | Molybdopterin biosynthesis molybdochelatase MogA | 0.9753 | 13 | 201 |
GO:0006777
|
| AF-A0A437LRV1-F1-model_v4 | Molybdopterin adenylyltransferase (EC 2.7.7.75) | 0.9736 | 13 | 204 |
GO:0006777
GO:0061598 |
| AF-A0A2E5F3T9-F1-model_v4 | Molybdopterin adenylyltransferase | 0.9686 | 15 | 189 |
GO:0006777
GO:0016779 |
| AF-A0A536V3Y1-F1-model_v4 | Molybdopterin adenylyltransferase (EC 2.7.7.75) | 0.9681 | 12 | 143 |
GO:0006777
GO:0061598 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar