F439362

General Info

Members Datasets Scaffolds Average Seq Length
418 231 418 202

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0154693|Ga0495605_0154693_72_677
Length 201
Sequence MSDKMSDIGALDTVHIGVLSVSDRASAGVYEDKGIPALQSWLQSAVRNPIVWEPRLIPDEQQLISDALIDLVDRAGCDLVLTTGAAARDVTPEATLAVATKVMPGFGEQMRQISLNFVPTAILSRQVAVIRHKALIINLPGQPKAIAETLGGIPNAQPPVGGIFAAVPYCVDLIGGPYIDTDPAVCKAFRPKSAQRPVASP

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
137 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
140 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
141 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
179 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
226 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
227 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
228 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
229 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11
Nodule 0
Rhizoplane 1.67
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 4.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10018036 3300005328 Bacteria 3909
2 Ga0070676_10186093 3300005328 Bacteria 1353
3 Ga0070683_100237396 3300005329 Bacteria 1734
4 Ga0070690_100029058 3300005330 Bacteria 3426
5 Ga0070670_100003129 3300005331 Bacteria 13693
6 Ga0070670_100079386 3300005331 Bacteria 2820
7 Ga0070677_10067259 3300005333 Bacteria 1496
8 Ga0068869_100046053 3300005334 Bacteria 3143
9 Ga0068869_100050335 3300005334 Bacteria 3019
10 Ga0070680_100001873 3300005336 Bacteria 15421
11 Ga0070680_100149072 3300005336 Bacteria 1964
12 Ga0068868_100126480 3300005338 Bacteria 2088
13 Ga0068868_100594017 3300005338 Bacteria 980
14 Ga0070689_100009503 3300005340 Bacteria 6894
15 Ga0070689_100333187 3300005340 Bacteria 1270
16 Ga0070691_10043452 3300005341 Bacteria 2129
17 Ga0070692_10262172 3300005345 Bacteria 1039
18 Ga0070668_100004749 3300005347 Bacteria 10080
19 Ga0070669_100021017 3300005353 Bacteria 4664
20 Ga0070669_100045796 3300005353 Bacteria 3188
21 Ga0070669_100306118 3300005353 Bacteria 1279
22 Ga0070675_100007695 3300005354 Bacteria 8339
23 Ga0070675_100093079 3300005354 Bacteria 2528
24 Ga0070675_100139624 3300005354 Bacteria 2070
25 Ga0070671_100011653 3300005355 Bacteria 7073
26 Ga0070671_100323279 3300005355 Bacteria 1315
27 Ga0070674_100008402 3300005356 Bacteria 6147
28 Ga0070674_100034557 3300005356 Bacteria 3377
29 Ga0070674_100051467 3300005356 Bacteria 2838
30 Ga0070674_100168973 3300005356 Bacteria 1666
31 Ga0070674_100334175 3300005356 Bacteria 1219
32 Ga0070673_100022540 3300005364 Bacteria 4586
33 Ga0070673_100027067 3300005364 Bacteria 4246
34 Ga0070673_100054663 3300005364 Bacteria 3142
35 Ga0070673_100159435 3300005364 Bacteria 1918
36 Ga0070673_100441904 3300005364 Bacteria 1169
37 Ga0070659_100287722 3300005366 Bacteria 1368
38 Ga0070667_100001171 3300005367 Bacteria 23847
39 Ga0070667_100062553 3300005367 Bacteria 3153
40 Ga0070705_100373752 3300005440 Bacteria 1047
41 Ga0070700_100005633 3300005441 Bacteria 6642
42 Ga0070700_100093275 3300005441 Bacteria 1969
43 Ga0070694_100110885 3300005444 Bacteria 1954
44 Ga0070708_100000040 3300005445 Bacteria 84054
45 Ga0070663_100249969 3300005455 Bacteria 1403
46 Ga0070678_100009576 3300005456 Bacteria 5877
47 Ga0070678_100022866 3300005456 Bacteria 4154
48 Ga0070678_100026712 3300005456 Bacteria 3908
49 Ga0070662_100113728 3300005457 Bacteria 2065
50 Ga0070662_100208267 3300005457 Bacteria 1555
51 Ga0070662_100219943 3300005457 Bacteria 1515
52 Ga0070662_100448923 3300005457 Bacteria 1070
53 Ga0070681_10131220 3300005458 Bacteria 2438
54 Ga0068867_100012224 3300005459 Bacteria 6067
55 Ga0070679_100006195 3300005530 Bacteria 11138
56 Ga0068853_100157319 3300005539 Bacteria 2048
57 Ga0070672_100002003 3300005543 Bacteria 12792
58 Ga0070672_100026453 3300005543 Bacteria 4318
59 Ga0070672_100028846 3300005543 Bacteria 4155
60 Ga0070672_100033634 3300005543 Bacteria 3884
61 Ga0070672_100038231 3300005543 Bacteria 3666
62 Ga0070672_100053569 3300005543 Bacteria 3154
63 Ga0070672_100336441 3300005543 Bacteria 1285
64 Ga0070686_100021059 3300005544 Bacteria 3869
65 Ga0070695_100072495 3300005545 Bacteria 2258
66 Ga0070704_100803639 3300005549 Bacteria 840
67 Ga0070664_100458489 3300005564 Bacteria 1171
68 Ga0068857_100068142 3300005577 Bacteria 3168
69 Ga0068857_100337554 3300005577 Bacteria 1394
70 Ga0068854_100066703 3300005578 Bacteria 2620
71 Ga0070702_100006482 3300005615 Bacteria 5544
72 Ga0068852_100081171 3300005616 Bacteria 2878
73 Ga0068852_100199735 3300005616 Bacteria 1892
74 Ga0068852_100444406 3300005616 Bacteria 1282
75 Ga0068859_100059484 3300005617 Bacteria 3849
76 Ga0068859_100098525 3300005617 Bacteria 2977
77 Ga0068864_100125334 3300005618 Bacteria 2301
78 Ga0068864_100153585 3300005618 Bacteria 2087
79 Ga0068866_10002667 3300005718 Bacteria 7371
80 Ga0068866_10032021 3300005718 Bacteria 2539
81 Ga0068866_10352045 3300005718 Bacteria 936
82 Ga0068861_100011784 3300005719 Bacteria 6085
83 Ga0068861_100014098 3300005719 Bacteria 5604
84 Ga0068851_10122710 3300005834 Bacteria 1398
85 Ga0068851_10435552 3300005834 Bacteria 777
86 Ga0068870_10009162 3300005840 Bacteria 4488
87 Ga0068863_100031883 3300005841 Bacteria 5027
88 Ga0068863_100047492 3300005841 Bacteria 4071
89 Ga0068863_100273414 3300005841 Bacteria 1636
90 Ga0068863_100342953 3300005841 Bacteria 1453
91 Ga0068863_100845874 3300005841 Bacteria 914
92 Ga0068858_100011483 3300005842 Bacteria 8358
93 Ga0068858_100056552 3300005842 Bacteria 3625
94 Ga0068858_101461249 3300005842 Bacteria 674
95 Ga0068860_100014499 3300005843 Bacteria 7714
96 Ga0068860_100034080 3300005843 Bacteria 4883
97 Ga0068862_100014569 3300005844 Bacteria 6528
98 Ga0075368_10120548 3300006042 Bacteria 1086
99 Ga0075364_10146035 3300006051 Bacteria 1592
100 Ga0070716_100482361 3300006173 Bacteria 911
101 Ga0075362_10000766 3300006177 Bacteria 9569
102 Ga0075362_10030335 3300006177 Bacteria 2335
103 Ga0075367_10021765 3300006178 Bacteria 3588
104 Ga0075367_10042138 3300006178 Bacteria 2670
105 Ga0075367_10077658 3300006178 Bacteria 2005
106 Ga0075369_10004800 3300006186 Bacteria 5026
107 Ga0075366_10000673 3300006195 Bacteria 16127
108 Ga0075366_10024219 3300006195 Bacteria 3541
109 Ga0075366_10426888 3300006195 Bacteria 817
110 Ga0097621_100005843 3300006237 Bacteria 8692
111 Ga0097621_100100684 3300006237 Bacteria 2431
112 Ga0097621_100207413 3300006237 Bacteria 1703
113 Ga0075370_10000167 3300006353 Bacteria 22616
114 Ga0075370_10001602 3300006353 Bacteria 9980
115 Ga0075370_10087068 3300006353 Bacteria 1800
116 Ga0068871_100086480 3300006358 Bacteria 2605
117 Ga0068865_100031257 3300006881 Bacteria 3549
118 Ga0097620_100059481 3300006931 Bacteria 3849
119 Ga0097620_100098527 3300006931 Bacteria 2977
120 Ga0105240_10004619 3300009093 Bacteria 20879
121 Ga0111539_10654996 3300009094 Bacteria 1223
122 Ga0105245_10001278 3300009098 Bacteria 22694
123 Ga0114129_11553843 3300009147 Bacteria 811
124 Ga0105243_10024526 3300009148 Bacteria 4600
125 Ga0105243_10043131 3300009148 Bacteria 3535
126 Ga0105243_10074563 3300009148 Bacteria 2752
127 Ga0105243_10227152 3300009148 Bacteria 1654
128 Ga0105243_10806944 3300009148 Bacteria 925
129 Ga0105242_10021901 3300009176 Bacteria 5023
130 Ga0105242_10058685 3300009176 Bacteria 3156
131 Ga0105242_11080540 3300009176 Bacteria 815
132 Ga0105248_10852450 3300009177 Bacteria 1028
133 Ga0105237_10061045 3300009545 Bacteria 3770
134 Ga0105237_10223900 3300009545 Bacteria 1881
135 Ga0105249_10029780 3300009553 Bacteria 4932
136 Ga0105249_10058080 3300009553 Bacteria 3546
137 Ga0105249_11169257 3300009553 Bacteria 840
138 Ga0105239_10026856 3300010375 Bacteria 6336
139 Ga0105239_10067979 3300010375 Bacteria 3915
140 Ga0157371_10376994 3300013102 Bacteria 1035
141 Ga0157369_10556974 3300013105 Bacteria 1185
142 Ga0157374_10276244 3300013296 Bacteria 1658
143 Ga0157378_10010618 3300013297 Bacteria 8049
144 Ga0157378_10518177 3300013297 Bacteria 1193
145 Ga0163162_10009181 3300013306 Bacteria 9623
146 Ga0163162_10113717 3300013306 Bacteria 2806
147 Ga0163162_10496402 3300013306 Bacteria 1351
148 Ga0163162_10650131 3300013306 Bacteria 1178
149 Ga0157375_10015776 3300013308 Bacteria 6770
150 Ga0157375_10024899 3300013308 Bacteria 5548
151 Ga0157375_10039281 3300013308 Bacteria 4554
152 Ga0163163_10347112 3300014325 Bacteria 1540
153 Ga0157380_10011688 3300014326 Bacteria 6348
154 Ga0157380_10031042 3300014326 Bacteria 4099
155 Ga0157379_10017086 3300014968 Bacteria 6387
156 Ga0157379_10108628 3300014968 Bacteria 2491
157 Ga0157376_10720584 3300014969 Bacteria 1004
158 Ga0163161_10017349 3300017792 Bacteria 5038
159 Ga0163161_10377334 3300017792 Bacteria 1132
160 Ga0163161_10652620 3300017792 Bacteria 872
161 Ga0207666_1007034 3300025271 Bacteria 1472
162 Ga0209051_1002574 3300025303 Bacteria 12777
163 Ga0209051_1004247 3300025303 Bacteria 8926
164 Ga0209257_1098525 3300025304 Bacteria 717
165 Ga0207656_10095306 3300025321 Bacteria 1357
166 Ga0207656_10306630 3300025321 Bacteria 787
167 Ga0207682_10074524 3300025893 Bacteria 1443
168 Ga0207682_10082870 3300025893 Bacteria 1378
169 Ga0207642_10010087 3300025899 Bacteria 3313
170 Ga0207642_10012923 3300025899 Bacteria 3029
171 Ga0207688_10081357 3300025901 Bacteria 1850
172 Ga0207688_10176792 3300025901 Bacteria 1271
173 Ga0207680_10016228 3300025903 Bacteria 3905
174 Ga0207645_10007602 3300025907 Bacteria 7638
175 Ga0207645_10040637 3300025907 Bacteria 2979
176 Ga0207643_10003209 3300025908 Bacteria 8811
177 Ga0207643_10031468 3300025908 Bacteria 2958
178 Ga0207707_10192524 3300025912 Bacteria 1779
179 Ga0207695_10216235 3300025913 Bacteria 1825
180 Ga0207671_10019714 3300025914 Bacteria 5151
181 Ga0207671_10346966 3300025914 Bacteria 1177
182 Ga0207662_10059408 3300025918 Bacteria 2291
183 Ga0207652_10002539 3300025921 Bacteria 15323
184 Ga0207681_10011771 3300025923 Bacteria 5381
185 Ga0207681_10340857 3300025923 Bacteria 1197
186 Ga0207650_10007691 3300025925 Bacteria 7340
187 Ga0207650_10096119 3300025925 Bacteria 2272
188 Ga0207650_10362409 3300025925 Bacteria 1194
189 Ga0207650_10367434 3300025925 Bacteria 1186
190 Ga0207659_10050556 3300025926 Bacteria 2953
191 Ga0207659_10222695 3300025926 Bacteria 1518
192 Ga0207659_10290174 3300025926 Bacteria 1340
193 Ga0207687_10030625 3300025927 Bacteria 3629
194 Ga0207644_10001435 3300025931 Bacteria 15350
195 Ga0207644_10258179 3300025931 Bacteria 1392
196 Ga0207690_10280831 3300025932 Bacteria 1297
197 Ga0207690_10604058 3300025932 Bacteria 896
198 Ga0207706_10000845 3300025933 Bacteria 31549
199 Ga0207706_10021167 3300025933 Bacteria 5844
200 Ga0207706_10113711 3300025933 Bacteria 2381
201 Ga0207706_10687225 3300025933 Bacteria 875
202 Ga0207686_10019153 3300025934 Bacteria 3887
203 Ga0207686_10086564 3300025934 Bacteria 2058
204 Ga0207686_10097221 3300025934 Bacteria 1958
205 Ga0207709_10014445 3300025935 Bacteria 4361
206 Ga0207709_10021946 3300025935 Bacteria 3618
207 Ga0207709_10300056 3300025935 Bacteria 1194
208 Ga0207709_10457692 3300025935 Bacteria 988
209 Ga0207709_10521079 3300025935 Bacteria 930
210 Ga0207670_10146931 3300025936 Bacteria 1744
211 Ga0207669_10218690 3300025937 Bacteria 1396
212 Ga0207704_10009470 3300025938 Bacteria 4701
213 Ga0207704_10045846 3300025938 Bacteria 2600
214 Ga0207665_10345241 3300025939 Bacteria 1123
215 Ga0207691_10010194 3300025940 Bacteria 9015
216 Ga0207691_10021773 3300025940 Bacteria 6051
217 Ga0207691_10028125 3300025940 Bacteria 5266
218 Ga0207691_10069901 3300025940 Bacteria 3171
219 Ga0207691_10070074 3300025940 Bacteria 3167
220 Ga0207691_10135301 3300025940 Bacteria 2174
221 Ga0207691_10143124 3300025940 Bacteria 2106
222 Ga0207691_10149866 3300025940 Bacteria 2051
223 Ga0207691_10274034 3300025940 Bacteria 1452
224 Ga0207711_10103709 3300025941 Bacteria 2519
225 Ga0207711_10487187 3300025941 Bacteria 1149
226 Ga0207711_10668795 3300025941 Bacteria 969
227 Ga0207689_10005034 3300025942 Bacteria 11908
228 Ga0207689_10015754 3300025942 Bacteria 6402
229 Ga0207679_10801062 3300025945 Bacteria 859
230 Ga0207651_10036901 3300025960 Bacteria 3196
231 Ga0207651_10189531 3300025960 Bacteria 1639
232 Ga0207651_10191647 3300025960 Bacteria 1631
233 Ga0207651_10250122 3300025960 Bacteria 1450
234 Ga0207651_10497733 3300025960 Bacteria 1053
235 Ga0207651_10574790 3300025960 Bacteria 982
236 Ga0207712_10068958 3300025961 Bacteria 2536
237 Ga0207712_10740666 3300025961 Bacteria 860
238 Ga0207668_10030247 3300025972 Bacteria 3557
239 Ga0207668_10171801 3300025972 Bacteria 1701
240 Ga0207668_10377747 3300025972 Bacteria 1192
241 Ga0207640_10224264 3300025981 Bacteria 1441
242 Ga0207658_10000959 3300025986 Bacteria 23778
243 Ga0207658_10109869 3300025986 Bacteria 2177
244 Ga0207658_11179249 3300025986 Bacteria 700
245 Ga0207677_10087043 3300026023 Bacteria 2260
246 Ga0207703_10035556 3300026035 Bacteria 3958
247 Ga0207703_10038363 3300026035 Bacteria 3822
248 Ga0207703_10718663 3300026035 Bacteria 951
249 Ga0207639_10782098 3300026041 Bacteria 889
250 Ga0207639_11007306 3300026041 Bacteria 780
251 Ga0207708_10000767 3300026075 Bacteria 24167
252 Ga0207708_10594943 3300026075 Bacteria 936
253 Ga0207641_10029108 3300026088 Bacteria 4567
254 Ga0207641_10085698 3300026088 Bacteria 2745
255 Ga0207641_10342970 3300026088 Bacteria 1422
256 Ga0207648_10003104 3300026089 Bacteria 17543
257 Ga0207648_10005079 3300026089 Bacteria 13337
258 Ga0207648_10112167 3300026089 Bacteria 2394
259 Ga0207648_10126487 3300026089 Bacteria 2248
260 Ga0207648_10218751 3300026089 Bacteria 1692
261 Ga0207648_10365619 3300026089 Bacteria 1302
262 Ga0207676_10019189 3300026095 Bacteria 4983
263 Ga0207676_10070617 3300026095 Bacteria 2801
264 Ga0207676_10208702 3300026095 Bacteria 1731
265 Ga0207676_10232318 3300026095 Bacteria 1649
266 Ga0207674_10027378 3300026116 Bacteria 6032
267 Ga0207674_10205482 3300026116 Bacteria 1919
268 Ga0207675_100002571 3300026118 Bacteria 17972
269 Ga0207675_100004297 3300026118 Bacteria 13767
270 Ga0207683_10014677 3300026121 Bacteria 6671
271 Ga0207683_10029024 3300026121 Bacteria 4788
272 Ga0207683_10040448 3300026121 Bacteria 4068
273 Ga0207683_10092858 3300026121 Bacteria 2689
274 Ga0207683_10137739 3300026121 Bacteria 2198
275 Ga0207698_10001243 3300026142 Bacteria 14895
276 Ga0207698_10017788 3300026142 Bacteria 4831
277 Ga0207698_10083685 3300026142 Bacteria 2583
278 Ga0207698_10385048 3300026142 Bacteria 1335
279 Ga0207698_10422524 3300026142 Bacteria 1279
280 Ga0207698_10603726 3300026142 Bacteria 1082
281 Ga0209813_10117407 3300027866 Bacteria 923
282 Ga0268265_10054973 3300028380 Bacteria 3023
283 Ga0268264_10011851 3300028381 Bacteria 7185
284 Ga0268264_10398200 3300028381 Bacteria 1322
285 Ga0268264_10718574 3300028381 Bacteria 993
286 Ga0307517_10315753 3300028786 Bacteria 867
287 Ga0307515_10000020 3300028794 Bacteria 411735
288 Ga0307515_10000053 3300028794 Bacteria 266512
289 Ga0307515_10006495 3300028794 Bacteria 23397
290 Ga0307515_10117949 3300028794 Bacteria 3033
291 Ga0307513_10006695 3300031456 Bacteria 15034
292 Ga0307513_10059231 3300031456 Bacteria 4065
293 Ga0307513_10379345 3300031456 Bacteria 1154
294 Ga0307509_10001851 3300031507 Bacteria 34975
295 Ga0307408_100401301 3300031548 Bacteria 1177
296 Ga0307508_10004920 3300031616 Bacteria 12859
297 Ga0307514_10117885 3300031649 Bacteria 1861
298 Ga0307516_10003104 3300031730 Bacteria 21606
299 Ga0307516_10096888 3300031730 Bacteria 2770
300 Ga0307405_10236260 3300031731 Bacteria 1351
301 Ga0307413_10000382 3300031824 Bacteria 14204
302 Ga0307518_10094086 3300031838 Bacteria 2153
303 Ga0307410_10214634 3300031852 Bacteria 1476
304 Ga0307407_10553340 3300031903 Bacteria 851
305 Ga0307409_100110678 3300031995 Bacteria 2302
306 Ga0307409_100297948 3300031995 Bacteria 1499
307 Ga0307416_100464965 3300032002 Bacteria 1321
308 Ga0307414_10400247 3300032004 Bacteria 1192
309 Ga0307411_10046325 3300032005 Bacteria 2802
310 Ga0307411_10075658 3300032005 Bacteria 2299
311 Ga0307510_10009361 3300033180 Bacteria 11669
312 Ga0373932_0009360 3300035112 Bacteria 2355
313 Ga0373956_0217390 3300035119 Bacteria 907
314 Ga0373943_0148064 3300035170 Bacteria 1270
315 Ga0373946_0190814 3300035171 Bacteria 977
316 Ga0373962_0071781 3300035242 Bacteria 1036
317 Ga0373927_0231145 3300035695 Bacteria 1215
318 Ga0373937_0122739 3300036401 Bacteria 2422
319 Ga0373937_0184879 3300036401 Bacteria 1957
320 Ga0373925_0058875 3300037068 Bacteria 2881
321 Ga0373925_0404107 3300037068 Bacteria 1114
322 Ga0395905_0071619 3300037471 Bacteria 3249
323 Ga0395905_0104710 3300037471 Bacteria 2656
324 Ga0395905_0148998 3300037471 Bacteria 2201
325 Ga0451793_0570148 3300041452 Bacteria 767
326 Ga0451577_0026925 3300042876 Bacteria 5205
327 Ga0466969_0000385 3300044656 Bacteria 24302
328 Ga0466972_0050146 3300044658 Bacteria 2015
329 Ga0453683_0308144 3300044673 Bacteria 1013
330 Ga0453684_0061734 3300044712 Bacteria 4808
331 Ga0453684_0464706 3300044712 Bacteria 1406
332 Ga0466970_0149302 3300044765 Bacteria 1290
333 Ga0466960_0120325 3300044901 Bacteria 1374
334 Ga0466959_0056397 3300045049 Bacteria 2866
335 Ga0451576_0002187 3300045051 Bacteria 30196
336 Ga0451576_0168520 3300045051 Bacteria 2285
337 Ga0495592_0000028 3300046454 Bacteria 132590
338 Ga0495590_0003199 3300046457 Bacteria 6694
339 Ga0495629_0063966 3300046459 Bacteria 2569
340 Ga0495629_0426595 3300046459 Bacteria 899
341 Ga0495629_0723868 3300046459 Bacteria 660
342 Ga0495605_0154693 3300046474 Bacteria 1021
343 Ga0495664_0405456 3300046477 Bacteria 818
344 Ga0495620_0212672 3300046515 Bacteria 741
345 Ga0495628_0590250 3300046516 Bacteria 794
346 Ga0495632_0049793 3300046519 Bacteria 2069
347 Ga0495642_0018831 3300046528 Bacteria 2704
348 Ga0495586_0315633 3300046535 Bacteria 896
349 Ga0495621_0023670 3300046539 Bacteria 2044
350 Ga0495645_0042282 3300046543 Bacteria 3323
351 Ga0495645_0103562 3300046543 Bacteria 2022
352 Ga0495668_0020830 3300046616 Bacteria 3766
353 Ga0495668_0330294 3300046616 Bacteria 836
354 Ga0495611_0089374 3300046648 Bacteria 1423
355 Ga0495647_0009507 3300046681 Bacteria 3296
356 Ga0495658_0075594 3300046683 Bacteria 1966
357 Ga0495624_0016781 3300046690 Bacteria 4928
358 Ga0495649_0001518 3300046694 Bacteria 17442
359 Ga0495674_0265755 3300047319 Bacteria 1409
360 Ga0495676_0038527 3300047321 Bacteria 3969
361 Ga0495684_0091526 3300047471 Bacteria 2304
362 Ga0495686_0083884 3300047472 Bacteria 1943
363 Ga0495593_0019598 3300047673 Bacteria 3792
364 Ga0495626_0061141 3300048091 Bacteria 1714
365 Ga0496101_0566805 3300048904 Bacteria 898
366 Ga0496102_0002801 3300048905 Bacteria 14872
367 Ga0496108_0080372 3300048911 Bacteria 2761
368 Ga0496109_0081688 3300048912 Bacteria 2978
369 Ga0496110_0783820 3300048913 Bacteria 857
370 Ga0496114_0294840 3300048917 Bacteria 1431
371 Ga0496124_0000317 3300048927 Bacteria 89188
372 Ga0496125_0009263 3300048928 Bacteria 10166
373 Ga0501034_0000406 3300049571 Bacteria 72755
374 Ga0501034_0095781 3300049571 Bacteria 2964
375 Ga0501043_0000004 3300049579 Bacteria 291085
376 Ga0501046_0000016 3300049580 Bacteria 234374
377 Ga0501047_0000012 3300049581 Bacteria 368824
378 Ga0501048_0007739 3300049582 Bacteria 8144
379 Ga0501068_0000303 3300049584 Bacteria 24685
380 Ga0501072_0004011 3300049588 Bacteria 11140
381 Ga0501073_0017254 3300049589 Bacteria 5229
382 Ga0501080_0114322 3300049742 Bacteria 2502
383 Ga0501080_0200616 3300049742 Bacteria 1832
384 Ga0501282_010596 3300049778 Bacteria 990
385 nmdc:mga03683_306291_c1 3300050489 Bacteria 746
386 nmdc:mga03683_59257_c1 3300050489 Bacteria 1615
387 nmdc:mga03n38_399951_c1 3300050490 Bacteria 756
388 nmdc:mga00v17_82966_c1 3300050491 Bacteria 2004
389 nmdc:mga0k408_101244_c1 3300050493 Bacteria 1699
390 nmdc:mga0k408_1729_c1 3300050493 Bacteria 11722
391 nmdc:mga0k408_2776_c1 3300050493 Bacteria 9308
392 nmdc:mga0k408_28506_c1 3300050493 Bacteria 3175
393 nmdc:mga0k408_5832_c1 3300050493 Bacteria 6562
394 nmdc:mga0k408_6487_c1 3300050493 Bacteria 6236
395 nmdc:mga0k408_732_c1 3300050493 Bacteria 18001
396 nmdc:mga0k408_82661_c1 3300050493 Bacteria 1882
397 nmdc:mga06z11_105485_c1 3300050494 Bacteria 1553
398 nmdc:mga06z11_123048_c1 3300050494 Bacteria 1449
399 nmdc:mga06z11_43994_c1 3300050494 Bacteria 2250
400 nmdc:mga07m45_13775_c1 3300050496 Bacteria 4295
401 nmdc:mga07m45_1544_c1 3300050496 Bacteria 10590
402 nmdc:mga07m45_434_c1 3300050496 Bacteria 17366
403 nmdc:mga07m45_46676_c1 3300050496 Bacteria 2434
404 nmdc:mga07m45_75677_c1 3300050496 Bacteria 1919
405 nmdc:mga08y16_640133_c1 3300050511 Bacteria 1068
406 Ga0495601_0031942 3300053077 Bacteria 3275
407 Ga0495595_0012992 3300053084 Bacteria 3513
408 Ga0495619_0046311 3300053085 Bacteria 2859
409 Ga0500644_0022549 3300053088 Bacteria 1900
410 Ga0500651_0006242 3300053093 Bacteria 6859
411 Ga0500651_0088952 3300053093 Bacteria 1904
412 Ga0500652_051194 3300053131 Bacteria 1687
413 Ga0500658_0003009 3300053134 Bacteria 6470
414 Ga0500559_0002434 3300053136 Bacteria 9633
415 Ga0500568_0036624 3300053139 Bacteria 1995
416 Ga0500622_0004444 3300053156 Bacteria 8804
417 Ga0501084_0175005 3300054114 Bacteria 1811
418 Ga0590071_000859 3300059421 Bacteria 8461

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026041 Ga0207639_10782098 Ga0207639_107820982 176
2 3300005445 Ga0070708_100000040 Ga0070708_10000004043 182
3 3300025321 Ga0207656_10095306 Ga0207656_100953062 183
4 3300009553 Ga0105249_11169257 Ga0105249_111692572 184
5 3300025918 Ga0207662_10059408 Ga0207662_100594082 184
6 3300025961 Ga0207712_10740666 Ga0207712_107406662 184
7 3300005353 Ga0070669_100306118 Ga0070669_1003061182 190
8 3300026142 Ga0207698_10001243 Ga0207698_100012435 193
9 3300037471 Ga0395905_0104710 Ga0395905_0104710_890_1471 193
10 3300049778 Ga0501282_010596 Ga0501282_010596_127_708 193
11 3300005841 Ga0068863_100273414 Ga0068863_1002734142 194
12 3300013297 Ga0157378_10518177 Ga0157378_105181772 194
13 3300025271 Ga0207666_1007034 Ga0207666_10070341 194
14 3300045051 Ga0451576_0002187 Ga0451576_0002187_14909_15493 194
15 3300050493 nmdc:mga0k408_5832_c1 nmdc:mga0k408_5832_c1_5629_6213 194
16 3300005330 Ga0070690_100029058 Ga0070690_1000290583 195
17 3300005334 Ga0068869_100046053 Ga0068869_1000460534 195
18 3300005336 Ga0070680_100149072 Ga0070680_1001490723 195
19 3300005340 Ga0070689_100009503 Ga0070689_1000095035 195
20 3300005341 Ga0070691_10043452 Ga0070691_100434523 195
21 3300005345 Ga0070692_10262172 Ga0070692_102621723 195
22 3300005440 Ga0070705_100373752 Ga0070705_1003737521 195
23 3300005441 Ga0070700_100005633 Ga0070700_1000056335 195
24 3300005444 Ga0070694_100110885 Ga0070694_1001108853 195
25 3300005544 Ga0070686_100021059 Ga0070686_1000210593 195
26 3300005545 Ga0070695_100072495 Ga0070695_1000724954 195
27 3300005549 Ga0070704_100803639 Ga0070704_1008036392 195
28 3300005615 Ga0070702_100006482 Ga0070702_1000064824 195
29 3300005617 Ga0068859_100059484 Ga0068859_1000594842 195
30 3300005718 Ga0068866_10002667 Ga0068866_100026674 195
31 3300005719 Ga0068861_100014098 Ga0068861_1000140983 195
32 3300005840 Ga0068870_10009162 Ga0068870_100091625 195
33 3300005842 Ga0068858_100011483 Ga0068858_1000114835 195
34 3300005843 Ga0068860_100034080 Ga0068860_1000340805 195
35 3300005844 Ga0068862_100014569 Ga0068862_1000145695 195
36 3300006195 Ga0075366_10000673 Ga0075366_100006732 195
37 3300006237 Ga0097621_100005843 Ga0097621_1000058436 195
38 3300006881 Ga0068865_100031257 Ga0068865_1000312573 195
39 3300006931 Ga0097620_100059481 Ga0097620_1000594812 195
40 3300009093 Ga0105240_10004619 Ga0105240_1000461918 195
41 3300009098 Ga0105245_10001278 Ga0105245_100012783 195
42 3300009147 Ga0114129_11553843 Ga0114129_115538431 195
43 3300009148 Ga0105243_10024526 Ga0105243_100245263 195
44 3300009176 Ga0105242_10021901 Ga0105242_100219015 195
45 3300009545 Ga0105237_10223900 Ga0105237_102239002 195
46 3300009553 Ga0105249_10058080 Ga0105249_100580802 195
47 3300010375 Ga0105239_10026856 Ga0105239_100268565 195
48 3300013297 Ga0157378_10010618 Ga0157378_100106184 195
49 3300014326 Ga0157380_10011688 Ga0157380_100116885 195
50 3300017792 Ga0163161_10652620 Ga0163161_106526202 195
51 3300025899 Ga0207642_10012923 Ga0207642_100129233 195
52 3300025908 Ga0207643_10003209 Ga0207643_100032093 195
53 3300025913 Ga0207695_10216235 Ga0207695_102162352 195
54 3300025914 Ga0207671_10019714 Ga0207671_100197145 195
55 3300025927 Ga0207687_10030625 Ga0207687_100306254 195
56 3300025934 Ga0207686_10019153 Ga0207686_100191533 195
57 3300025935 Ga0207709_10457692 Ga0207709_104576921 195
58 3300025936 Ga0207670_10146931 Ga0207670_101469311 195
59 3300025938 Ga0207704_10009470 Ga0207704_100094704 195
60 3300025942 Ga0207689_10005034 Ga0207689_100050345 195
61 3300025981 Ga0207640_10224264 Ga0207640_102242643 195
62 3300026035 Ga0207703_10038363 Ga0207703_100383635 195
63 3300026075 Ga0207708_10000767 Ga0207708_100007675 195
64 3300026089 Ga0207648_10003104 Ga0207648_100031045 195
65 3300026118 Ga0207675_100002571 Ga0207675_10000257118 195
66 3300028381 Ga0268264_10718574 Ga0268264_107185741 195
67 3300031649 Ga0307514_10117885 Ga0307514_101178852 195
68 3300031838 Ga0307518_10094086 Ga0307518_100940863 195
69 3300037471 Ga0395905_0148998 Ga0395905_0148998_25_612 195
70 3300044658 Ga0466972_0050146 Ga0466972_0050146_170_757 195
71 3300044901 Ga0466960_0120325 Ga0466960_0120325_435_1022 195
72 3300047472 Ga0495686_0083884 Ga0495686_0083884_1107_1694 195
73 3300049571 Ga0501034_0000406 Ga0501034_0000406_29026_29619 195
74 3300049571 Ga0501034_0095781 Ga0501034_0095781_207_800 195
75 3300049584 Ga0501068_0000303 Ga0501068_0000303_20099_20692 195
76 3300049588 Ga0501072_0004011 Ga0501072_0004011_10509_11102 195
77 3300049589 Ga0501073_0017254 Ga0501073_0017254_1593_2186 195
78 3300049742 Ga0501080_0114322 Ga0501080_0114322_1773_2366 195
79 3300049742 Ga0501080_0200616 Ga0501080_0200616_1209_1802 195
80 3300050493 nmdc:mga0k408_101244_c1 nmdc:mga0k408_101244_c1_824_1411 195
81 3300054114 Ga0501084_0175005 Ga0501084_0175005_1056_1649 195
82 3300005356 Ga0070674_100168973 Ga0070674_1001689733 196
83 3300025908 Ga0207643_10031468 Ga0207643_100314683 196
84 3300026121 Ga0207683_10014677 Ga0207683_100146773 196
85 3300028794 Ga0307515_10117949 Ga0307515_101179492 196
86 3300031456 Ga0307513_10006695 Ga0307513_1000669510 196
87 3300031730 Ga0307516_10003104 Ga0307516_100031049 196
88 3300031731 Ga0307405_10236260 Ga0307405_102362602 196
89 3300032002 Ga0307416_100464965 Ga0307416_1004649652 196
90 3300032005 Ga0307411_10075658 Ga0307411_100756583 196
91 3300044712 Ga0453684_0464706 Ga0453684_0464706_252_842 196
92 3300048927 Ga0496124_0000317 Ga0496124_0000317_10070_10660 196
93 3300048928 Ga0496125_0009263 Ga0496125_0009263_7789_8379 196
94 3300005367 Ga0070667_100001171 Ga0070667_10000117121 197
95 3300013308 Ga0157375_10039281 Ga0157375_100392815 197
96 3300014968 Ga0157379_10108628 Ga0157379_101086282 197
97 3300025986 Ga0207658_10000959 Ga0207658_1000095921 197
98 3300028794 Ga0307515_10000020 Ga0307515_10000020303 197
99 3300035112 Ga0373932_0009360 Ga0373932_0009360_339_932 197
100 3300035242 Ga0373962_0071781 Ga0373962_0071781_400_993 197
101 3300037068 Ga0373925_0404107 Ga0373925_0404107_106_711 197
102 3300046459 Ga0495629_0063966 Ga0495629_0063966_398_991 197
103 3300046459 Ga0495629_0723868 Ga0495629_0723868_34_627 197
104 3300046516 Ga0495628_0590250 Ga0495628_0590250_30_623 197
105 3300046690 Ga0495624_0016781 Ga0495624_0016781_1553_2146 197
106 3300047321 Ga0495676_0038527 Ga0495676_0038527_104_697 197
107 3300047673 Ga0495593_0019598 Ga0495593_0019598_593_1186 197
108 3300005616 Ga0068852_100444406 Ga0068852_1004444062 198
109 3300013306 Ga0163162_10650131 Ga0163162_106501312 198
110 3300025303 Ga0209051_1004247 Ga0209051_10042475 198
111 3300025933 Ga0207706_10000845 Ga0207706_1000084514 198
112 3300025986 Ga0207658_11179249 Ga0207658_111792491 198
113 3300026142 Ga0207698_10385048 Ga0207698_103850482 198
114 3300031456 Ga0307513_10379345 Ga0307513_103793452 198
115 3300031507 Ga0307509_10001851 Ga0307509_1000185118 198
116 3300031616 Ga0307508_10004920 Ga0307508_100049208 198
117 3300033180 Ga0307510_10009361 Ga0307510_100093614 198
118 3300042876 Ga0451577_0026925 Ga0451577_0026925_1982_2584 198
119 3300044673 Ga0453683_0308144 Ga0453683_0308144_318_920 198
120 3300044712 Ga0453684_0061734 Ga0453684_0061734_1407_2009 198
121 3300045051 Ga0451576_0168520 Ga0451576_0168520_726_1328 198
122 3300046454 Ga0495592_0000028 Ga0495592_0000028_40482_41090 198
123 3300046515 Ga0495620_0212672 Ga0495620_0212672_110_706 198
124 3300053088 Ga0500644_0022549 Ga0500644_0022549_727_1323 198
125 3300053093 Ga0500651_0006242 Ga0500651_0006242_2894_3490 198
126 3300053093 Ga0500651_0088952 Ga0500651_0088952_1076_1684 198
127 3300053136 Ga0500559_0002434 Ga0500559_0002434_4310_4906 198
128 3300053156 Ga0500622_0004444 Ga0500622_0004444_7904_8500 198
129 3300005331 Ga0070670_100003129 Ga0070670_10000312915 199
130 3300005353 Ga0070669_100021017 Ga0070669_1000210173 199
131 3300005354 Ga0070675_100007695 Ga0070675_10000769510 199
132 3300005364 Ga0070673_100022540 Ga0070673_1000225403 199
133 3300005364 Ga0070673_100054663 Ga0070673_1000546634 199
134 3300005456 Ga0070678_100022866 Ga0070678_1000228663 199
135 3300005457 Ga0070662_100448923 Ga0070662_1004489232 199
136 3300005543 Ga0070672_100002003 Ga0070672_10000200311 199
137 3300005543 Ga0070672_100038231 Ga0070672_1000382313 199
138 3300005564 Ga0070664_100458489 Ga0070664_1004584892 199
139 3300005841 Ga0068863_100342953 Ga0068863_1003429532 199
140 3300006237 Ga0097621_100100684 Ga0097621_1001006842 199
141 3300006353 Ga0075370_10001602 Ga0075370_100016029 199
142 3300006353 Ga0075370_10087068 Ga0075370_100870683 199
143 3300009094 Ga0111539_10654996 Ga0111539_106549962 199
144 3300014325 Ga0163163_10347112 Ga0163163_103471122 199
145 3300025303 Ga0209051_1002574 Ga0209051_10025747 199
146 3300025304 Ga0209257_1098525 Ga0209257_10985251 199
147 3300025925 Ga0207650_10362409 Ga0207650_103624092 199
148 3300025925 Ga0207650_10367434 Ga0207650_103674342 199
149 3300025926 Ga0207659_10290174 Ga0207659_102901742 199
150 3300025933 Ga0207706_10687225 Ga0207706_106872252 199
151 3300025940 Ga0207691_10010194 Ga0207691_100101942 199
152 3300025940 Ga0207691_10021773 Ga0207691_100217736 199
153 3300025941 Ga0207711_10668795 Ga0207711_106687951 199
154 3300025945 Ga0207679_10801062 Ga0207679_108010622 199
155 3300025960 Ga0207651_10189531 Ga0207651_101895312 199
156 3300025960 Ga0207651_10191647 Ga0207651_101916472 199
157 3300025960 Ga0207651_10497733 Ga0207651_104977332 199
158 3300026088 Ga0207641_10342970 Ga0207641_103429702 199
159 3300026095 Ga0207676_10070617 Ga0207676_100706173 199
160 3300026121 Ga0207683_10029024 Ga0207683_100290243 199
161 3300028794 Ga0307515_10000053 Ga0307515_10000053104 199
162 3300037471 Ga0395905_0071619 Ga0395905_0071619_1183_1782 199
163 3300044656 Ga0466969_0000385 Ga0466969_0000385_16279_16878 199
164 3300044765 Ga0466970_0149302 Ga0466970_0149302_368_967 199
165 3300045049 Ga0466959_0056397 Ga0466959_0056397_517_1116 199
166 3300046539 Ga0495621_0023670 Ga0495621_0023670_87_689 199
167 3300048905 Ga0496102_0002801 Ga0496102_0002801_2405_3004 199
168 3300048911 Ga0496108_0080372 Ga0496108_0080372_916_1515 199
169 3300048912 Ga0496109_0081688 Ga0496109_0081688_2176_2775 199
170 3300049579 Ga0501043_0000004 Ga0501043_0000004_137990_138589 199
171 3300049580 Ga0501046_0000016 Ga0501046_0000016_153247_153846 199
172 3300049581 Ga0501047_0000012 Ga0501047_0000012_152927_153526 199
173 3300049582 Ga0501048_0007739 Ga0501048_0007739_52_651 199
174 3300050493 nmdc:mga0k408_82661_c1 nmdc:mga0k408_82661_c1_307_924 199
175 3300005338 Ga0068868_100594017 Ga0068868_1005940172 200
176 3300005364 Ga0070673_100441904 Ga0070673_1004419042 200
177 3300005366 Ga0070659_100287722 Ga0070659_1002877222 200
178 3300005455 Ga0070663_100249969 Ga0070663_1002499692 200
179 3300005457 Ga0070662_100219943 Ga0070662_1002199431 200
180 3300005539 Ga0068853_100157319 Ga0068853_1001573192 200
181 3300005577 Ga0068857_100068142 Ga0068857_1000681423 200
182 3300005578 Ga0068854_100066703 Ga0068854_1000667031 200
183 3300005616 Ga0068852_100199735 Ga0068852_1001997352 200
184 3300005842 Ga0068858_101461249 Ga0068858_1014612491 200
185 3300006051 Ga0075364_10146035 Ga0075364_101460352 200
186 3300006177 Ga0075362_10030335 Ga0075362_100303352 200
187 3300006178 Ga0075367_10042138 Ga0075367_100421382 200
188 3300006178 Ga0075367_10077658 Ga0075367_100776582 200
189 3300006195 Ga0075366_10024219 Ga0075366_100242193 200
190 3300006195 Ga0075366_10426888 Ga0075366_104268882 200
191 3300006353 Ga0075370_10000167 Ga0075370_1000016715 200
192 3300009148 Ga0105243_10074563 Ga0105243_100745632 200
193 3300009545 Ga0105237_10061045 Ga0105237_100610454 200
194 3300010375 Ga0105239_10067979 Ga0105239_100679793 200
195 3300025914 Ga0207671_10346966 Ga0207671_103469662 200
196 3300025932 Ga0207690_10604058 Ga0207690_106040581 200
197 3300025933 Ga0207706_10113711 Ga0207706_101137113 200
198 3300025935 Ga0207709_10300056 Ga0207709_103000562 200
199 3300025972 Ga0207668_10377747 Ga0207668_103777471 200
200 3300026035 Ga0207703_10718663 Ga0207703_107186631 200
201 3300026041 Ga0207639_11007306 Ga0207639_110073062 200
202 3300026089 Ga0207648_10218751 Ga0207648_102187512 200
203 3300026116 Ga0207674_10027378 Ga0207674_100273783 200
204 3300026142 Ga0207698_10422524 Ga0207698_104225242 200
205 3300027866 Ga0209813_10117407 Ga0209813_101174072 200
206 3300028786 Ga0307517_10315753 Ga0307517_103157532 200
207 3300050489 nmdc:mga03683_59257_c1 nmdc:mga03683_59257_c1_301_903 200
208 3300050490 nmdc:mga03n38_399951_c1 nmdc:mga03n38_399951_c1_128_730 200
209 3300050491 nmdc:mga00v17_82966_c1 nmdc:mga00v17_82966_c1_534_1136 200
210 3300050493 nmdc:mga0k408_2776_c1 nmdc:mga0k408_2776_c1_1028_1642 200
211 3300050493 nmdc:mga0k408_6487_c1 nmdc:mga0k408_6487_c1_1238_1840 200
212 3300050494 nmdc:mga06z11_105485_c1 nmdc:mga06z11_105485_c1_396_998 200
213 3300050494 nmdc:mga06z11_123048_c1 nmdc:mga06z11_123048_c1_711_1325 200
214 3300050496 nmdc:mga07m45_13775_c1 nmdc:mga07m45_13775_c1_2177_2779 200
215 3300050496 nmdc:mga07m45_1544_c1 nmdc:mga07m45_1544_c1_8035_8649 200
216 3300053131 Ga0500652_051194 Ga0500652_051194_718_1323 200
217 3300059421 Ga0590071_000859 Ga0590071_000859_5364_5966 200
218 3300005457 Ga0070662_100208267 Ga0070662_1002082672 201
219 3300005577 Ga0068857_100337554 Ga0068857_1003375541 201
220 3300005718 Ga0068866_10352045 Ga0068866_103520452 201
221 3300005834 Ga0068851_10122710 Ga0068851_101227101 201
222 3300006042 Ga0075368_10120548 Ga0075368_101205481 201
223 3300006177 Ga0075362_10000766 Ga0075362_100007667 201
224 3300006178 Ga0075367_10021765 Ga0075367_100217654 201
225 3300006186 Ga0075369_10004800 Ga0075369_100048004 201
226 3300009148 Ga0105243_10227152 Ga0105243_102271522 201
227 3300025935 Ga0207709_10014445 Ga0207709_100144455 201
228 3300026116 Ga0207674_10205482 Ga0207674_102054823 201
229 3300028381 Ga0268264_10398200 Ga0268264_103982002 201
230 3300028794 Ga0307515_10006495 Ga0307515_100064954 201
231 3300031730 Ga0307516_10096888 Ga0307516_100968883 201
232 3300046474 Ga0495605_0154693 Ga0495605_0154693_72_677 201
233 3300050493 nmdc:mga0k408_28506_c1 nmdc:mga0k408_28506_c1_2431_3036 201
234 3300050493 nmdc:mga0k408_732_c1 nmdc:mga0k408_732_c1_14054_14659 201
235 3300050494 nmdc:mga06z11_43994_c1 nmdc:mga06z11_43994_c1_1016_1621 201
236 3300050496 nmdc:mga07m45_434_c1 nmdc:mga07m45_434_c1_7711_8316 201
237 3300050496 nmdc:mga07m45_46676_c1 nmdc:mga07m45_46676_c1_270_875 201
238 3300050496 nmdc:mga07m45_75677_c1 nmdc:mga07m45_75677_c1_363_968 201
239 3300046457 Ga0495590_0003199 Ga0495590_0003199_983_1591 202
240 3300048904 Ga0496101_0566805 Ga0496101_0566805_213_821 202
241 3300048917 Ga0496114_0294840 Ga0496114_0294840_278_886 202
242 3300050489 nmdc:mga03683_306291_c1 nmdc:mga03683_306291_c1_18_626 202
243 3300050493 nmdc:mga0k408_1729_c1 nmdc:mga0k408_1729_c1_355_963 202
244 3300041452 Ga0451793_0570148 Ga0451793_0570148_76_687 203
245 3300005356 Ga0070674_100034557 Ga0070674_1000345572 204
246 3300005356 Ga0070674_100334175 Ga0070674_1003341752 204
247 3300005543 Ga0070672_100028846 Ga0070672_1000288462 204
248 3300005543 Ga0070672_100336441 Ga0070672_1003364412 204
249 3300005616 Ga0068852_100081171 Ga0068852_1000811712 204
250 3300006173 Ga0070716_100482361 Ga0070716_1004823612 204
251 3300025901 Ga0207688_10081357 Ga0207688_100813571 204
252 3300025939 Ga0207665_10345241 Ga0207665_103452412 204
253 3300025940 Ga0207691_10070074 Ga0207691_100700744 204
254 3300025940 Ga0207691_10135301 Ga0207691_101353012 204
255 3300025972 Ga0207668_10030247 Ga0207668_100302474 204
256 3300026142 Ga0207698_10083685 Ga0207698_100836853 204
257 3300031456 Ga0307513_10059231 Ga0307513_100592312 204
258 3300032004 Ga0307414_10400247 Ga0307414_104002472 204
259 3300046519 Ga0495632_0049793 Ga0495632_0049793_267_881 204
260 3300046528 Ga0495642_0018831 Ga0495642_0018831_443_1057 204
261 3300046543 Ga0495645_0103562 Ga0495645_0103562_747_1361 204
262 3300046616 Ga0495668_0020830 Ga0495668_0020830_435_1049 204
263 3300046616 Ga0495668_0330294 Ga0495668_0330294_134_748 204
264 3300046648 Ga0495611_0089374 Ga0495611_0089374_518_1132 204
265 3300046694 Ga0495649_0001518 Ga0495649_0001518_8079_8693 204
266 3300048091 Ga0495626_0061141 Ga0495626_0061141_118_732 204
267 3300053134 Ga0500658_0003009 Ga0500658_0003009_2153_2767 204
268 3300053139 Ga0500568_0036624 Ga0500568_0036624_1176_1790 204
269 3300005329 Ga0070683_100237396 Ga0070683_1002373962 205
270 3300005331 Ga0070670_100079386 Ga0070670_1000793862 205
271 3300005354 Ga0070675_100139624 Ga0070675_1001396242 205
272 3300005355 Ga0070671_100011653 Ga0070671_1000116535 205
273 3300005356 Ga0070674_100051467 Ga0070674_1000514672 205
274 3300005456 Ga0070678_100026712 Ga0070678_1000267124 205
275 3300005841 Ga0068863_100845874 Ga0068863_1008458742 205
276 3300006237 Ga0097621_100207413 Ga0097621_1002074132 205
277 3300009148 Ga0105243_10806944 Ga0105243_108069442 205
278 3300009176 Ga0105242_11080540 Ga0105242_110805402 205
279 3300013102 Ga0157371_10376994 Ga0157371_103769942 205
280 3300013105 Ga0157369_10556974 Ga0157369_105569742 205
281 3300013296 Ga0157374_10276244 Ga0157374_102762442 205
282 3300013306 Ga0163162_10496402 Ga0163162_104964022 205
283 3300025893 Ga0207682_10074524 Ga0207682_100745242 205
284 3300025893 Ga0207682_10082870 Ga0207682_100828702 205
285 3300025923 Ga0207681_10340857 Ga0207681_103408572 205
286 3300025925 Ga0207650_10007691 Ga0207650_100076915 205
287 3300025925 Ga0207650_10096119 Ga0207650_100961192 205
288 3300025926 Ga0207659_10050556 Ga0207659_100505563 205
289 3300025926 Ga0207659_10222695 Ga0207659_102226952 205
290 3300025931 Ga0207644_10001435 Ga0207644_100014358 205
291 3300025932 Ga0207690_10280831 Ga0207690_102808312 205
292 3300025935 Ga0207709_10521079 Ga0207709_105210792 205
293 3300025937 Ga0207669_10218690 Ga0207669_102186902 205
294 3300025940 Ga0207691_10143124 Ga0207691_101431241 205
295 3300025940 Ga0207691_10274034 Ga0207691_102740342 205
296 3300025941 Ga0207711_10487187 Ga0207711_104871872 205
297 3300025960 Ga0207651_10250122 Ga0207651_102501222 205
298 3300025972 Ga0207668_10171801 Ga0207668_101718012 205
299 3300026088 Ga0207641_10085698 Ga0207641_100856983 205
300 3300026089 Ga0207648_10126487 Ga0207648_101264872 205
301 3300026095 Ga0207676_10208702 Ga0207676_102087023 205
302 3300026121 Ga0207683_10040448 Ga0207683_100404485 205
303 3300026121 Ga0207683_10092858 Ga0207683_100928583 205
304 3300031548 Ga0307408_100401301 Ga0307408_1004013012 205
305 3300031824 Ga0307413_10000382 Ga0307413_100003822 205
306 3300031852 Ga0307410_10214634 Ga0307410_102146342 205
307 3300031903 Ga0307407_10553340 Ga0307407_105533401 205
308 3300031995 Ga0307409_100110678 Ga0307409_1001106783 205
309 3300031995 Ga0307409_100297948 Ga0307409_1002979483 205
310 3300032005 Ga0307411_10046325 Ga0307411_100463252 205
311 3300035119 Ga0373956_0217390 Ga0373956_0217390_190_807 205
312 3300035170 Ga0373943_0148064 Ga0373943_0148064_40_657 205
313 3300035171 Ga0373946_0190814 Ga0373946_0190814_222_839 205
314 3300036401 Ga0373937_0122739 Ga0373937_0122739_100_717 205
315 3300046543 Ga0495645_0042282 Ga0495645_0042282_519_1136 205
316 3300046683 Ga0495658_0075594 Ga0495658_0075594_644_1261 205
317 3300047319 Ga0495674_0265755 Ga0495674_0265755_640_1257 205
318 3300047471 Ga0495684_0091526 Ga0495684_0091526_66_683 205
319 3300048913 Ga0496110_0783820 Ga0496110_0783820_61_684 205
320 3300050511 nmdc:mga08y16_640133_c1 nmdc:mga08y16_640133_c1_92_709 205
321 3300005328 Ga0070676_10186093 Ga0070676_101860932 206
322 3300005364 Ga0070673_100027067 Ga0070673_1000270674 206
323 3300005543 Ga0070672_100026453 Ga0070672_1000264533 206
324 3300005618 Ga0068864_100125334 Ga0068864_1001253343 206
325 3300005841 Ga0068863_100047492 Ga0068863_1000474923 206
326 3300006358 Ga0068871_100086480 Ga0068871_1000864803 206
327 3300013308 Ga0157375_10015776 Ga0157375_100157763 206
328 3300025907 Ga0207645_10040637 Ga0207645_100406372 206
329 3300025941 Ga0207711_10103709 Ga0207711_101037093 206
330 3300025960 Ga0207651_10036901 Ga0207651_100369013 206
331 3300026088 Ga0207641_10029108 Ga0207641_100291083 206
332 3300026089 Ga0207648_10112167 Ga0207648_101121673 206
333 3300026095 Ga0207676_10232318 Ga0207676_102323182 206
334 3300035695 Ga0373927_0231145 Ga0373927_0231145_395_1015 206
335 3300036401 Ga0373937_0184879 Ga0373937_0184879_372_992 206
336 3300037068 Ga0373925_0058875 Ga0373925_0058875_926_1546 206
337 3300046459 Ga0495629_0426595 Ga0495629_0426595_185_805 206
338 3300046477 Ga0495664_0405456 Ga0495664_0405456_108_728 206
339 3300046535 Ga0495586_0315633 Ga0495586_0315633_144_764 206
340 3300046681 Ga0495647_0009507 Ga0495647_0009507_2224_2844 206
341 3300053077 Ga0495601_0031942 Ga0495601_0031942_435_1055 206
342 3300053084 Ga0495595_0012992 Ga0495595_0012992_2099_2719 206
343 3300053085 Ga0495619_0046311 Ga0495619_0046311_226_846 206
344 3300005328 Ga0070676_10018036 Ga0070676_100180363 207
345 3300005333 Ga0070677_10067259 Ga0070677_100672592 207
346 3300005334 Ga0068869_100050335 Ga0068869_1000503353 207
347 3300005336 Ga0070680_100001873 Ga0070680_10000187313 207
348 3300005338 Ga0068868_100126480 Ga0068868_1001264802 207
349 3300005340 Ga0070689_100333187 Ga0070689_1003331871 207
350 3300005347 Ga0070668_100004749 Ga0070668_10000474911 207
351 3300005353 Ga0070669_100045796 Ga0070669_1000457963 207
352 3300005354 Ga0070675_100093079 Ga0070675_1000930791 207
353 3300005355 Ga0070671_100323279 Ga0070671_1003232792 207
354 3300005356 Ga0070674_100008402 Ga0070674_1000084023 207
355 3300005364 Ga0070673_100159435 Ga0070673_1001594353 207
356 3300005367 Ga0070667_100062553 Ga0070667_1000625533 207
357 3300005441 Ga0070700_100093275 Ga0070700_1000932753 207
358 3300005456 Ga0070678_100009576 Ga0070678_1000095765 207
359 3300005457 Ga0070662_100113728 Ga0070662_1001137282 207
360 3300005458 Ga0070681_10131220 Ga0070681_101312203 207
361 3300005459 Ga0068867_100012224 Ga0068867_1000122243 207
362 3300005530 Ga0070679_100006195 Ga0070679_1000061955 207
363 3300005543 Ga0070672_100033634 Ga0070672_1000336344 207
364 3300005543 Ga0070672_100053569 Ga0070672_1000535694 207
365 3300005617 Ga0068859_100098525 Ga0068859_1000985252 207
366 3300005618 Ga0068864_100153585 Ga0068864_1001535852 207
367 3300005718 Ga0068866_10032021 Ga0068866_100320213 207
368 3300005719 Ga0068861_100011784 Ga0068861_1000117842 207
369 3300005834 Ga0068851_10435552 Ga0068851_104355522 207
370 3300005841 Ga0068863_100031883 Ga0068863_1000318835 207
371 3300005842 Ga0068858_100056552 Ga0068858_1000565524 207
372 3300005843 Ga0068860_100014499 Ga0068860_1000144993 207
373 3300006931 Ga0097620_100098527 Ga0097620_1000985272 207
374 3300009148 Ga0105243_10043131 Ga0105243_100431312 207
375 3300009176 Ga0105242_10058685 Ga0105242_100586853 207
376 3300009177 Ga0105248_10852450 Ga0105248_108524502 207
377 3300009553 Ga0105249_10029780 Ga0105249_100297804 207
378 3300013306 Ga0163162_10009181 Ga0163162_100091813 207
379 3300013306 Ga0163162_10113717 Ga0163162_101137172 207
380 3300013308 Ga0157375_10024899 Ga0157375_100248994 207
381 3300014326 Ga0157380_10031042 Ga0157380_100310422 207
382 3300014968 Ga0157379_10017086 Ga0157379_100170861 207
383 3300014969 Ga0157376_10720584 Ga0157376_107205842 207
384 3300017792 Ga0163161_10017349 Ga0163161_100173491 207
385 3300017792 Ga0163161_10377334 Ga0163161_103773342 207
386 3300025321 Ga0207656_10306630 Ga0207656_103066302 207
387 3300025899 Ga0207642_10010087 Ga0207642_100100874 207
388 3300025901 Ga0207688_10176792 Ga0207688_101767922 207
389 3300025903 Ga0207680_10016228 Ga0207680_100162284 207
390 3300025907 Ga0207645_10007602 Ga0207645_100076025 207
391 3300025912 Ga0207707_10192524 Ga0207707_101925243 207
392 3300025921 Ga0207652_10002539 Ga0207652_1000253919 207
393 3300025923 Ga0207681_10011771 Ga0207681_100117715 207
394 3300025931 Ga0207644_10258179 Ga0207644_102581792 207
395 3300025933 Ga0207706_10021167 Ga0207706_100211671 207
396 3300025934 Ga0207686_10086564 Ga0207686_100865642 207
397 3300025934 Ga0207686_10097221 Ga0207686_100972212 207
398 3300025935 Ga0207709_10021946 Ga0207709_100219465 207
399 3300025938 Ga0207704_10045846 Ga0207704_100458462 207
400 3300025940 Ga0207691_10028125 Ga0207691_100281253 207
401 3300025940 Ga0207691_10069901 Ga0207691_100699013 207
402 3300025940 Ga0207691_10149866 Ga0207691_101498662 207
403 3300025942 Ga0207689_10015754 Ga0207689_100157544 207
404 3300025960 Ga0207651_10574790 Ga0207651_105747902 207
405 3300025961 Ga0207712_10068958 Ga0207712_100689583 207
406 3300025986 Ga0207658_10109869 Ga0207658_101098692 207
407 3300026023 Ga0207677_10087043 Ga0207677_100870432 207
408 3300026035 Ga0207703_10035556 Ga0207703_100355563 207
409 3300026075 Ga0207708_10594943 Ga0207708_105949432 207
410 3300026089 Ga0207648_10005079 Ga0207648_1000507911 207
411 3300026089 Ga0207648_10365619 Ga0207648_103656192 207
412 3300026095 Ga0207676_10019189 Ga0207676_100191892 207
413 3300026118 Ga0207675_100004297 Ga0207675_10000429711 207
414 3300026121 Ga0207683_10137739 Ga0207683_101377392 207
415 3300026142 Ga0207698_10017788 Ga0207698_100177883 207
416 3300026142 Ga0207698_10603726 Ga0207698_106037262 207
417 3300028380 Ga0268265_10054973 Ga0268265_100549731 207
418 3300028381 Ga0268264_10011851 Ga0268264_100118517 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

17

154

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4nwo-assembly1.cif.gz_A computationally designed two-component self-assembling tetrahedral cage t33-15 0.9642 15 194
8cuw-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9637 15 194
8cuu-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9616 15 194
8cuv-assembly1.cif.gz_A accurate computational design of genetically encoded 3d protein crystals 0.9612 15 196
3k6a-assembly2.cif.gz_B crystal structure of molybdenum cofactor biosynthesis protein mog from shewanella oneidensis 0.9607 15 195
ID Description Score Start End Superfamily
1di6A00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9397 13 200 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9373 13 179 3.40.980.10
4xcwB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9372 10 196 3.40.980.10
1di6A00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9347 13 200 3.40.980.10
4xcwB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9272 10 196 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A0Q6T2B2-F1-model_v4 MoaB/Mog domain-containing protein 0.9781 12 202 GO:0006777
AF-A0A401JHH7-F1-model_v4 Molybdopterin biosynthesis molybdochelatase MogA 0.9753 13 201 GO:0006777
AF-A0A437LRV1-F1-model_v4 Molybdopterin adenylyltransferase (EC 2.7.7.75) 0.9736 13 204 GO:0006777
GO:0061598
AF-A0A2E5F3T9-F1-model_v4 Molybdopterin adenylyltransferase 0.9686 15 189 GO:0006777
GO:0016779
AF-A0A536V3Y1-F1-model_v4 Molybdopterin adenylyltransferase (EC 2.7.7.75) 0.9681 12 143 GO:0006777
GO:0061598

Feature Viewer

pLDDT pTM Quality
84.72 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map