F439347

General Info

Members Datasets Scaffolds Average Seq Length
418 204 836 332

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0621208|Ga0436365_0621208_425_1552
Length 375
Sequence MGESDASGTDSPQTVAAKKSLDRRVQRYDAESMGEVGEADAWPRRHSPPATGRRTTANAADQAIIRTAGLTKVYSGADFTAVDRLDLTIRGGEIFGLLGPNGAGKTTTAGMLTTRIVPTGGTAHVGAVDVVANPALAKQLIGIVSQQNTLDRQLTVWENLYFHGRLFGISAAESRRLADEMLEQFHLTRWARASVYALSGGMAQRLMVARAILHRPAVLFLDEPTTGLDPQSRLALWEILGKLNADGQTIMLLTHYMEEAERLCDRVAIMDHGRILALDTPAALRKSVGADTVVTVKTVGDGGVLGGQLERDIDGVTRTRVIDGGVELHVNGVERIVPRVVAAADRQGFELLDLSVAEPTLETVFINLTGKELRE

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
65 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
100 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
101 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
104 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
203 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
204 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.28
Metatranscriptomes 0
Isolates 0.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 10.53
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0621208 3300039437 Bacteria 2453
2 Ga0070682_100044169 3300005337 Bacteria 2758
3 Ga0068868_100043194 3300005338 Bacteria 3520
4 Ga0070691_10029872 3300005341 Bacteria 2551
5 Ga0070675_100143556 3300005354 Bacteria 2042
6 Ga0070671_100174152 3300005355 Bacteria 1820
7 Ga0070674_100218607 3300005356 Bacteria 1481
8 Ga0070709_10009440 3300005434 Bacteria 5384
9 Ga0070714_100018656 3300005435 Bacteria 5640
10 Ga0070714_100120494 3300005435 Bacteria 2333
11 Ga0070713_100046846 3300005436 Bacteria 3550
12 Ga0070713_100100473 3300005436 Bacteria 2504
13 Ga0070710_10005345 3300005437 Bacteria 6091
14 Ga0070710_10010350 3300005437 Bacteria 4581
15 Ga0070708_100002175 3300005445 Bacteria 15134
16 Ga0070708_100064441 3300005445 Bacteria 3283
17 Ga0070708_100108686 3300005445 Bacteria 2547
18 Ga0070663_100065561 3300005455 Bacteria 2629
19 Ga0070681_10106894 3300005458 Bacteria 2739
20 Ga0070685_10009905 3300005466 Bacteria 4942
21 Ga0070706_100164203 3300005467 Bacteria 2074
22 Ga0070706_100188412 3300005467 Bacteria 1928
23 Ga0070707_100018691 3300005468 Bacteria 6522
24 Ga0070699_100043104 3300005518 Bacteria 3907
25 Ga0070684_100229746 3300005535 Bacteria 1694
26 Ga0070697_100028590 3300005536 Bacteria 4466
27 Ga0070665_100028260 3300005548 Bacteria 5648
28 Ga0070665_100254756 3300005548 Bacteria 1756
29 Ga0068855_100027439 3300005563 Bacteria 6810
30 Ga0070664_100062907 3300005564 Bacteria 3164
31 Ga0068857_100173527 3300005577 Bacteria 1960
32 Ga0068854_100097327 3300005578 Bacteria 2200
33 Ga0068856_100074776 3300005614 Bacteria 3355
34 Ga0068856_100076814 3300005614 Bacteria 3309
35 Ga0068856_100159598 3300005614 Bacteria 2265
36 Ga0068856_100273465 3300005614 Bacteria 1705
37 Ga0068852_100040663 3300005616 Bacteria 3924
38 Ga0068864_100000902 3300005618 Bacteria 24961
39 Ga0068864_100169593 3300005618 Bacteria 1989
40 Ga0068863_100023901 3300005841 Bacteria 5833
41 Ga0081538_10006441 3300005981 Bacteria 10334
42 Ga0081538_10053816 3300005981 Bacteria 2388
43 Ga0070717_10027307 3300006028 Bacteria 4562
44 Ga0070717_10076120 3300006028 Bacteria 2808
45 Ga0070717_10232703 3300006028 Bacteria 1623
46 Ga0070715_10010400 3300006163 Bacteria 3315
47 Ga0070715_10011386 3300006163 Bacteria 3202
48 Ga0070716_100008981 3300006173 Bacteria 4972
49 Ga0070716_100121456 3300006173 Bacteria 1636
50 Ga0070712_100035196 3300006175 Bacteria 3398
51 Ga0070712_100039518 3300006175 Bacteria 3229
52 Ga0070712_100285825 3300006175 Bacteria 1330
53 Ga0097621_100143398 3300006237 Bacteria 2043
54 Ga0068871_100072142 3300006358 Bacteria 2843
55 Ga0075428_100067659 3300006844 Bacteria 3909
56 Ga0075431_100017258 3300006847 Bacteria 7334
57 Ga0075431_100099433 3300006847 Bacteria 3002
58 Ga0075431_100218976 3300006847 Bacteria 1942
59 Ga0075433_10078471 3300006852 Bacteria 2909
60 Ga0075434_100047445 3300006871 Bacteria 4263
61 Ga0075434_100254854 3300006871 Bacteria 1774
62 Ga0075434_100262730 3300006871 Bacteria 1745
63 Ga0075434_100544693 3300006871 Bacteria 1180
64 Ga0075429_100014970 3300006880 Bacteria 6727
65 Ga0075435_100002057 3300007076 Bacteria 13182
66 Ga0075435_100023819 3300007076 Bacteria 4741
67 Ga0075435_100122634 3300007076 Bacteria 2170
68 Ga0105240_10141976 3300009093 Bacteria 2870
69 Ga0105245_10051144 3300009098 Bacteria 3704
70 Ga0105245_10089135 3300009098 Bacteria 2835
71 Ga0105247_10043672 3300009101 Bacteria 2747
72 Ga0105247_10178575 3300009101 Bacteria 1415
73 Ga0114129_10445247 3300009147 Bacteria 1700
74 Ga0114129_10482809 3300009147 Bacteria 1621
75 Ga0105243_10107466 3300009148 Bacteria 2327
76 Ga0105241_10003216 3300009174 Bacteria 12154
77 Ga0105242_10322644 3300009176 Bacteria 1417
78 Ga0105248_10020730 3300009177 Bacteria 7282
79 Ga0105248_10156033 3300009177 Bacteria 2576
80 Ga0105238_10053652 3300009551 Bacteria 4050
81 Ga0105249_10043324 3300009553 Bacteria 4094
82 Ga0105239_10030287 3300010375 Bacteria 5948
83 Ga0157370_10023293 3300013104 Bacteria 6149
84 Ga0157374_10021104 3300013296 Bacteria 5789
85 Ga0157374_10225416 3300013296 Bacteria 1840
86 Ga0157378_10122738 3300013297 Bacteria 2397
87 Ga0157372_10030409 3300013307 Bacteria 5909
88 Ga0163163_10003036 3300014325 Bacteria 14219
89 Ga0163163_10160164 3300014325 Bacteria 2296
90 Ga0157377_10032357 3300014745 Bacteria 2848
91 Ga0157379_10262957 3300014968 Bacteria 1568
92 Ga0157376_10520925 3300014969 Bacteria 1172
93 Ga0213874_10017186 3300021377 Bacteria 1936
94 Ga0213876_10003172 3300021384 Bacteria 9462
95 Ga0213876_10076824 3300021384 Bacteria 1764
96 Ga0213875_10013422 3300021388 Bacteria 4023
97 Ga0213875_10019596 3300021388 Bacteria 3255
98 Ga0213875_10051046 3300021388 Bacteria 1937
99 Ga0224572_1003019 3300024225 Bacteria 2794
100 Ga0207692_10005597 3300025898 Bacteria 5043
101 Ga0207710_10070193 3300025900 Bacteria 1605
102 Ga0207688_10047069 3300025901 Bacteria 2408
103 Ga0207685_10005805 3300025905 Bacteria 3299
104 Ga0207699_10002168 3300025906 Bacteria 9274
105 Ga0207699_10009918 3300025906 Bacteria 4762
106 Ga0207699_10055129 3300025906 Bacteria 2364
107 Ga0207707_10150561 3300025912 Bacteria 2034
108 Ga0207695_10003232 3300025913 Bacteria 23190
109 Ga0207671_10000467 3300025914 Bacteria 55193
110 Ga0207693_10040229 3300025915 Bacteria 3682
111 Ga0207693_10105385 3300025915 Bacteria 2211
112 Ga0207663_10005525 3300025916 Bacteria 6375
113 Ga0207663_10006412 3300025916 Bacteria 6018
114 Ga0207646_10041636 3300025922 Bacteria 4129
115 Ga0207694_10048631 3300025924 Bacteria 3281
116 Ga0207659_10122667 3300025926 Bacteria 1994
117 Ga0207687_10012380 3300025927 Bacteria 5574
118 Ga0207687_10134228 3300025927 Bacteria 1870
119 Ga0207700_10009583 3300025928 Bacteria 6062
120 Ga0207700_10010253 3300025928 Bacteria 5899
121 Ga0207700_10029989 3300025928 Bacteria 3846
122 Ga0207700_10060667 3300025928 Bacteria 2865
123 Ga0207700_10065180 3300025928 Bacteria 2778
124 Ga0207664_10000907 3300025929 Bacteria 20001
125 Ga0207664_10001500 3300025929 Bacteria 15305
126 Ga0207664_10003258 3300025929 Bacteria 10780
127 Ga0207664_10091804 3300025929 Bacteria 2491
128 Ga0207664_10125373 3300025929 Bacteria 2155
129 Ga0207664_10187457 3300025929 Bacteria 1779
130 Ga0207644_10068460 3300025931 Bacteria 2590
131 Ga0207665_10000364 3300025939 Bacteria 31349
132 Ga0207665_10000988 3300025939 Bacteria 19243
133 Ga0207665_10008965 3300025939 Bacteria 6567
134 Ga0207667_10026514 3300025949 Bacteria 6330
135 Ga0207667_10118387 3300025949 Bacteria 2729
136 Ga0207667_10221627 3300025949 Bacteria 1938
137 Ga0207712_10080039 3300025961 Bacteria 2375
138 Ga0207677_10079547 3300026023 Bacteria 2344
139 Ga0207678_10047637 3300026067 Bacteria 3706
140 Ga0207708_10015705 3300026075 Bacteria 5681
141 Ga0207702_10086656 3300026078 Bacteria 2732
142 Ga0207676_10014573 3300026095 Bacteria 5659
143 Ga0207674_10067145 3300026116 Bacteria 3611
144 Ga0207698_10049016 3300026142 Bacteria 3211
145 Ga0207698_10152339 3300026142 Bacteria 2009
146 Ga0207428_10057207 3300027907 Bacteria 3096
147 Ga0268266_10119953 3300028379 Bacteria 2340
148 Ga0265338_10001391 3300028800 Bacteria 39385
149 Ga0265338_10099914 3300028800 Bacteria 2368
150 Ga0265320_10050669 3300031240 Bacteria 2017
151 Ga0265327_10000524 3300031251 Bacteria 66279
152 Ga0265327_10002128 3300031251 Bacteria 21899
153 Ga0373926_0053986 3300035083 Bacteria 1455
154 Ga0373929_0018077 3300035085 Bacteria 1398
155 Ga0373934_0002192 3300035086 Bacteria 7177
156 Ga0373934_0045580 3300035086 Bacteria 1734
157 Ga0373949_0020006 3300035090 Bacteria 1529
158 Ga0373923_0020060 3300035111 Bacteria 2594
159 Ga0373923_0035876 3300035111 Bacteria 2021
160 Ga0373932_0002488 3300035112 Bacteria 4637
161 Ga0373936_0025337 3300035113 Bacteria 2319
162 Ga0373953_0003007 3300035117 Bacteria 5162
163 Ga0373953_0108210 3300035117 Bacteria 1174
164 Ga0373954_0084870 3300035118 Bacteria 1516
165 Ga0373956_0001203 3300035119 Bacteria 10695
166 Ga0373956_0027716 3300035119 Bacteria 2461
167 Ga0373956_0055478 3300035119 Bacteria 1787
168 Ga0373957_0000028 3300035120 Bacteria 37815
169 Ga0373955_0000018 3300035172 Bacteria 68313
170 Ga0373955_0058356 3300035172 Bacteria 2123
171 Ga0373942_0019940 3300035207 Bacteria 1679
172 Ga0373962_0032874 3300035242 Bacteria 1429
173 Ga0373924_0011318 3300035410 Bacteria 3311
174 Ga0373931_0000104 3300035691 Bacteria 38471
175 Ga0373931_0052496 3300035691 Bacteria 2173
176 Ga0373935_0045219 3300035692 Bacteria 2777
177 Ga0373935_0093193 3300035692 Bacteria 1975
178 Ga0373933_0000003 3300035724 Bacteria 150420
179 Ga0373933_0003236 3300035724 Bacteria 9090
180 Ga0373933_0067896 3300035724 Bacteria 2164
181 Ga0373933_0159727 3300035724 Bacteria 1430
182 Ga0373947_0086597 3300035725 Bacteria 1947
183 Ga0373947_0139625 3300035725 Bacteria 1553
184 Ga0373937_0000016 3300036401 Bacteria 145523
185 Ga0373937_0104109 3300036401 Bacteria 2637
186 Ga0373937_0130775 3300036401 Bacteria 2344
187 Ga0373925_0000338 3300037068 Bacteria 48691
188 Ga0373925_0021903 3300037068 Bacteria 4658
189 Ga0373925_0063917 3300037068 Bacteria 2769
190 Ga0373925_0167202 3300037068 Bacteria 1735
191 Ga0373925_0241867 3300037068 Bacteria 1445
192 Ga0436364_0027275 3300037853 Bacteria 23476
193 Ga0436364_0142963 3300037853 Bacteria 1533
194 Ga0436364_0304340 3300037853 Bacteria 1474
195 Ga0436364_0647454 3300037853 Bacteria 2213
196 Ga0436364_0790855 3300037853 Bacteria 6788
197 Ga0436364_0840900 3300037853 Bacteria 42362
198 Ga0436364_0894065 3300037853 Bacteria 5364
199 Ga0436364_1027085 3300037853 Bacteria 5580
200 Ga0436365_0025272 3300039437 Bacteria 37971
201 Ga0436365_0062040 3300039437 Bacteria 25145
202 Ga0436365_0889287 3300039437 Bacteria 6925
203 Ga0436360_0792215 3300039438 Bacteria 4659
204 Ga0436360_1179712 3300039438 Bacteria 1160
205 Ga0436360_1271145 3300039438 Bacteria 2753
206 Ga0436361_1006464 3300039447 Bacteria 4789
207 Ga0436363_0074161 3300039450 Bacteria 3605
208 Ga0436363_0172175 3300039450 Bacteria 1465
209 Ga0436363_0297583 3300039450 Bacteria 2389
210 Ga0436363_0582795 3300039450 Bacteria 5378
211 Ga0436363_0700550 3300039450 Bacteria 4935
212 Ga0436362_0686037 3300039453 Bacteria 4926
213 Ga0436362_0886472 3300039453 Bacteria 2046
214 Ga0436362_1083377 3300039453 Bacteria 1278
215 Ga0451853_2105550 3300041512 Bacteria 1337
216 Ga0466961_0038869 3300044693 Bacteria 3052
217 Ga0466963_0002619 3300044694 Bacteria 10102
218 Ga0466964_0046696 3300044706 Bacteria 1766
219 Ga0466970_0012689 3300044765 Bacteria 4310
220 Ga0466958_0091332 3300045836 Bacteria 1885
221 Ga0466967_0204960 3300045976 Bacteria 1869
222 Ga0466967_0217741 3300045976 Bacteria 1813
223 Ga0466967_0277645 3300045976 Bacteria 1607
224 Ga0466967_0282477 3300045976 Bacteria 1593
225 Ga0495592_0000631 3300046454 Bacteria 24536
226 Ga0495592_0014513 3300046454 Bacteria 5977
227 Ga0495592_0097278 3300046454 Bacteria 2102
228 Ga0495629_0009887 3300046459 Bacteria 6962
229 Ga0495629_0064320 3300046459 Bacteria 2561
230 Ga0495629_0176532 3300046459 Bacteria 1481
231 Ga0495641_0006822 3300046461 Bacteria 7316
232 Ga0495641_0043509 3300046461 Bacteria 2076
233 Ga0495641_0078021 3300046461 Bacteria 1484
234 Ga0495651_0000009 3300046462 Bacteria 150455
235 Ga0495651_0005164 3300046462 Bacteria 9957
236 Ga0495651_0007527 3300046462 Bacteria 8330
237 Ga0495651_0008182 3300046462 Bacteria 8022
238 Ga0495651_0027539 3300046462 Bacteria 4427
239 Ga0495651_0082873 3300046462 Bacteria 2419
240 Ga0495653_0000907 3300046463 Bacteria 22917
241 Ga0495653_0013872 3300046463 Bacteria 6568
242 Ga0495582_0025105 3300046473 Bacteria 3264
243 Ga0495639_0017076 3300046475 Bacteria 3151
244 Ga0495662_0033082 3300046476 Bacteria 2499
245 Ga0495662_0089237 3300046476 Bacteria 1502
246 Ga0495664_0017823 3300046477 Bacteria 4060
247 Ga0495664_0020588 3300046477 Bacteria 3805
248 Ga0495608_0000019 3300046511 Bacteria 180119
249 Ga0495608_0001472 3300046511 Bacteria 16727
250 Ga0495608_0002770 3300046511 Bacteria 12587
251 Ga0495608_0038399 3300046511 Bacteria 3215
252 Ga0495608_0072537 3300046511 Bacteria 2246
253 Ga0495608_0214741 3300046511 Bacteria 1208
254 Ga0495618_0000875 3300046514 Bacteria 20807
255 Ga0495618_0032694 3300046514 Bacteria 3258
256 Ga0495628_0040648 3300046516 Bacteria 3715
257 Ga0495628_0098976 3300046516 Bacteria 2252
258 Ga0495628_0122772 3300046516 Bacteria 1991
259 Ga0495630_0011291 3300046517 Bacteria 6463
260 Ga0495630_0140333 3300046517 Bacteria 1837
261 Ga0495652_0000082 3300046529 Bacteria 102163
262 Ga0495652_0056703 3300046529 Bacteria 3326
263 Ga0495652_0090011 3300046529 Bacteria 2511
264 Ga0495652_0157976 3300046529 Bacteria 1763
265 Ga0495665_0033038 3300046531 Bacteria 2767
266 Ga0495640_0012702 3300046533 Bacteria 6429
267 Ga0495640_0027923 3300046533 Bacteria 4065
268 Ga0495640_0154810 3300046533 Bacteria 1471
269 Ga0495586_0122589 3300046535 Bacteria 1452
270 Ga0495586_0143218 3300046535 Bacteria 1342
271 Ga0495587_0000056 3300046536 Bacteria 96726
272 Ga0495587_0003056 3300046536 Bacteria 11179
273 Ga0495587_0032135 3300046536 Bacteria 3174
274 Ga0495645_0000022 3300046543 Bacteria 137019
275 Ga0495645_0060371 3300046543 Bacteria 2748
276 Ga0495645_0105493 3300046543 Bacteria 1999
277 Ga0495645_0291540 3300046543 Bacteria 1069
278 Ga0495667_0000037 3300046559 Bacteria 133780
279 Ga0495667_0000901 3300046559 Bacteria 19170
280 Ga0495667_0003217 3300046559 Bacteria 10952
281 Ga0495667_0013319 3300046559 Bacteria 5566
282 Ga0495667_0015663 3300046559 Bacteria 5125
283 Ga0495667_0079748 3300046559 Bacteria 2128
284 Ga0495667_0110122 3300046559 Bacteria 1779
285 Ga0495634_0034218 3300046642 Bacteria 3488
286 Ga0495634_0051026 3300046642 Bacteria 2776
287 Ga0495634_0151194 3300046642 Bacteria 1468
288 Ga0495635_0001843 3300046663 Bacteria 14345
289 Ga0495635_0150410 3300046663 Bacteria 1585
290 Ga0495657_0000041 3300046675 Bacteria 115251
291 Ga0495657_0000043 3300046675 Bacteria 114089
292 Ga0495657_0004720 3300046675 Bacteria 10862
293 Ga0495657_0033870 3300046675 Bacteria 3552
294 Ga0495657_0038018 3300046675 Bacteria 3314
295 Ga0495657_0061253 3300046675 Bacteria 2489
296 Ga0495657_0127167 3300046675 Bacteria 1600
297 Ga0495599_0001235 3300046678 Bacteria 14497
298 Ga0495599_0010703 3300046678 Bacteria 5617
299 Ga0495599_0049679 3300046678 Bacteria 2629
300 Ga0495599_0072843 3300046678 Bacteria 2144
301 Ga0495599_0125661 3300046678 Bacteria 1594
302 Ga0495599_0163674 3300046678 Bacteria 1374
303 Ga0495623_0000176 3300046679 Bacteria 40029
304 Ga0495623_0045548 3300046679 Bacteria 2786
305 Ga0495623_0085733 3300046679 Bacteria 1942
306 Ga0495646_0000634 3300046680 Bacteria 19154
307 Ga0495646_0064475 3300046680 Bacteria 2171
308 Ga0495646_0085803 3300046680 Bacteria 1827
309 Ga0495646_0191298 3300046680 Bacteria 1118
310 Ga0495613_0028137 3300046689 Bacteria 4181
311 Ga0495624_0057835 3300046690 Bacteria 2437
312 Ga0495600_0008162 3300046809 Bacteria 6427
313 Ga0495600_0080842 3300046809 Bacteria 2121
314 Ga0495581_0017470 3300047315 Bacteria 4166
315 Ga0495581_0073547 3300047315 Bacteria 1978
316 Ga0495604_0000040 3300047317 Bacteria 120837
317 Ga0495604_0010995 3300047317 Bacteria 7186
318 Ga0495604_0018304 3300047317 Bacteria 5611
319 Ga0495604_0104576 3300047317 Bacteria 2074
320 Ga0495674_0002438 3300047319 Bacteria 18172
321 Ga0495674_0016342 3300047319 Bacteria 6920
322 Ga0495674_0042737 3300047319 Bacteria 4040
323 Ga0495674_0166686 3300047319 Bacteria 1840
324 Ga0495676_0027216 3300047321 Bacteria 4907
325 Ga0495680_0000010 3300047322 Bacteria 142931
326 Ga0495680_0009579 3300047322 Bacteria 8700
327 Ga0495680_0071168 3300047322 Bacteria 2649
328 Ga0495680_0102100 3300047322 Bacteria 2135
329 Ga0495680_0151776 3300047322 Bacteria 1688
330 Ga0495675_0065315 3300047444 Bacteria 2301
331 Ga0495675_0066449 3300047444 Bacteria 2279
332 Ga0495684_0012632 3300047471 Bacteria 6516
333 Ga0495684_0013431 3300047471 Bacteria 6303
334 Ga0495684_0057238 3300047471 Bacteria 2972
335 Ga0495593_0033662 3300047673 Bacteria 2790
336 Ga0495602_0000109 3300048088 Bacteria 79404
337 Ga0495602_0022118 3300048088 Bacteria 6232
338 Ga0495602_0040419 3300048088 Bacteria 4276
339 Ga0495602_0046015 3300048088 Bacteria 3945
340 Ga0496100_0017314 3300048903 Bacteria 4251
341 Ga0496100_0067144 3300048903 Bacteria 2381
342 Ga0496101_0027574 3300048904 Bacteria 3958
343 Ga0496101_0053393 3300048904 Bacteria 2916
344 Ga0496101_0091316 3300048904 Bacteria 2266
345 Ga0496102_0026477 3300048905 Bacteria 5173
346 Ga0496102_0234648 3300048905 Bacteria 1729
347 Ga0496104_0007677 3300048907 Bacteria 9549
348 Ga0496104_0019410 3300048907 Bacteria 6219
349 Ga0496104_0065122 3300048907 Bacteria 3457
350 Ga0496105_0018319 3300048908 Bacteria 5626
351 Ga0496105_0044150 3300048908 Bacteria 3675
352 Ga0496105_0064794 3300048908 Bacteria 3015
353 Ga0496105_0244773 3300048908 Bacteria 1454
354 Ga0496106_0117529 3300048909 Bacteria 2075
355 Ga0496106_0120995 3300048909 Bacteria 2046
356 Ga0496107_0111052 3300048910 Bacteria 2015
357 Ga0496107_0115985 3300048910 Bacteria 1971
358 Ga0496108_0004842 3300048911 Bacteria 10864
359 Ga0496108_0010879 3300048911 Bacteria 7388
360 Ga0496108_0013914 3300048911 Bacteria 6562
361 Ga0496108_0078600 3300048911 Bacteria 2792
362 Ga0496109_0028044 3300048912 Bacteria 5033
363 Ga0496109_0045595 3300048912 Bacteria 3979
364 Ga0496109_0082530 3300048912 Bacteria 2962
365 Ga0496109_0117424 3300048912 Bacteria 2476
366 Ga0496110_0003544 3300048913 Bacteria 11985
367 Ga0496110_0018023 3300048913 Bacteria 5915
368 Ga0496110_0148371 3300048913 Bacteria 2122
369 Ga0496110_0260180 3300048913 Bacteria 1579
370 Ga0496111_0003473 3300048914 Bacteria 9758
371 Ga0496111_0243667 3300048914 Bacteria 1335
372 Ga0496112_0001165 3300048915 Bacteria 19661
373 Ga0496112_0022970 3300048915 Bacteria 5951
374 Ga0496112_0106125 3300048915 Bacteria 2779
375 Ga0496112_0200941 3300048915 Bacteria 1952
376 Ga0496113_0003608 3300048916 Bacteria 9300
377 Ga0496113_0061481 3300048916 Bacteria 2834
378 Ga0496113_0148652 3300048916 Bacteria 1847
379 Ga0496113_0158700 3300048916 Bacteria 1787
380 Ga0496114_0041630 3300048917 Bacteria 3807
381 Ga0496114_0060059 3300048917 Bacteria 3177
382 Ga0496115_0029428 3300048918 Bacteria 4313
383 Ga0496115_0031224 3300048918 Bacteria 4195
384 Ga0501033_0008131 3300049570 Bacteria 8122
385 Ga0501047_0068332 3300049581 Bacteria 3422
386 Ga0501069_0000079 3300049585 Bacteria 47599
387 Ga0501069_0093804 3300049585 Bacteria 1698
388 Ga0501070_0000092 3300049586 Bacteria 76642
389 Ga0501080_0006341 3300049742 Bacteria 10612
390 Ga0501044_0013675 3300049823 Bacteria 8771
391 nmdc:mga0yw44_105088_c1 3300050492 Bacteria 1803
392 nmdc:mga05p37_317100_c1 3300050507 Bacteria 1846
393 nmdc:mga05p37_388019_c1 3300050507 Bacteria 1634
394 nmdc:mga09592_57303_c1 3300050508 Bacteria 3293
395 nmdc:mga06r32_642_c1 3300050510 Bacteria 30428
396 nmdc:mga06r32_67067_c1 3300050510 Bacteria 3464
397 nmdc:mga0n895_146232_c1 3300050512 Bacteria 2393
398 nmdc:mga0n895_39496_c1 3300050512 Bacteria 4579
399 nmdc:mga0rr50_24585_c1 3300050513 Bacteria 4174
400 nmdc:mga0rr50_30202_c1 3300050513 Bacteria 3834
401 nmdc:mga08x19_132697_c1 3300050514 Bacteria 1676
402 Ga0495601_0004765 3300053077 Bacteria 7868
403 Ga0495601_0020422 3300053077 Bacteria 4046
404 Ga0495601_0030726 3300053077 Bacteria 3337
405 Ga0495601_0059698 3300053077 Bacteria 2419
406 Ga0495612_0000103 3300053078 Bacteria 36230
407 Ga0495612_0020555 3300053078 Bacteria 2646
408 Ga0495612_0027207 3300053078 Bacteria 2299
409 Ga0495612_0050561 3300053078 Bacteria 1707
410 Ga0495595_0005406 3300053084 Bacteria 5173
411 Ga0495595_0013497 3300053084 Bacteria 3451
412 Ga0495595_0015195 3300053084 Bacteria 3280
413 Ga0495595_0036945 3300053084 Bacteria 2219
414 Ga0495619_0017143 3300053085 Bacteria 4589
415 Ga0500566_0000130 3300053094 Bacteria 38338
416 2819743816 2818991472 Bacteria 10089953
417 2997600109 2997600082 Bacteria 9896405
418 8025535322 8025530807 Bacteria 8495698
419 Ga0436365_0621208
420 Ga0070682_100044169
421 Ga0068868_100043194
422 Ga0070691_10029872
423 Ga0070675_100143556
424 Ga0070671_100174152
425 Ga0070674_100218607
426 Ga0070709_10009440
427 Ga0070714_100018656
428 Ga0070714_100120494
429 Ga0070713_100046846
430 Ga0070713_100100473
431 Ga0070710_10005345
432 Ga0070710_10010350
433 Ga0070708_100002175
434 Ga0070708_100064441
435 Ga0070708_100108686
436 Ga0070663_100065561
437 Ga0070681_10106894
438 Ga0070685_10009905
439 Ga0070706_100164203
440 Ga0070706_100188412
441 Ga0070707_100018691
442 Ga0070699_100043104
443 Ga0070684_100229746
444 Ga0070697_100028590
445 Ga0070665_100028260
446 Ga0070665_100254756
447 Ga0068855_100027439
448 Ga0070664_100062907
449 Ga0068857_100173527
450 Ga0068854_100097327
451 Ga0068856_100074776
452 Ga0068856_100076814
453 Ga0068856_100159598
454 Ga0068856_100273465
455 Ga0068852_100040663
456 Ga0068864_100000902
457 Ga0068864_100169593
458 Ga0068863_100023901
459 Ga0081538_10006441
460 Ga0081538_10053816
461 Ga0070717_10027307
462 Ga0070717_10076120
463 Ga0070717_10232703
464 Ga0070715_10010400
465 Ga0070715_10011386
466 Ga0070716_100008981
467 Ga0070716_100121456
468 Ga0070712_100035196
469 Ga0070712_100039518
470 Ga0070712_100285825
471 Ga0097621_100143398
472 Ga0068871_100072142
473 Ga0075428_100067659
474 Ga0075431_100017258
475 Ga0075431_100099433
476 Ga0075431_100218976
477 Ga0075433_10078471
478 Ga0075434_100047445
479 Ga0075434_100254854
480 Ga0075434_100262730
481 Ga0075434_100544693
482 Ga0075429_100014970
483 Ga0075435_100002057
484 Ga0075435_100023819
485 Ga0075435_100122634
486 Ga0105240_10141976
487 Ga0105245_10051144
488 Ga0105245_10089135
489 Ga0105247_10043672
490 Ga0105247_10178575
491 Ga0114129_10445247
492 Ga0114129_10482809
493 Ga0105243_10107466
494 Ga0105241_10003216
495 Ga0105242_10322644
496 Ga0105248_10020730
497 Ga0105248_10156033
498 Ga0105238_10053652
499 Ga0105249_10043324
500 Ga0105239_10030287
501 Ga0157370_10023293
502 Ga0157374_10021104
503 Ga0157374_10225416
504 Ga0157378_10122738
505 Ga0157372_10030409
506 Ga0163163_10003036
507 Ga0163163_10160164
508 Ga0157377_10032357
509 Ga0157379_10262957
510 Ga0157376_10520925
511 Ga0213874_10017186
512 Ga0213876_10003172
513 Ga0213876_10076824
514 Ga0213875_10013422
515 Ga0213875_10019596
516 Ga0213875_10051046
517 Ga0224572_1003019
518 Ga0207692_10005597
519 Ga0207710_10070193
520 Ga0207688_10047069
521 Ga0207685_10005805
522 Ga0207699_10002168
523 Ga0207699_10009918
524 Ga0207699_10055129
525 Ga0207707_10150561
526 Ga0207695_10003232
527 Ga0207671_10000467
528 Ga0207693_10040229
529 Ga0207693_10105385
530 Ga0207663_10005525
531 Ga0207663_10006412
532 Ga0207646_10041636
533 Ga0207694_10048631
534 Ga0207659_10122667
535 Ga0207687_10012380
536 Ga0207687_10134228
537 Ga0207700_10009583
538 Ga0207700_10010253
539 Ga0207700_10029989
540 Ga0207700_10060667
541 Ga0207700_10065180
542 Ga0207664_10000907
543 Ga0207664_10001500
544 Ga0207664_10003258
545 Ga0207664_10091804
546 Ga0207664_10125373
547 Ga0207664_10187457
548 Ga0207644_10068460
549 Ga0207665_10000364
550 Ga0207665_10000988
551 Ga0207665_10008965
552 Ga0207667_10026514
553 Ga0207667_10118387
554 Ga0207667_10221627
555 Ga0207712_10080039
556 Ga0207677_10079547
557 Ga0207678_10047637
558 Ga0207708_10015705
559 Ga0207702_10086656
560 Ga0207676_10014573
561 Ga0207674_10067145
562 Ga0207698_10049016
563 Ga0207698_10152339
564 Ga0207428_10057207
565 Ga0268266_10119953
566 Ga0265338_10001391
567 Ga0265338_10099914
568 Ga0265320_10050669
569 Ga0265327_10000524
570 Ga0265327_10002128
571 Ga0373926_0053986
572 Ga0373929_0018077
573 Ga0373934_0002192
574 Ga0373934_0045580
575 Ga0373949_0020006
576 Ga0373923_0020060
577 Ga0373923_0035876
578 Ga0373932_0002488
579 Ga0373936_0025337
580 Ga0373953_0003007
581 Ga0373953_0108210
582 Ga0373954_0084870
583 Ga0373956_0001203
584 Ga0373956_0027716
585 Ga0373956_0055478
586 Ga0373957_0000028
587 Ga0373955_0000018
588 Ga0373955_0058356
589 Ga0373942_0019940
590 Ga0373962_0032874
591 Ga0373924_0011318
592 Ga0373931_0000104
593 Ga0373931_0052496
594 Ga0373935_0045219
595 Ga0373935_0093193
596 Ga0373933_0000003
597 Ga0373933_0003236
598 Ga0373933_0067896
599 Ga0373933_0159727
600 Ga0373947_0086597
601 Ga0373947_0139625
602 Ga0373937_0000016
603 Ga0373937_0104109
604 Ga0373937_0130775
605 Ga0373925_0000338
606 Ga0373925_0021903
607 Ga0373925_0063917
608 Ga0373925_0167202
609 Ga0373925_0241867
610 Ga0436364_0027275
611 Ga0436364_0142963
612 Ga0436364_0304340
613 Ga0436364_0647454
614 Ga0436364_0790855
615 Ga0436364_0840900
616 Ga0436364_0894065
617 Ga0436364_1027085
618 Ga0436365_0025272
619 Ga0436365_0062040
620 Ga0436365_0889287
621 Ga0436360_0792215
622 Ga0436360_1179712
623 Ga0436360_1271145
624 Ga0436361_1006464
625 Ga0436363_0074161
626 Ga0436363_0172175
627 Ga0436363_0297583
628 Ga0436363_0582795
629 Ga0436363_0700550
630 Ga0436362_0686037
631 Ga0436362_0886472
632 Ga0436362_1083377
633 Ga0451853_2105550
634 Ga0466961_0038869
635 Ga0466963_0002619
636 Ga0466964_0046696
637 Ga0466970_0012689
638 Ga0466958_0091332
639 Ga0466967_0204960
640 Ga0466967_0217741
641 Ga0466967_0277645
642 Ga0466967_0282477
643 Ga0495592_0000631
644 Ga0495592_0014513
645 Ga0495592_0097278
646 Ga0495629_0009887
647 Ga0495629_0064320
648 Ga0495629_0176532
649 Ga0495641_0006822
650 Ga0495641_0043509
651 Ga0495641_0078021
652 Ga0495651_0000009
653 Ga0495651_0005164
654 Ga0495651_0007527
655 Ga0495651_0008182
656 Ga0495651_0027539
657 Ga0495651_0082873
658 Ga0495653_0000907
659 Ga0495653_0013872
660 Ga0495582_0025105
661 Ga0495639_0017076
662 Ga0495662_0033082
663 Ga0495662_0089237
664 Ga0495664_0017823
665 Ga0495664_0020588
666 Ga0495608_0000019
667 Ga0495608_0001472
668 Ga0495608_0002770
669 Ga0495608_0038399
670 Ga0495608_0072537
671 Ga0495608_0214741
672 Ga0495618_0000875
673 Ga0495618_0032694
674 Ga0495628_0040648
675 Ga0495628_0098976
676 Ga0495628_0122772
677 Ga0495630_0011291
678 Ga0495630_0140333
679 Ga0495652_0000082
680 Ga0495652_0056703
681 Ga0495652_0090011
682 Ga0495652_0157976
683 Ga0495665_0033038
684 Ga0495640_0012702
685 Ga0495640_0027923
686 Ga0495640_0154810
687 Ga0495586_0122589
688 Ga0495586_0143218
689 Ga0495587_0000056
690 Ga0495587_0003056
691 Ga0495587_0032135
692 Ga0495645_0000022
693 Ga0495645_0060371
694 Ga0495645_0105493
695 Ga0495645_0291540
696 Ga0495667_0000037
697 Ga0495667_0000901
698 Ga0495667_0003217
699 Ga0495667_0013319
700 Ga0495667_0015663
701 Ga0495667_0079748
702 Ga0495667_0110122
703 Ga0495634_0034218
704 Ga0495634_0051026
705 Ga0495634_0151194
706 Ga0495635_0001843
707 Ga0495635_0150410
708 Ga0495657_0000041
709 Ga0495657_0000043
710 Ga0495657_0004720
711 Ga0495657_0033870
712 Ga0495657_0038018
713 Ga0495657_0061253
714 Ga0495657_0127167
715 Ga0495599_0001235
716 Ga0495599_0010703
717 Ga0495599_0049679
718 Ga0495599_0072843
719 Ga0495599_0125661
720 Ga0495599_0163674
721 Ga0495623_0000176
722 Ga0495623_0045548
723 Ga0495623_0085733
724 Ga0495646_0000634
725 Ga0495646_0064475
726 Ga0495646_0085803
727 Ga0495646_0191298
728 Ga0495613_0028137
729 Ga0495624_0057835
730 Ga0495600_0008162
731 Ga0495600_0080842
732 Ga0495581_0017470
733 Ga0495581_0073547
734 Ga0495604_0000040
735 Ga0495604_0010995
736 Ga0495604_0018304
737 Ga0495604_0104576
738 Ga0495674_0002438
739 Ga0495674_0016342
740 Ga0495674_0042737
741 Ga0495674_0166686
742 Ga0495676_0027216
743 Ga0495680_0000010
744 Ga0495680_0009579
745 Ga0495680_0071168
746 Ga0495680_0102100
747 Ga0495680_0151776
748 Ga0495675_0065315
749 Ga0495675_0066449
750 Ga0495684_0012632
751 Ga0495684_0013431
752 Ga0495684_0057238
753 Ga0495593_0033662
754 Ga0495602_0000109
755 Ga0495602_0022118
756 Ga0495602_0040419
757 Ga0495602_0046015
758 Ga0496100_0017314
759 Ga0496100_0067144
760 Ga0496101_0027574
761 Ga0496101_0053393
762 Ga0496101_0091316
763 Ga0496102_0026477
764 Ga0496102_0234648
765 Ga0496104_0007677
766 Ga0496104_0019410
767 Ga0496104_0065122
768 Ga0496105_0018319
769 Ga0496105_0044150
770 Ga0496105_0064794
771 Ga0496105_0244773
772 Ga0496106_0117529
773 Ga0496106_0120995
774 Ga0496107_0111052
775 Ga0496107_0115985
776 Ga0496108_0004842
777 Ga0496108_0010879
778 Ga0496108_0013914
779 Ga0496108_0078600
780 Ga0496109_0028044
781 Ga0496109_0045595
782 Ga0496109_0082530
783 Ga0496109_0117424
784 Ga0496110_0003544
785 Ga0496110_0018023
786 Ga0496110_0148371
787 Ga0496110_0260180
788 Ga0496111_0003473
789 Ga0496111_0243667
790 Ga0496112_0001165
791 Ga0496112_0022970
792 Ga0496112_0106125
793 Ga0496112_0200941
794 Ga0496113_0003608
795 Ga0496113_0061481
796 Ga0496113_0148652
797 Ga0496113_0158700
798 Ga0496114_0041630
799 Ga0496114_0060059
800 Ga0496115_0029428
801 Ga0496115_0031224
802 Ga0501033_0008131
803 Ga0501047_0068332
804 Ga0501069_0000079
805 Ga0501069_0093804
806 Ga0501070_0000092
807 Ga0501080_0006341
808 Ga0501044_0013675
809 nmdc:mga0yw44_105088_c1
810 nmdc:mga05p37_317100_c1
811 nmdc:mga05p37_388019_c1
812 nmdc:mga09592_57303_c1
813 nmdc:mga06r32_642_c1
814 nmdc:mga06r32_67067_c1
815 nmdc:mga0n895_146232_c1
816 nmdc:mga0n895_39496_c1
817 nmdc:mga0rr50_24585_c1
818 nmdc:mga0rr50_30202_c1
819 nmdc:mga08x19_132697_c1
820 Ga0495601_0004765
821 Ga0495601_0020422
822 Ga0495601_0030726
823 Ga0495601_0059698
824 Ga0495612_0000103
825 Ga0495612_0020555
826 Ga0495612_0027207
827 Ga0495612_0050561
828 Ga0495595_0005406
829 Ga0495595_0013497
830 Ga0495595_0015195
831 Ga0495595_0036945
832 Ga0495619_0017143
833 Ga0500566_0000130
834 2819743816
835 2997600109
836 8025535322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

82

226

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9511 37 254
1vpl-assembly1.cif.gz_A-2 crystal structure of abc transporter atp-binding protein (tm0544) from thermotoga maritima at 2.10 a resolution 0.9469 38 264
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9413 37 254
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9383 39 258
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9362 38 258
ID Description Score Start End Superfamily
af_P9WQL9_1_244_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9795 35 262 3.40.50.300
af_Q9VVK6_333_568_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9659 37 264 3.40.50.300
af_A4I2P8_1496_1744_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9634 34 264 3.40.50.300
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9607 36 260 3.40.50.300
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9586 39 261 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A402BF34-F1-model_v4 Glycosyl transferase family 8 0.9794 37 261 GO:0005524
GO:0016740
GO:0016887
AF-A0A1I2M2I1-F1-model_v4 ABC-2 type transport system ATP-binding protein/oleandomycin transport system ATP-binding protein 0.9781 37 258 GO:0005524
GO:0016887
AF-A0A7C6CAI4-F1-model_v4 ABC transporter ATP-binding protein 0.9747 37 263 GO:0005524
GO:0016887
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9712 39 254 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A0U3H3Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9688 37 263 GO:0005524
GO:0016887

Map