metagRoot

F439269

General Info

Members	Datasets	Scaffolds	Average Seq Length
418	227	418	59

Family's Representative Sequence

Representative Sequence	3300006038\|Ga0075365_10120062\|Ga0075365_101200624
Length	59
Sequence	VADLVIKQVRSANGTNPKQRETLRPDTPELRGMLTVVDHLVEVDGERAGGDRPKAEASS

Samples

	Sample ID	Description	Type	Environment
1	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
2	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
3	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
4	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
7	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
8	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
9	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
10	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
13	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
14	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
15	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
16	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
17	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
18	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
19	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
20	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
21	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
22	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
23	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
24	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
25	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
26	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
27	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
28	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
29	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
30	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
31	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
32	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
33	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
34	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
35	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
36	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
37	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
38	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
39	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
40	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
41	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
42	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
43	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
44	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
45	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
46	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
47	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
48	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
49	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
50	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
51	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
52	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
53	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
54	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
55	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
56	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
57	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
58	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
59	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
60	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
62	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
63	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
64	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
65	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
66	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
67	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
68	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
69	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
70	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
71	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
72	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
73	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
74	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
75	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
76	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
77	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
78	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
79	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
80	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
109	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
111	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
112	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
113	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
114	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
115	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
116	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
117	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
118	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
119	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
120	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
121	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
122	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
123	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
124	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
125	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
126	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
127	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
128	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
129	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
130	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
131	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
132	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
133	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
134	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
135	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
136	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
137	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
138	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
139	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
140	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
141	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
142	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
143	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
144	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
145	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
146	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
147	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
148	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
149	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
150	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
151	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
152	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
153	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
154	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
155	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
156	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
157	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
158	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
159	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
160	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
161	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
162	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
163	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
164	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
165	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
166	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
167	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
168	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
169	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
170	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
171	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
172	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
173	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
174	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
175	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
176	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
177	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
178	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
179	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
180	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
181	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
182	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
183	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
184	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
185	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
186	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
187	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
188	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
189	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
190	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
191	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
192	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
193	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
194	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
195	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
196	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
197	3300049162	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
198	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
199	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
200	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
201	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
202	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
203	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
204	3300049670	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought	Metagenome	Rhizosphere
205	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
206	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
207	3300049768	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought	Metagenome	Rhizosphere
208	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
209	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
210	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
211	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
212	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
213	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
214	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
215	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
216	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
217	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
218	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
219	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
220	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
221	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
222	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
223	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
224	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
225	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
226	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
227	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.28
Metatranscriptomes	0.72
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.63
Nodule	0
Rhizoplane	12.44
Rhizosphere	83.25
Stem	0
Stem Tuber	0
Unclassified	1.67

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1000007	3300001977	Bacteria	20037
2	JGI24748J21848_1002459	3300002074	Bacteria	2088
3	JGI24034J26672_10000068	3300002239	Bacteria	28347
4	JGI25406J46586_10005035	3300003203	Bacteria	6138
5	Ga0070676_10577524	3300005328	Bacteria	808
6	Ga0070683_100266453	3300005329	Bacteria	1630
7	Ga0070683_100420127	3300005329	Bacteria	1275
8	Ga0070680_100075958	3300005336	Bacteria	2766
9	Ga0070680_101463436	3300005336	Bacteria	591
10	Ga0070682_100000009	3300005337	Bacteria	291635
11	Ga0070682_101184452	3300005337	Bacteria	644
12	Ga0070682_102015313	3300005337	Unclassified	508
13	Ga0070661_100670099	3300005344	Unclassified	843
14	Ga0070661_101612542	3300005344	Bacteria	549
15	Ga0070692_10346849	3300005345	Bacteria	921
16	Ga0070692_11083219	3300005345	Bacteria	565
17	Ga0070668_101267706	3300005347	Bacteria	669
18	Ga0070668_102234739	3300005347	Bacteria	506
19	Ga0070674_100000047	3300005356	Bacteria	52597
20	Ga0070674_100982827	3300005356	Unclassified	740
21	Ga0070667_100252495	3300005367	Bacteria	1577
22	Ga0070711_100013725	3300005439	Bacteria	5092
23	Ga0070700_100788739	3300005441	Bacteria	764
24	Ga0070694_100210729	3300005444	Bacteria	1453
25	Ga0070694_100411628	3300005444	Bacteria	1061
26	Ga0070694_101548799	3300005444	Bacteria	562
27	Ga0070663_100171657	3300005455	Bacteria	1677
28	Ga0070663_100344621	3300005455	Bacteria	1205
29	Ga0070662_100000007	3300005457	Bacteria	168761
30	Ga0070681_10030447	3300005458	Bacteria	5415
31	Ga0070681_12013839	3300005458	Bacteria	506
32	Ga0068867_100006857	3300005459	Bacteria	8056
33	Ga0070685_11043668	3300005466	Unclassified	615
34	Ga0070698_100353637	3300005471	Bacteria	1401
35	Ga0070679_100000190	3300005530	Bacteria	49809
36	Ga0070684_100010065	3300005535	Bacteria	7476
37	Ga0070684_100022207	3300005535	Bacteria	5289
38	Ga0070684_100494496	3300005535	Bacteria	1133
39	Ga0070684_100739970	3300005535	Bacteria	918
40	Ga0070684_101665959	3300005535	Unclassified	602
41	Ga0070697_100344732	3300005536	Bacteria	1286
42	Ga0068853_100011462	3300005539	Bacteria	7206
43	Ga0070686_100383428	3300005544	Bacteria	1065
44	Ga0070693_100017893	3300005547	Bacteria	3694
45	Ga0070665_100000022	3300005548	Bacteria	379286
46	Ga0070665_102317022	3300005548	Bacteria	540
47	Ga0070704_100209108	3300005549	Bacteria	1580
48	Ga0068855_100228442	3300005563	Bacteria	2085
49	Ga0070664_100119037	3300005564	Bacteria	2311
50	Ga0068856_100334287	3300005614	Bacteria	1533
51	Ga0068856_100582888	3300005614	Bacteria	1140
52	Ga0068856_100810326	3300005614	Bacteria	956
53	Ga0068852_101157282	3300005616	Bacteria	794
54	Ga0068852_102831676	3300005616	Bacteria	503
55	Ga0068866_10000274	3300005718	Bacteria	24536
56	Ga0068866_10031081	3300005718	Bacteria	2569
57	Ga0068866_10573783	3300005718	Bacteria	758
58	Ga0068861_101870591	3300005719	Bacteria	596
59	Ga0068870_10334425	3300005840	Bacteria	966
60	Ga0068863_100008951	3300005841	Bacteria	9775
61	Ga0068863_100701736	3300005841	Bacteria	1006
62	Ga0068858_100000150	3300005842	Bacteria	73075
63	Ga0081455_10171439	3300005937	Bacteria	1653
64	Ga0081455_11034216	3300005937	Unclassified	508
65	Ga0081538_10053161	3300005981	Bacteria	2411
66	Ga0081538_10276990	3300005981	Bacteria	625
67	Ga0081539_10001787	3300005985	Bacteria	34104
68	Ga0075365_10000565	3300006038	Bacteria	14356
69	Ga0075365_10120062	3300006038	Bacteria	1813
70	Ga0075364_10146054	3300006051	Bacteria	1592
71	Ga0075364_10151466	3300006051	Bacteria	1563
72	Ga0075364_10642650	3300006051	Bacteria	725
73	Ga0070716_101264237	3300006173	Unclassified	595
74	Ga0070712_101595163	3300006175	Unclassified	571
75	Ga0097621_100048344	3300006237	Bacteria	3451
76	Ga0068871_100893964	3300006358	Bacteria	823
77	Ga0075428_101143295	3300006844	Bacteria	822
78	Ga0075431_101331808	3300006847	Bacteria	678
79	Ga0075433_10907092	3300006852	Bacteria	769
80	Ga0075434_100409065	3300006871	Bacteria	1378
81	Ga0075434_101117770	3300006871	Unclassified	801
82	Ga0075429_100640079	3300006880	Bacteria	931
83	Ga0075429_101570429	3300006880	Bacteria	572
84	Ga0068865_100646016	3300006881	Bacteria	899
85	Ga0075435_101325153	3300007076	Unclassified	631
86	Ga0105240_10759145	3300009093	Unclassified	1054
87	Ga0105240_11636561	3300009093	Unclassified	673
88	Ga0111539_12237205	3300009094	Bacteria	634
89	Ga0111539_12730743	3300009094	Bacteria	572
90	Ga0105245_10576131	3300009098	Bacteria	1150
91	Ga0105245_10924081	3300009098	Bacteria	915
92	Ga0105245_12596059	3300009098	Bacteria	560
93	Ga0105247_11544438	3300009101	Unclassified	543
94	Ga0114129_10774119	3300009147	Bacteria	1226
95	Ga0114129_12243029	3300009147	Bacteria	656
96	Ga0114129_12768862	3300009147	Unclassified	583
97	Ga0105243_10608387	3300009148	Bacteria	1053
98	Ga0105243_12633450	3300009148	Bacteria	543
99	Ga0105242_10000123	3300009176	Bacteria	56900
100	Ga0105242_10148260	3300009176	Bacteria	2043
101	Ga0105237_10707060	3300009545	Bacteria	1014
102	Ga0105249_10263745	3300009553	Bacteria	1713
103	Ga0105249_10477581	3300009553	Bacteria	1289
104	Ga0105246_10977877	3300011119	Bacteria	765
105	Ga0105246_11716446	3300011119	Bacteria	597
106	Ga0105246_11849817	3300011119	Unclassified	578
107	Ga0157371_10977045	3300013102	Bacteria	645
108	Ga0157370_10747755	3300013104	Bacteria	891
109	Ga0157374_10009368	3300013296	Bacteria	8403
110	Ga0157374_10988345	3300013296	Bacteria	860
111	Ga0157378_11535788	3300013297	Bacteria	711
112	Ga0157378_12652202	3300013297	Bacteria	554
113	Ga0163162_10264211	3300013306	Bacteria	1852
114	Ga0163162_11527595	3300013306	Bacteria	761
115	Ga0157372_10619103	3300013307	Bacteria	1262
116	Ga0157375_10000126	3300013308	Bacteria	75410
117	Ga0157375_13576994	3300013308	Bacteria	517
118	Ga0163163_10253215	3300014325	Bacteria	1812
119	Ga0163163_10414950	3300014325	Bacteria	1405
120	Ga0163163_10569608	3300014325	Bacteria	1195
121	Ga0157380_10000560	3300014326	Bacteria	22835
122	Ga0157379_10037228	3300014968	Bacteria	4337
123	Ga0163161_10026094	3300017792	Bacteria	4139
124	Ga0163161_10717966	3300017792	Bacteria	833
125	Ga0163161_11722298	3300017792	Bacteria	556
126	Ga0206352_10489846	3300020078	Unclassified	545
127	Ga0207642_10000290	3300025899	Bacteria	15000
128	Ga0207642_10001731	3300025899	Bacteria	6725
129	Ga0207642_10697250	3300025899	Bacteria	639
130	Ga0207643_10112514	3300025908	Bacteria	1605
131	Ga0207707_10023272	3300025912	Bacteria	5421
132	Ga0207695_10516258	3300025913	Unclassified	1076
133	Ga0207693_10844301	3300025915	Bacteria	704
134	Ga0207663_10005211	3300025916	Bacteria	6542
135	Ga0207660_10037082	3300025917	Bacteria	3394
136	Ga0207660_10592458	3300025917	Bacteria	903
137	Ga0207657_11023264	3300025919	Bacteria	633
138	Ga0207649_10278763	3300025920	Bacteria	1215
139	Ga0207649_10960664	3300025920	Bacteria	671
140	Ga0207652_10000242	3300025921	Bacteria	56966
141	Ga0207687_11319302	3300025927	Bacteria	620
142	Ga0207686_10000066	3300025934	Bacteria	95095
143	Ga0207686_10023990	3300025934	Bacteria	3528
144	Ga0207686_10080456	3300025934	Bacteria	2124
145	Ga0207709_10305150	3300025935	Bacteria	1185
146	Ga0207709_11030708	3300025935	Bacteria	673
147	Ga0207669_10000002	3300025937	Bacteria	377651
148	Ga0207669_11149756	3300025937	Bacteria	656
149	Ga0207665_10601614	3300025939	Bacteria	858
150	Ga0207689_10435654	3300025942	Unclassified	1095
151	Ga0207661_10046081	3300025944	Bacteria	3456
152	Ga0207661_10071282	3300025944	Bacteria	2839
153	Ga0207661_10211568	3300025944	Bacteria	1709
154	Ga0207661_11223834	3300025944	Bacteria	691
155	Ga0207679_10093031	3300025945	Bacteria	2337
156	Ga0207667_10152193	3300025949	Bacteria	2381
157	Ga0207712_10877372	3300025961	Bacteria	792
158	Ga0207668_10793859	3300025972	Bacteria	838
159	Ga0207658_10221464	3300025986	Bacteria	1592
160	Ga0207703_10001133	3300026035	Bacteria	25156
161	Ga0207639_10373357	3300026041	Bacteria	1279
162	Ga0207639_11877788	3300026041	Bacteria	560
163	Ga0207678_10520547	3300026067	Bacteria	1038
164	Ga0207678_10941735	3300026067	Bacteria	764
165	Ga0207678_11437778	3300026067	Bacteria	609
166	Ga0207708_10430324	3300026075	Bacteria	1096
167	Ga0207708_10953353	3300026075	Bacteria	744
168	Ga0207702_10017871	3300026078	Bacteria	5869
169	Ga0207702_12471076	3300026078	Bacteria	506
170	Ga0207641_10015727	3300026088	Bacteria	6200
171	Ga0207641_10323129	3300026088	Bacteria	1464
172	Ga0207676_10000025	3300026095	Bacteria	261714
173	Ga0207675_100180723	3300026118	Bacteria	2020
174	Ga0207675_100257160	3300026118	Bacteria	1692
175	Ga0207675_100550960	3300026118	Bacteria	1152
176	Ga0207428_10056324	3300027907	Bacteria	3124
177	Ga0268266_10000029	3300028379	Bacteria	424015
178	Ga0307511_10328410	3300030521	Bacteria	671
179	Ga0265327_10167656	3300031251	Bacteria	1011
180	Ga0307408_102470279	3300031548	Bacteria	505
181	Ga0307405_10582799	3300031731	Bacteria	910
182	Ga0307405_11487619	3300031731	Bacteria	594
183	Ga0307413_10150888	3300031824	Bacteria	1619
184	Ga0307413_10654258	3300031824	Bacteria	867
185	Ga0307413_11874248	3300031824	Bacteria	538
186	Ga0307410_10076072	3300031852	Bacteria	2342
187	Ga0307410_10265144	3300031852	Bacteria	1341
188	Ga0307410_11235448	3300031852	Bacteria	652
189	Ga0307410_11509492	3300031852	Bacteria	592
190	Ga0307406_10050212	3300031901	Bacteria	2643
191	Ga0307406_10056823	3300031901	Bacteria	2508
192	Ga0307406_10371774	3300031901	Bacteria	1124
193	Ga0307406_10379176	3300031901	Bacteria	1114
194	Ga0307406_10396447	3300031901	Bacteria	1093
195	Ga0307406_10807956	3300031901	Bacteria	792
196	Ga0307407_10012271	3300031903	Bacteria	4112
197	Ga0307407_10077433	3300031903	Bacteria	2000
198	Ga0307407_10559618	3300031903	Bacteria	846
199	Ga0307412_10504294	3300031911	Bacteria	1008
200	Ga0307412_10602973	3300031911	Bacteria	930
201	Ga0307409_100480540	3300031995	Bacteria	1205
202	Ga0307409_101583424	3300031995	Bacteria	683
203	Ga0307409_102704994	3300031995	Bacteria	524
204	Ga0307416_100035326	3300032002	Bacteria	3815
205	Ga0307416_100111348	3300032002	Bacteria	2413
206	Ga0307416_100566595	3300032002	Bacteria	1211
207	Ga0307416_100802420	3300032002	Bacteria	1037
208	Ga0307416_101408627	3300032002	Bacteria	803
209	Ga0307416_101511301	3300032002	Bacteria	777
210	Ga0307416_101867958	3300032002	Bacteria	704
211	Ga0307414_10017391	3300032004	Bacteria	4398
212	Ga0307414_11338290	3300032004	Bacteria	665
213	Ga0307411_10047172	3300032005	Bacteria	2784
214	Ga0307411_11267396	3300032005	Bacteria	670
215	Ga0307411_11437669	3300032005	Bacteria	632
216	Ga0307415_100072262	3300032126	Bacteria	2429
217	Ga0307415_100109350	3300032126	Bacteria	2047
218	Ga0307415_100639639	3300032126	Bacteria	952
219	Ga0307415_102360076	3300032126	Bacteria	522
220	Ga0307415_102439031	3300032126	Bacteria	514
221	Ga0316583_10066737	3300032133	Bacteria	1259
222	Ga0373956_0135535	3300035119	Bacteria	1155
223	Ga0316574_0131462	3300035398	Bacteria	1611
224	Ga0373935_0586339	3300035692	Bacteria	815
225	Ga0373933_0414929	3300035724	Bacteria	879
226	Ga0373947_0722041	3300035725	Bacteria	680
227	Ga0373937_0046449	3300036401	Bacteria	3971
228	Ga0395899_0059904	3300037312	Bacteria	2806
229	Ga0395899_0455178	3300037312	Bacteria	837
230	Ga0395899_0880719	3300037312	Bacteria	547
231	Ga0395900_0026501	3300037418	Bacteria	5935
232	Ga0395900_0202893	3300037418	Bacteria	2005
233	Ga0395900_0874493	3300037418	Bacteria	823
234	Ga0395898_0009239	3300037466	Bacteria	10370
235	Ga0395898_0060897	3300037466	Bacteria	3667
236	Ga0395898_0065262	3300037466	Bacteria	3529
237	Ga0395898_0176334	3300037466	Bacteria	2043
238	Ga0395898_0224150	3300037466	Bacteria	1793
239	Ga0395905_0009415	3300037471	Bacteria	9550
240	Ga0395905_0504965	3300037471	Bacteria	1109
241	Ga0395905_0905330	3300037471	Bacteria	785
242	Ga0395901_0019973	3300038443	Bacteria	6854
243	Ga0395901_0302408	3300038443	Bacteria	1658
244	Ga0395901_0325229	3300038443	Bacteria	1590
245	Ga0395901_0538585	3300038443	Bacteria	1184
246	Ga0395901_0553062	3300038443	Bacteria	1166
247	Ga0395901_1558239	3300038443	Bacteria	615
248	Ga0451791_0502081	3300041451	Bacteria	679
249	Ga0451791_1380446	3300041451	Unclassified	634
250	Ga0451804_0494194	3300041463	Bacteria	703
251	Ga0451804_0667332	3300041463	Bacteria	519
252	Ga0451807_0325831	3300041486	Bacteria	782
253	Ga0451837_1703547	3300041494	Bacteria	528
254	Ga0451849_0238995	3300041505	Bacteria	571
255	Ga0451849_0644558	3300041505	Bacteria	2538
256	Ga0451853_1749816	3300041512	Bacteria	1279
257	Ga0451853_2729518	3300041512	Bacteria	1179
258	Ga0439440_0093104	3300042993	Bacteria	811
259	Ga0466957_0502483	3300044842	Bacteria	841
260	Ga0466960_0667195	3300044901	Bacteria	622
261	Ga0466967_0031612	3300045976	Bacteria	4458
262	Ga0466967_0051187	3300045976	Bacteria	3618
263	Ga0466967_0193173	3300045976	Bacteria	1925
264	Ga0466967_0448693	3300045976	Bacteria	1260
265	Ga0466967_1588462	3300045976	Bacteria	651
266	Ga0495603_0037721	3300046455	Bacteria	2899
267	Ga0495603_0150214	3300046455	Bacteria	1353
268	Ga0495603_0753152	3300046455	Bacteria	556
269	Ga0495629_0004371	3300046459	Bacteria	10589
270	Ga0495629_0007604	3300046459	Bacteria	7983
271	Ga0495629_0597387	3300046459	Bacteria	738
272	Ga0495641_0141595	3300046461	Bacteria	1074
273	Ga0495653_0094459	3300046463	Bacteria	2179
274	Ga0495662_0291497	3300046476	Bacteria	803
275	Ga0495608_0143930	3300046511	Bacteria	1521
276	Ga0495608_0641124	3300046511	Unclassified	635
277	Ga0495618_0766002	3300046514	Bacteria	564
278	Ga0495628_0232244	3300046516	Bacteria	1382
279	Ga0495628_0291644	3300046516	Bacteria	1209
280	Ga0495630_0000395	3300046517	Bacteria	34351
281	Ga0495643_0480656	3300046522	Bacteria	537
282	Ga0495652_0023756	3300046529	Bacteria	5433
283	Ga0495652_0104863	3300046529	Bacteria	2286
284	Ga0495652_0663330	3300046529	Bacteria	705
285	Ga0495640_0932189	3300046533	Unclassified	513
286	Ga0495586_0067497	3300046535	Bacteria	1950
287	Ga0495586_0185429	3300046535	Bacteria	1178
288	Ga0495645_0015381	3300046543	Bacteria	5441
289	Ga0495645_0163017	3300046543	Bacteria	1540
290	Ga0495667_0010689	3300046559	Bacteria	6207
291	Ga0495667_0073755	3300046559	Bacteria	2223
292	Ga0495634_0046880	3300046642	Bacteria	2915
293	Ga0495634_0257308	3300046642	Bacteria	1066
294	Ga0495634_0281963	3300046642	Bacteria	1009
295	Ga0495634_0545634	3300046642	Bacteria	676
296	Ga0495634_0776821	3300046642	Bacteria	547
297	Ga0495635_0046430	3300046663	Bacteria	2996
298	Ga0495635_0414390	3300046663	Bacteria	894
299	Ga0495588_0275755	3300046674	Bacteria	886
300	Ga0495657_0106116	3300046675	Bacteria	1784
301	Ga0495647_0349099	3300046681	Unclassified	673
302	Ga0495658_0528905	3300046683	Bacteria	755
303	Ga0495658_1033895	3300046683	Bacteria	524
304	Ga0495669_0488765	3300046684	Unclassified	598
305	Ga0495613_0525467	3300046689	Bacteria	794
306	Ga0495624_0712390	3300046690	Unclassified	595
307	Ga0495649_0004973	3300046694	Bacteria	8555
308	Ga0495600_0139375	3300046809	Bacteria	1574
309	Ga0495600_0787474	3300046809	Bacteria	567
310	Ga0495604_0161839	3300047317	Bacteria	1581
311	Ga0495672_0427747	3300047320	Bacteria	601
312	Ga0495676_0000522	3300047321	Bacteria	31518
313	Ga0495676_0127222	3300047321	Bacteria	1845
314	Ga0495680_0287999	3300047322	Bacteria	1156
315	Ga0495680_0313789	3300047322	Bacteria	1098
316	Ga0495675_0512390	3300047444	Bacteria	688
317	Ga0495675_0513993	3300047444	Bacteria	686
318	Ga0495679_020151	3300047446	Bacteria	2327
319	Ga0495684_1036570	3300047471	Bacteria	519
320	Ga0495602_0798022	3300048088	Bacteria	634
321	Ga0495614_0672830	3300048089	Bacteria	500
322	Ga0496100_0000028	3300048903	Bacteria	113912
323	Ga0496101_0000005	3300048904	Bacteria	331455
324	Ga0496102_0000021	3300048905	Bacteria	246920
325	Ga0496102_0294971	3300048905	Bacteria	1528
326	Ga0496102_0965428	3300048905	Bacteria	773
327	Ga0496103_0000001	3300048906	Bacteria	643471
328	Ga0496104_1531538	3300048907	Bacteria	570
329	Ga0496106_0000070	3300048909	Bacteria	82770
330	Ga0496106_1138939	3300048909	Bacteria	610
331	Ga0496107_0000004	3300048910	Bacteria	297680
332	Ga0496108_0109470	3300048911	Bacteria	2361
333	Ga0496108_0110386	3300048911	Bacteria	2351
334	Ga0496108_1139393	3300048911	Bacteria	661
335	Ga0496108_1228243	3300048911	Bacteria	633
336	Ga0496109_0043843	3300048912	Bacteria	4055
337	Ga0496109_0099010	3300048912	Bacteria	2704
338	Ga0496109_0324425	3300048912	Bacteria	1453
339	Ga0496109_0457066	3300048912	Bacteria	1206
340	Ga0496109_0556254	3300048912	Bacteria	1082
341	Ga0496110_0035533	3300048913	Bacteria	4324
342	Ga0496110_0056185	3300048913	Bacteria	3464
343	Ga0496110_0533202	3300048913	Bacteria	1067
344	Ga0496110_0718173	3300048913	Bacteria	901
345	Ga0496110_0799884	3300048913	Bacteria	847
346	Ga0496111_0011147	3300048914	Bacteria	6052
347	Ga0496111_0262639	3300048914	Bacteria	1281
348	Ga0496111_0309359	3300048914	Bacteria	1171
349	Ga0496111_0414587	3300048914	Unclassified	995
350	Ga0496111_0425153	3300048914	Bacteria	981
351	Ga0496111_0892346	3300048914	Bacteria	640
352	Ga0496112_0000002	3300048915	Bacteria	782039
353	Ga0496112_0047484	3300048915	Bacteria	4212
354	Ga0496112_0193132	3300048915	Bacteria	1997
355	Ga0496112_0200149	3300048915	Bacteria	1957
356	Ga0496112_0251531	3300048915	Bacteria	1718
357	Ga0496112_0384492	3300048915	Bacteria	1344
358	Ga0496112_0401526	3300048915	Bacteria	1310
359	Ga0496112_1342952	3300048915	Bacteria	630
360	Ga0496113_0043533	3300048916	Bacteria	3323
361	Ga0496113_0109302	3300048916	Bacteria	2150
362	Ga0496113_0170822	3300048916	Bacteria	1722
363	Ga0496113_0371659	3300048916	Bacteria	1147
364	Ga0496113_0436603	3300048916	Bacteria	1052
365	Ga0496113_0509386	3300048916	Bacteria	966
366	Ga0496114_0000097	3300048917	Bacteria	63410
367	Ga0496114_0028056	3300048917	Bacteria	4617
368	Ga0496115_0000151	3300048918	Bacteria	64493
369	Ga0496126_1148564	3300048929	Bacteria	574
370	Ga0501307_030938	3300049162	Bacteria	742
371	Ga0501037_0959628	3300049573	Bacteria	558
372	Ga0501042_0451280	3300049578	Bacteria	932
373	Ga0501042_0625675	3300049578	Bacteria	783
374	Ga0501042_0879839	3300049578	Bacteria	652
375	Ga0501072_0487084	3300049588	Bacteria	976
376	Ga0501073_0797602	3300049589	Bacteria	651
377	Ga0501076_0727920	3300049592	Bacteria	819
378	Ga0501076_1146500	3300049592	Bacteria	640
379	Ga0501199_052667	3300049650	Bacteria	553
380	Ga0501236_127188	3300049670	Bacteria	523
381	Ga0501243_026256	3300049675	Bacteria	980
382	Ga0501243_054672	3300049675	Bacteria	728
383	Ga0501079_0546615	3300049741	Bacteria	911
384	Ga0501271_028854	3300049768	Bacteria	677
385	Ga0501045_1393707	3300049824	Unclassified	509
386	nmdc:mga00v17_5520_c1	3300050491	Bacteria	6664
387	nmdc:mga0yw44_1146537_c1	3300050492	Bacteria	525
388	nmdc:mga0yw44_51739_c1	3300050492	Bacteria	2488
389	nmdc:mga0yw44_5534_c1	3300050492	Bacteria	4531
390	nmdc:mga05p37_466910_c1	3300050507	Bacteria	1457
391	nmdc:mga09592_1130912_c1	3300050508	Bacteria	650
392	nmdc:mga0qj67_1053815_c1	3300050509	Bacteria	636
393	nmdc:mga06r32_316088_c1	3300050510	Bacteria	1547
394	nmdc:mga08y16_32980_c1	3300050511	Bacteria	5442
395	nmdc:mga0n895_1679120_c1	3300050512	Bacteria	598
396	nmdc:mga0n895_457258_c1	3300050512	Bacteria	1288
397	nmdc:mga08x19_837006_c1	3300050514	Bacteria	654
398	nmdc:mga0a205_1326879_c1	3300050515	Bacteria	567
399	Ga0495601_0049036	3300053077	Bacteria	2661
400	Ga0495601_0159221	3300053077	Bacteria	1475
401	Ga0495601_0741820	3300053077	Unclassified	625
402	Ga0495612_0000820	3300053078	Bacteria	12636
403	Ga0495612_0057248	3300053078	Bacteria	1609
404	Ga0495612_0110676	3300053078	Bacteria	1175
405	Ga0495655_0000013	3300053083	Bacteria	63264
406	Ga0495655_0129589	3300053083	Bacteria	776
407	Ga0495619_0001945	3300053085	Bacteria	13767
408	Ga0495619_0005994	3300053085	Bacteria	7695
409	Ga0495619_0007307	3300053085	Bacteria	6996
410	Ga0495619_0020941	3300053085	Bacteria	4170
411	Ga0495619_0275624	3300053085	Bacteria	1165
412	Ga0495619_0707248	3300053085	Bacteria	685
413	Ga0500566_0001523	3300053094	Bacteria	13612
414	Ga0500628_000045	3300053129	Bacteria	45042
415	Ga0587083_0108806	3300059505	Bacteria	701
416	Ga0501082_1293273	3300060353	Bacteria	637
417	Ga0501082_1524015	3300060353	Bacteria	584
418	Ga0530510_1221634	3300061734	Bacteria	576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006038	Ga0075365_10120062	Ga0075365_101200624	43
2	3300006051	Ga0075364_10151466	Ga0075364_101514663	43
3	3300050492	nmdc:mga0yw44_5534_c1	nmdc:mga0yw44_5534_c1_3903_4121	43
4	3300005444	Ga0070694_100411628	Ga0070694_1004116283	53
5	3300005457	Ga0070662_100000007	Ga0070662_10000000744	53
6	3300005459	Ga0068867_100006857	Ga0068867_1000068576	53
7	3300005466	Ga0070685_11043668	Ga0070685_110436682	53
8	3300005547	Ga0070693_100017893	Ga0070693_1000178933	53
9	3300005614	Ga0068856_100810326	Ga0068856_1008103261	53
10	3300005616	Ga0068852_101157282	Ga0068852_1011572822	53
11	3300007076	Ga0075435_101325153	Ga0075435_1013251532	53
12	3300014325	Ga0163163_10414950	Ga0163163_104149502	53
13	3300014968	Ga0157379_10037228	Ga0157379_100372282	53
14	3300005439	Ga0070711_100013725	Ga0070711_1000137256	54
15	3300006175	Ga0070712_101595163	Ga0070712_1015951632	54
16	3300009545	Ga0105237_10707060	Ga0105237_107070603	54
17	3300025915	Ga0207693_10844301	Ga0207693_108443012	54
18	3300025916	Ga0207663_10005211	Ga0207663_100052116	54
19	3300032133	Ga0316583_10066737	Ga0316583_100667372	54
20	3300045976	Ga0466967_0448693	Ga0466967_0448693_855_1028	54
21	3300046455	Ga0495603_0037721	Ga0495603_0037721_1947_2117	54
22	3300050515	nmdc:mga0a205_1326879_c1	nmdc:mga0a205_1326879_c1_360_530	54
23	3300005328	Ga0070676_10577524	Ga0070676_105775242	55
24	3300005329	Ga0070683_100266453	Ga0070683_1002664531	55
25	3300005345	Ga0070692_10346849	Ga0070692_103468492	55
26	3300005347	Ga0070668_101267706	Ga0070668_1012677062	55
27	3300005444	Ga0070694_100210729	Ga0070694_1002107291	55
28	3300005471	Ga0070698_100353637	Ga0070698_1003536373	55
29	3300005535	Ga0070684_100010065	Ga0070684_10001006513	55
30	3300006038	Ga0075365_10000565	Ga0075365_1000056522	55
31	3300006051	Ga0075364_10146054	Ga0075364_101460542	55
32	3300006173	Ga0070716_101264237	Ga0070716_1012642372	55
33	3300006880	Ga0075429_101570429	Ga0075429_1015704291	55
34	3300009148	Ga0105243_10608387	Ga0105243_106083872	55
35	3300009553	Ga0105249_10477581	Ga0105249_104775812	55
36	3300013306	Ga0163162_11527595	Ga0163162_115275952	55
37	3300014326	Ga0157380_10000560	Ga0157380_100005603	55
38	3300025939	Ga0207665_10601614	Ga0207665_106016142	55
39	3300025944	Ga0207661_10211568	Ga0207661_102115681	55
40	3300025972	Ga0207668_10793859	Ga0207668_107938592	55
41	3300026067	Ga0207678_10941735	Ga0207678_109417352	55
42	3300026075	Ga0207708_10953353	Ga0207708_109533532	55
43	3300031852	Ga0307410_10265144	Ga0307410_102651442	55
44	3300031852	Ga0307410_11509492	Ga0307410_115094922	55
45	3300031903	Ga0307407_10077433	Ga0307407_100774334	55
46	3300031911	Ga0307412_10602973	Ga0307412_106029733	55
47	3300031995	Ga0307409_100480540	Ga0307409_1004805403	55
48	3300032002	Ga0307416_100111348	Ga0307416_1001113482	55
49	3300032126	Ga0307415_100072262	Ga0307415_1000722625	55
50	3300037418	Ga0395900_0026501	Ga0395900_0026501_1436_1639	55
51	3300037466	Ga0395898_0009239	Ga0395898_0009239_4481_4684	55
52	3300037466	Ga0395898_0224150	Ga0395898_0224150_67_279	55
53	3300037471	Ga0395905_0009415	Ga0395905_0009415_4435_4638	55
54	3300038443	Ga0395901_0019973	Ga0395901_0019973_4156_4359	55
55	3300038443	Ga0395901_0538585	Ga0395901_0538585_492_704	55
56	3300047320	Ga0495672_0427747	Ga0495672_0427747_375_548	55
57	3300048915	Ga0496112_0000002	Ga0496112_0000002_225568_225744	55
58	3300048916	Ga0496113_0436603	Ga0496113_0436603_467_643	55
59	3300049675	Ga0501243_026256	Ga0501243_026256_118_291	55
60	3300049768	Ga0501271_028854	Ga0501271_028854_388_561	55
61	3300050491	nmdc:mga00v17_5520_c1	nmdc:mga00v17_5520_c1_2373_2561	55
62	3300050492	nmdc:mga0yw44_51739_c1	nmdc:mga0yw44_51739_c1_1173_1361	55
63	3300001977	JGI24746J21847_1000007	JGI24746J21847_100000723	56
64	3300002074	JGI24748J21848_1002459	JGI24748J21848_10024592	56
65	3300002239	JGI24034J26672_10000068	JGI24034J26672_100000689	56
66	3300003203	JGI25406J46586_10005035	JGI25406J46586_1000503514	56
67	3300005329	Ga0070683_100420127	Ga0070683_1004201272	56
68	3300005336	Ga0070680_100075958	Ga0070680_1000759583	56
69	3300005336	Ga0070680_101463436	Ga0070680_1014634362	56
70	3300005337	Ga0070682_100000009	Ga0070682_100000009280	56
71	3300005337	Ga0070682_101184452	Ga0070682_1011844522	56
72	3300005337	Ga0070682_102015313	Ga0070682_1020153132	56
73	3300005344	Ga0070661_100670099	Ga0070661_1006700992	56
74	3300005344	Ga0070661_101612542	Ga0070661_1016125422	56
75	3300005345	Ga0070692_11083219	Ga0070692_110832192	56
76	3300005347	Ga0070668_102234739	Ga0070668_1022347392	56
77	3300005356	Ga0070674_100000047	Ga0070674_10000004729	56
78	3300005356	Ga0070674_100982827	Ga0070674_1009828272	56
79	3300005367	Ga0070667_100252495	Ga0070667_1002524953	56
80	3300005441	Ga0070700_100788739	Ga0070700_1007887392	56
81	3300005444	Ga0070694_101548799	Ga0070694_1015487992	56
82	3300005455	Ga0070663_100171657	Ga0070663_1001716572	56
83	3300005455	Ga0070663_100344621	Ga0070663_1003446213	56
84	3300005458	Ga0070681_10030447	Ga0070681_100304474	56
85	3300005458	Ga0070681_12013839	Ga0070681_120138391	56
86	3300005530	Ga0070679_100000190	Ga0070679_10000019013	56
87	3300005535	Ga0070684_100022207	Ga0070684_1000222075	56
88	3300005535	Ga0070684_100494496	Ga0070684_1004944963	56
89	3300005535	Ga0070684_100739970	Ga0070684_1007399701	56
90	3300005535	Ga0070684_101665959	Ga0070684_1016659592	56
91	3300005536	Ga0070697_100344732	Ga0070697_1003447323	56
92	3300005539	Ga0068853_100011462	Ga0068853_1000114629	56
93	3300005544	Ga0070686_100383428	Ga0070686_1003834282	56
94	3300005548	Ga0070665_100000022	Ga0070665_100000022388	56
95	3300005548	Ga0070665_102317022	Ga0070665_1023170222	56
96	3300005549	Ga0070704_100209108	Ga0070704_1002091082	56
97	3300005563	Ga0068855_100228442	Ga0068855_1002284422	56
98	3300005564	Ga0070664_100119037	Ga0070664_1001190373	56
99	3300005614	Ga0068856_100334287	Ga0068856_1003342873	56
100	3300005614	Ga0068856_100582888	Ga0068856_1005828882	56
101	3300005616	Ga0068852_102831676	Ga0068852_1028316762	56
102	3300005718	Ga0068866_10000274	Ga0068866_1000027411	56
103	3300005718	Ga0068866_10031081	Ga0068866_100310814	56
104	3300005718	Ga0068866_10573783	Ga0068866_105737832	56
105	3300005719	Ga0068861_101870591	Ga0068861_1018705912	56
106	3300005840	Ga0068870_10334425	Ga0068870_103344252	56
107	3300005841	Ga0068863_100008951	Ga0068863_1000089512	56
108	3300005841	Ga0068863_100701736	Ga0068863_1007017362	56
109	3300005842	Ga0068858_100000150	Ga0068858_10000015029	56
110	3300005937	Ga0081455_10171439	Ga0081455_101714393	56
111	3300005937	Ga0081455_11034216	Ga0081455_110342162	56
112	3300005981	Ga0081538_10053161	Ga0081538_100531613	56
113	3300005981	Ga0081538_10276990	Ga0081538_102769902	56
114	3300005985	Ga0081539_10001787	Ga0081539_1000178732	56
115	3300006051	Ga0075364_10642650	Ga0075364_106426502	56
116	3300006237	Ga0097621_100048344	Ga0097621_1000483443	56
117	3300006358	Ga0068871_100893964	Ga0068871_1008939642	56
118	3300006844	Ga0075428_101143295	Ga0075428_1011432952	56
119	3300006847	Ga0075431_101331808	Ga0075431_1013318082	56
120	3300006852	Ga0075433_10907092	Ga0075433_109070921	56
121	3300006871	Ga0075434_100409065	Ga0075434_1004090653	56
122	3300006871	Ga0075434_101117770	Ga0075434_1011177702	56
123	3300006880	Ga0075429_100640079	Ga0075429_1006400792	56
124	3300006881	Ga0068865_100646016	Ga0068865_1006460162	56
125	3300009093	Ga0105240_10759145	Ga0105240_107591452	56
126	3300009093	Ga0105240_11636561	Ga0105240_116365611	56
127	3300009094	Ga0111539_12237205	Ga0111539_122372052	56
128	3300009094	Ga0111539_12730743	Ga0111539_127307432	56
129	3300009098	Ga0105245_10576131	Ga0105245_105761312	56
130	3300009098	Ga0105245_10924081	Ga0105245_109240813	56
131	3300009098	Ga0105245_12596059	Ga0105245_125960592	56
132	3300009101	Ga0105247_11544438	Ga0105247_115444382	56
133	3300009147	Ga0114129_10774119	Ga0114129_107741193	56
134	3300009147	Ga0114129_12243029	Ga0114129_122430292	56
135	3300009147	Ga0114129_12768862	Ga0114129_127688621	56
136	3300009148	Ga0105243_12633450	Ga0105243_126334502	56
137	3300009176	Ga0105242_10000123	Ga0105242_1000012321	56
138	3300009176	Ga0105242_10148260	Ga0105242_101482604	56
139	3300009553	Ga0105249_10263745	Ga0105249_102637452	56
140	3300011119	Ga0105246_10977877	Ga0105246_109778772	56
141	3300011119	Ga0105246_11716446	Ga0105246_117164462	56
142	3300011119	Ga0105246_11849817	Ga0105246_118498172	56
143	3300013102	Ga0157371_10977045	Ga0157371_109770452	56
144	3300013104	Ga0157370_10747755	Ga0157370_107477553	56
145	3300013296	Ga0157374_10009368	Ga0157374_100093684	56
146	3300013296	Ga0157374_10988345	Ga0157374_109883452	56
147	3300013297	Ga0157378_11535788	Ga0157378_115357882	56
148	3300013297	Ga0157378_12652202	Ga0157378_126522022	56
149	3300013306	Ga0163162_10264211	Ga0163162_102642113	56
150	3300013307	Ga0157372_10619103	Ga0157372_106191033	56
151	3300013308	Ga0157375_10000126	Ga0157375_1000012622	56
152	3300013308	Ga0157375_13576994	Ga0157375_135769942	56
153	3300014325	Ga0163163_10253215	Ga0163163_102532152	56
154	3300014325	Ga0163163_10569608	Ga0163163_105696082	56
155	3300017792	Ga0163161_10026094	Ga0163161_100260945	56
156	3300017792	Ga0163161_10717966	Ga0163161_107179662	56
157	3300017792	Ga0163161_11722298	Ga0163161_117222981	56
158	3300020078	Ga0206352_10489846	Ga0206352_104898462	56
159	3300025899	Ga0207642_10000290	Ga0207642_1000029019	56
160	3300025899	Ga0207642_10001731	Ga0207642_100017313	56
161	3300025899	Ga0207642_10697250	Ga0207642_106972502	56
162	3300025908	Ga0207643_10112514	Ga0207643_101125143	56
163	3300025912	Ga0207707_10023272	Ga0207707_100232727	56
164	3300025913	Ga0207695_10516258	Ga0207695_105162582	56
165	3300025917	Ga0207660_10037082	Ga0207660_100370824	56
166	3300025917	Ga0207660_10592458	Ga0207660_105924582	56
167	3300025919	Ga0207657_11023264	Ga0207657_110232642	56
168	3300025920	Ga0207649_10278763	Ga0207649_102787633	56
169	3300025920	Ga0207649_10960664	Ga0207649_109606642	56
170	3300025921	Ga0207652_10000242	Ga0207652_1000024222	56
171	3300025927	Ga0207687_11319302	Ga0207687_113193022	56
172	3300025934	Ga0207686_10000066	Ga0207686_1000006685	56
173	3300025934	Ga0207686_10023990	Ga0207686_100239902	56
174	3300025934	Ga0207686_10080456	Ga0207686_100804563	56
175	3300025935	Ga0207709_10305150	Ga0207709_103051501	56
176	3300025935	Ga0207709_11030708	Ga0207709_110307082	56
177	3300025937	Ga0207669_10000002	Ga0207669_10000002381	56
178	3300025937	Ga0207669_11149756	Ga0207669_111497561	56
179	3300025942	Ga0207689_10435654	Ga0207689_104356541	56
180	3300025944	Ga0207661_10046081	Ga0207661_100460815	56
181	3300025944	Ga0207661_10071282	Ga0207661_100712824	56
182	3300025944	Ga0207661_11223834	Ga0207661_112238342	56
183	3300025945	Ga0207679_10093031	Ga0207679_100930312	56
184	3300025949	Ga0207667_10152193	Ga0207667_101521932	56
185	3300025961	Ga0207712_10877372	Ga0207712_108773722	56
186	3300025986	Ga0207658_10221464	Ga0207658_102214643	56
187	3300026035	Ga0207703_10001133	Ga0207703_1000113329	56
188	3300026041	Ga0207639_10373357	Ga0207639_103733573	56
189	3300026041	Ga0207639_11877788	Ga0207639_118777882	56
190	3300026067	Ga0207678_10520547	Ga0207678_105205471	56
191	3300026067	Ga0207678_11437778	Ga0207678_114377782	56
192	3300026075	Ga0207708_10430324	Ga0207708_104303242	56
193	3300026078	Ga0207702_10017871	Ga0207702_100178715	56
194	3300026078	Ga0207702_12471076	Ga0207702_124710761	56
195	3300026088	Ga0207641_10015727	Ga0207641_100157279	56
196	3300026088	Ga0207641_10323129	Ga0207641_103231292	56
197	3300026095	Ga0207676_10000025	Ga0207676_1000002542	56
198	3300026118	Ga0207675_100180723	Ga0207675_1001807234	56
199	3300026118	Ga0207675_100257160	Ga0207675_1002571603	56
200	3300026118	Ga0207675_100550960	Ga0207675_1005509601	56
201	3300027907	Ga0207428_10056324	Ga0207428_100563245	56
202	3300028379	Ga0268266_10000029	Ga0268266_1000002967	56
203	3300030521	Ga0307511_10328410	Ga0307511_103284101	56
204	3300031251	Ga0265327_10167656	Ga0265327_101676562	56
205	3300031548	Ga0307408_102470279	Ga0307408_1024702791	56
206	3300031731	Ga0307405_10582799	Ga0307405_105827992	56
207	3300031731	Ga0307405_11487619	Ga0307405_114876191	56
208	3300031824	Ga0307413_10150888	Ga0307413_101508881	56
209	3300031824	Ga0307413_10654258	Ga0307413_106542582	56
210	3300031824	Ga0307413_11874248	Ga0307413_118742481	56
211	3300031852	Ga0307410_10076072	Ga0307410_100760722	56
212	3300031852	Ga0307410_11235448	Ga0307410_112354482	56
213	3300031901	Ga0307406_10050212	Ga0307406_100502121	56
214	3300031901	Ga0307406_10056823	Ga0307406_100568234	56
215	3300031901	Ga0307406_10371774	Ga0307406_103717743	56
216	3300031901	Ga0307406_10379176	Ga0307406_103791763	56
217	3300031901	Ga0307406_10396447	Ga0307406_103964472	56
218	3300031901	Ga0307406_10807956	Ga0307406_108079562	56
219	3300031903	Ga0307407_10012271	Ga0307407_100122712	56
220	3300031903	Ga0307407_10559618	Ga0307407_105596182	56
221	3300031911	Ga0307412_10504294	Ga0307412_105042942	56
222	3300031995	Ga0307409_101583424	Ga0307409_1015834242	56
223	3300031995	Ga0307409_102704994	Ga0307409_1027049941	56
224	3300032002	Ga0307416_100035326	Ga0307416_1000353265	56
225	3300032002	Ga0307416_100566595	Ga0307416_1005665953	56
226	3300032002	Ga0307416_100802420	Ga0307416_1008024202	56
227	3300032002	Ga0307416_101408627	Ga0307416_1014086272	56
228	3300032002	Ga0307416_101511301	Ga0307416_1015113012	56
229	3300032002	Ga0307416_101867958	Ga0307416_1018679582	56
230	3300032004	Ga0307414_10017391	Ga0307414_100173915	56
231	3300032004	Ga0307414_11338290	Ga0307414_113382902	56
232	3300032005	Ga0307411_10047172	Ga0307411_100471722	56
233	3300032005	Ga0307411_11267396	Ga0307411_112673962	56
234	3300032005	Ga0307411_11437669	Ga0307411_114376692	56
235	3300032126	Ga0307415_100109350	Ga0307415_1001093502	56
236	3300032126	Ga0307415_100639639	Ga0307415_1006396392	56
237	3300032126	Ga0307415_102360076	Ga0307415_1023600762	56
238	3300032126	Ga0307415_102439031	Ga0307415_1024390312	56
239	3300035119	Ga0373956_0135535	Ga0373956_0135535_805_984	56
240	3300035398	Ga0316574_0131462	Ga0316574_0131462_845_1027	56
241	3300035692	Ga0373935_0586339	Ga0373935_0586339_22_204	56
242	3300035724	Ga0373933_0414929	Ga0373933_0414929_244_423	56
243	3300035725	Ga0373947_0722041	Ga0373947_0722041_486_668	56
244	3300036401	Ga0373937_0046449	Ga0373937_0046449_238_417	56
245	3300037312	Ga0395899_0059904	Ga0395899_0059904_2149_2325	56
246	3300037312	Ga0395899_0455178	Ga0395899_0455178_414_590	56
247	3300037312	Ga0395899_0880719	Ga0395899_0880719_178_354	56
248	3300037418	Ga0395900_0202893	Ga0395900_0202893_1216_1392	56
249	3300037418	Ga0395900_0874493	Ga0395900_0874493_388_564	56
250	3300037466	Ga0395898_0060897	Ga0395898_0060897_2706_2882	56
251	3300037466	Ga0395898_0065262	Ga0395898_0065262_3058_3234	56
252	3300037466	Ga0395898_0176334	Ga0395898_0176334_825_1001	56
253	3300037471	Ga0395905_0504965	Ga0395905_0504965_525_701	56
254	3300037471	Ga0395905_0905330	Ga0395905_0905330_462_638	56
255	3300038443	Ga0395901_0302408	Ga0395901_0302408_614_790	56
256	3300038443	Ga0395901_0325229	Ga0395901_0325229_546_722	56
257	3300038443	Ga0395901_0553062	Ga0395901_0553062_52_228	56
258	3300038443	Ga0395901_1558239	Ga0395901_1558239_298_474	56
259	3300041451	Ga0451791_0502081	Ga0451791_0502081_303_482	56
260	3300041451	Ga0451791_1380446	Ga0451791_1380446_60_233	56
261	3300041463	Ga0451804_0494194	Ga0451804_0494194_192_368	56
262	3300041463	Ga0451804_0667332	Ga0451804_0667332_227_400	56
263	3300041486	Ga0451807_0325831	Ga0451807_0325831_516_689	56
264	3300041494	Ga0451837_1703547	Ga0451837_1703547_128_301	56
265	3300041505	Ga0451849_0238995	Ga0451849_0238995_322_495	56
266	3300041505	Ga0451849_0644558	Ga0451849_0644558_1346_1519	56
267	3300041512	Ga0451853_1749816	Ga0451853_1749816_197_370	56
268	3300041512	Ga0451853_2729518	Ga0451853_2729518_744_920	56
269	3300042993	Ga0439440_0093104	Ga0439440_0093104_35_214	56
270	3300044842	Ga0466957_0502483	Ga0466957_0502483_281_460	56
271	3300044901	Ga0466960_0667195	Ga0466960_0667195_117_296	56
272	3300045976	Ga0466967_0031612	Ga0466967_0031612_2490_2666	56
273	3300045976	Ga0466967_0051187	Ga0466967_0051187_776_955	56
274	3300045976	Ga0466967_0193173	Ga0466967_0193173_906_1085	56
275	3300045976	Ga0466967_1588462	Ga0466967_1588462_86_262	56
276	3300046455	Ga0495603_0150214	Ga0495603_0150214_881_1060	56
277	3300046455	Ga0495603_0753152	Ga0495603_0753152_308_487	56
278	3300046459	Ga0495629_0004371	Ga0495629_0004371_9842_10015	56
279	3300046459	Ga0495629_0007604	Ga0495629_0007604_1220_1393	56
280	3300046459	Ga0495629_0597387	Ga0495629_0597387_41_217	56
281	3300046461	Ga0495641_0141595	Ga0495641_0141595_796_975	56
282	3300046463	Ga0495653_0094459	Ga0495653_0094459_993_1172	56
283	3300046476	Ga0495662_0291497	Ga0495662_0291497_370_549	56
284	3300046511	Ga0495608_0143930	Ga0495608_0143930_20_199	56
285	3300046511	Ga0495608_0641124	Ga0495608_0641124_219_398	56
286	3300046514	Ga0495618_0766002	Ga0495618_0766002_229_408	56
287	3300046516	Ga0495628_0232244	Ga0495628_0232244_492_671	56
288	3300046516	Ga0495628_0291644	Ga0495628_0291644_755_934	56
289	3300046517	Ga0495630_0000395	Ga0495630_0000395_23803_23982	56
290	3300046522	Ga0495643_0480656	Ga0495643_0480656_150_332	56
291	3300046529	Ga0495652_0023756	Ga0495652_0023756_2633_2812	56
292	3300046529	Ga0495652_0104863	Ga0495652_0104863_1094_1270	56
293	3300046529	Ga0495652_0663330	Ga0495652_0663330_278_457	56
294	3300046533	Ga0495640_0932189	Ga0495640_0932189_150_329	56
295	3300046535	Ga0495586_0067497	Ga0495586_0067497_826_1005	56
296	3300046535	Ga0495586_0185429	Ga0495586_0185429_866_1045	56
297	3300046543	Ga0495645_0015381	Ga0495645_0015381_4155_4334	56
298	3300046543	Ga0495645_0163017	Ga0495645_0163017_365_541	56
299	3300046559	Ga0495667_0010689	Ga0495667_0010689_5169_5345	56
300	3300046559	Ga0495667_0073755	Ga0495667_0073755_1184_1363	56
301	3300046642	Ga0495634_0046880	Ga0495634_0046880_2509_2688	56
302	3300046642	Ga0495634_0257308	Ga0495634_0257308_607_786	56
303	3300046642	Ga0495634_0281963	Ga0495634_0281963_80_259	56
304	3300046642	Ga0495634_0545634	Ga0495634_0545634_142_318	56
305	3300046642	Ga0495634_0776821	Ga0495634_0776821_220_399	56
306	3300046663	Ga0495635_0046430	Ga0495635_0046430_1427_1606	56
307	3300046663	Ga0495635_0414390	Ga0495635_0414390_139_318	56
308	3300046674	Ga0495588_0275755	Ga0495588_0275755_206_385	56
309	3300046675	Ga0495657_0106116	Ga0495657_0106116_1166_1345	56
310	3300046681	Ga0495647_0349099	Ga0495647_0349099_389_568	56
311	3300046683	Ga0495658_0528905	Ga0495658_0528905_35_214	56
312	3300046683	Ga0495658_1033895	Ga0495658_1033895_54_233	56
313	3300046684	Ga0495669_0488765	Ga0495669_0488765_170_349	56
314	3300046689	Ga0495613_0525467	Ga0495613_0525467_511_690	56
315	3300046690	Ga0495624_0712390	Ga0495624_0712390_275_454	56
316	3300046694	Ga0495649_0004973	Ga0495649_0004973_5031_5207	56
317	3300046809	Ga0495600_0139375	Ga0495600_0139375_629_808	56
318	3300046809	Ga0495600_0787474	Ga0495600_0787474_173_349	56
319	3300047317	Ga0495604_0161839	Ga0495604_0161839_972_1151	56
320	3300047321	Ga0495676_0000522	Ga0495676_0000522_10298_10471	56
321	3300047321	Ga0495676_0127222	Ga0495676_0127222_248_421	56
322	3300047322	Ga0495680_0287999	Ga0495680_0287999_727_906	56
323	3300047322	Ga0495680_0313789	Ga0495680_0313789_621_794	56
324	3300047444	Ga0495675_0512390	Ga0495675_0512390_309_488	56
325	3300047444	Ga0495675_0513993	Ga0495675_0513993_217_396	56
326	3300047446	Ga0495679_020151	Ga0495679_020151_922_1098	56
327	3300047471	Ga0495684_1036570	Ga0495684_1036570_182_361	56
328	3300048088	Ga0495602_0798022	Ga0495602_0798022_160_339	56
329	3300048089	Ga0495614_0672830	Ga0495614_0672830_122_298	56
330	3300048903	Ga0496100_0000028	Ga0496100_0000028_95084_95257	56
331	3300048904	Ga0496101_0000005	Ga0496101_0000005_245083_245256	56
332	3300048905	Ga0496102_0000021	Ga0496102_0000021_172868_173041	56
333	3300048905	Ga0496102_0294971	Ga0496102_0294971_703_876	56
334	3300048905	Ga0496102_0965428	Ga0496102_0965428_90_275	56
335	3300048906	Ga0496103_0000001	Ga0496103_0000001_422866_423039	56
336	3300048907	Ga0496104_1531538	Ga0496104_1531538_110_286	56
337	3300048909	Ga0496106_0000070	Ga0496106_0000070_63980_64153	56
338	3300048909	Ga0496106_1138939	Ga0496106_1138939_258_443	56
339	3300048910	Ga0496107_0000004	Ga0496107_0000004_245300_245473	56
340	3300048911	Ga0496108_0109470	Ga0496108_0109470_911_1090	56
341	3300048911	Ga0496108_0110386	Ga0496108_0110386_1515_1694	56
342	3300048911	Ga0496108_1139393	Ga0496108_1139393_254_439	56
343	3300048911	Ga0496108_1228243	Ga0496108_1228243_180_359	56
344	3300048912	Ga0496109_0043843	Ga0496109_0043843_3390_3566	56
345	3300048912	Ga0496109_0099010	Ga0496109_0099010_802_981	56
346	3300048912	Ga0496109_0324425	Ga0496109_0324425_237_413	56
347	3300048912	Ga0496109_0457066	Ga0496109_0457066_51_236	56
348	3300048912	Ga0496109_0556254	Ga0496109_0556254_353_532	56
349	3300048913	Ga0496110_0035533	Ga0496110_0035533_3829_4008	56
350	3300048913	Ga0496110_0056185	Ga0496110_0056185_2447_2632	56
351	3300048913	Ga0496110_0533202	Ga0496110_0533202_405_581	56
352	3300048913	Ga0496110_0718173	Ga0496110_0718173_251_427	56
353	3300048913	Ga0496110_0799884	Ga0496110_0799884_94_270	56
354	3300048914	Ga0496111_0011147	Ga0496111_0011147_4836_5015	56
355	3300048914	Ga0496111_0262639	Ga0496111_0262639_547_732	56
356	3300048914	Ga0496111_0309359	Ga0496111_0309359_272_451	56
357	3300048914	Ga0496111_0414587	Ga0496111_0414587_627_806	56
358	3300048914	Ga0496111_0425153	Ga0496111_0425153_582_758	56
359	3300048914	Ga0496111_0892346	Ga0496111_0892346_234_410	56
360	3300048915	Ga0496112_0047484	Ga0496112_0047484_3509_3694	56
361	3300048915	Ga0496112_0193132	Ga0496112_0193132_1758_1937	56
362	3300048915	Ga0496112_0200149	Ga0496112_0200149_76_252	56
363	3300048915	Ga0496112_0251531	Ga0496112_0251531_655_831	56
364	3300048915	Ga0496112_0384492	Ga0496112_0384492_1045_1224	56
365	3300048915	Ga0496112_0401526	Ga0496112_0401526_454_630	56
366	3300048915	Ga0496112_1342952	Ga0496112_1342952_144_320	56
367	3300048916	Ga0496113_0043533	Ga0496113_0043533_1396_1575	56
368	3300048916	Ga0496113_0109302	Ga0496113_0109302_1887_2072	56
369	3300048916	Ga0496113_0170822	Ga0496113_0170822_516_692	56
370	3300048916	Ga0496113_0371659	Ga0496113_0371659_578_757	56
371	3300048916	Ga0496113_0509386	Ga0496113_0509386_703_879	56
372	3300048917	Ga0496114_0000097	Ga0496114_0000097_31868_32041	56
373	3300048917	Ga0496114_0028056	Ga0496114_0028056_1597_1773	56
374	3300048918	Ga0496115_0000151	Ga0496115_0000151_32970_33143	56
375	3300048929	Ga0496126_1148564	Ga0496126_1148564_64_237	56
376	3300049162	Ga0501307_030938	Ga0501307_030938_537_719	56
377	3300049573	Ga0501037_0959628	Ga0501037_0959628_79_258	56
378	3300049578	Ga0501042_0451280	Ga0501042_0451280_460_633	56
379	3300049578	Ga0501042_0625675	Ga0501042_0625675_459_635	56
380	3300049578	Ga0501042_0879839	Ga0501042_0879839_216_395	56
381	3300049588	Ga0501072_0487084	Ga0501072_0487084_716_892	56
382	3300049589	Ga0501073_0797602	Ga0501073_0797602_134_313	56
383	3300049592	Ga0501076_0727920	Ga0501076_0727920_42_233	56
384	3300049592	Ga0501076_1146500	Ga0501076_1146500_231_410	56
385	3300049650	Ga0501199_052667	Ga0501199_052667_313_489	56
386	3300049670	Ga0501236_127188	Ga0501236_127188_114_290	56
387	3300049675	Ga0501243_054672	Ga0501243_054672_282_461	56
388	3300049741	Ga0501079_0546615	Ga0501079_0546615_108_308	56
389	3300049824	Ga0501045_1393707	Ga0501045_1393707_215_394	56
390	3300050492	nmdc:mga0yw44_1146537_c1	nmdc:mga0yw44_1146537_c1_222_401	56
391	3300050507	nmdc:mga05p37_466910_c1	nmdc:mga05p37_466910_c1_1109_1285	56
392	3300050508	nmdc:mga09592_1130912_c1	nmdc:mga09592_1130912_c1_299_475	56
393	3300050509	nmdc:mga0qj67_1053815_c1	nmdc:mga0qj67_1053815_c1_198_377	56
394	3300050510	nmdc:mga06r32_316088_c1	nmdc:mga06r32_316088_c1_87_263	56
395	3300050511	nmdc:mga08y16_32980_c1	nmdc:mga08y16_32980_c1_5124_5300	56
396	3300050512	nmdc:mga0n895_1679120_c1	nmdc:mga0n895_1679120_c1_298_474	56
397	3300050512	nmdc:mga0n895_457258_c1	nmdc:mga0n895_457258_c1_248_433	56
398	3300050514	nmdc:mga08x19_837006_c1	nmdc:mga08x19_837006_c1_47_232	56
399	3300053077	Ga0495601_0049036	Ga0495601_0049036_1213_1392	56
400	3300053077	Ga0495601_0159221	Ga0495601_0159221_1113_1292	56
401	3300053077	Ga0495601_0741820	Ga0495601_0741820_269_448	56
402	3300053078	Ga0495612_0000820	Ga0495612_0000820_7282_7461	56
403	3300053078	Ga0495612_0057248	Ga0495612_0057248_256_435	56
404	3300053078	Ga0495612_0110676	Ga0495612_0110676_240_419	56
405	3300053083	Ga0495655_0000013	Ga0495655_0000013_29035_29208	56
406	3300053083	Ga0495655_0129589	Ga0495655_0129589_261_437	56
407	3300053085	Ga0495619_0001945	Ga0495619_0001945_12745_12924	56
408	3300053085	Ga0495619_0005994	Ga0495619_0005994_3450_3626	56
409	3300053085	Ga0495619_0007307	Ga0495619_0007307_5441_5620	56
410	3300053085	Ga0495619_0020941	Ga0495619_0020941_2660_2839	56
411	3300053085	Ga0495619_0275624	Ga0495619_0275624_727_906	56
412	3300053085	Ga0495619_0707248	Ga0495619_0707248_263_439	56
413	3300053094	Ga0500566_0001523	Ga0500566_0001523_1835_2008	56
414	3300053129	Ga0500628_000045	Ga0500628_000045_13273_13446	56
415	3300059505	Ga0587083_0108806	Ga0587083_0108806_394_573	56
416	3300060353	Ga0501082_1293273	Ga0501082_1293273_280_459	56
417	3300060353	Ga0501082_1524015	Ga0501082_1524015_175_351	56
418	3300061734	Ga0530510_1221634	Ga0530510_1221634_226_405	56

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7nhn-assembly1.cif.gz_3	vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes	0.9934	3	56
5xym-assembly1.cif.gz_Z	large subunit of mycobacterium smegmatis	0.9925	1	56
7msh-assembly1.cif.gz_Z	mtb 70sic in complex with mtbetta at pre_r1 state	0.9911	1	56
8g34-assembly1.cif.gz_Z	time-resolved cryo-em study of the 70s recycling by the hflx:1st intermediate	0.989	2	56
8cvm-assembly1.cif.gz_y	cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map	0.9887	2	56

ID	Description	Score	Start	End	Superfamily
af_P9WHA3_1_65_3.30.1390.20	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9996	2	56	3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9979	1	56	3.30.1390.20
af_Q54GH8_53_110_3.30.1390.20	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9849	3	56	3.30.1390.20
af_B6SIL2_19_102_3.30.1390.20	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9804	1	56	3.30.1390.20
4tomZ00	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9787	1	56	3.30.1390.20

ID	Description	Score	Start	End	GO Terms
AF-A0A838V3G0-F1-model_v4	Large ribosomal subunit protein uL30	1.013	1	56	GO:0003735 GO:0006412 GO:0022625
AF-A0A7V9CZF5-F1-model_v4	Large ribosomal subunit protein uL30	1.013	2	56	GO:0003735 GO:0006412 GO:0022625
AF-A0A537YP15-F1-model_v4	Large ribosomal subunit protein uL30	1.012	2	56	GO:0003735 GO:0006412 GO:0015934
AF-B3EGX2-F1-model_v4	Large ribosomal subunit protein uL30 (50S ribosomal protein L30)	1.012	2	56	GO:0003735 GO:0006412 GO:0022625
AF-A0A535JM54-F1-model_v4	Large ribosomal subunit protein uL30	1.012	2	56	GO:0003735 GO:0006412 GO:0022625

Feature Viewer

pLDDT	pTM	Quality
95.57	0.75	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F439269

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map