F439167

General Info

Members Datasets Scaffolds Average Seq Length
417 233 834 228

Family's Representative Sequence

Representative Sequence 3300049583|Ga0501067_0161810|Ga0501067_0161810_393_1067
Length 224
Sequence MLRAVVFDVDFTIARPGPELGPEGYRRLGARYGLTLVPERYEESRRAALDTLERHPELEHVEETWVLFTQRIVEGMGGEGDTYGCAVEMTRAWEHAQHFDIYDDVLPALDDLRSRGLLVGLLSNTARDLEVFVRHHGLEVDAVLTSRVHGKTKPHESIFLRMLELLEVAPGEAAMVGDTVEDDVEGARAVGMQAVLLDRNDRHPEVTDRLTDLRELPAALKLSA

Samples

Sample ID Description Type Environment
1 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
116 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
129 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
130 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
131 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
145 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
149 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
154 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
161 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
165 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
166 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
167 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
168 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
169 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
170 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
178 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
179 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
216 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
224 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
227 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
228 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
229 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
230 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
231 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.48
Nodule 0
Rhizoplane 9.11
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 13.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501067_0161810 3300049583 Bacteria 1246
2 JGI25407J50210_10014992 3300003373 Bacteria 2001
3 Ga0070658_10223413 3300005327 Bacteria 1593
4 Ga0070683_100419201 3300005329 Bacteria 1277
5 Ga0070682_100004344 3300005337 Bacteria 7867
6 Ga0070660_100022591 3300005339 Bacteria 4653
7 Ga0070689_100162537 3300005340 Bacteria 1806
8 Ga0070687_100146559 3300005343 Bacteria 1381
9 Ga0070661_100021907 3300005344 Bacteria 4570
10 Ga0070671_100282216 3300005355 Bacteria 1412
11 Ga0070714_100082860 3300005435 Bacteria 2795
12 Ga0070711_100124113 3300005439 Bacteria 1914
13 Ga0070705_100102144 3300005440 Bacteria 1813
14 Ga0070708_100030757 3300005445 Bacteria 4642
15 Ga0070663_100283535 3300005455 Bacteria 1321
16 Ga0070678_100239177 3300005456 Bacteria 1517
17 Ga0070681_10076414 3300005458 Bacteria 3308
18 Ga0070681_10213296 3300005458 Bacteria 1847
19 Ga0070681_10348138 3300005458 Bacteria 1392
20 Ga0068867_100330100 3300005459 Unclassified 1266
21 Ga0070706_100005941 3300005467 Bacteria 11541
22 Ga0070706_100009560 3300005467 Bacteria 9017
23 Ga0070706_100200135 3300005467 Bacteria 1866
24 Ga0070707_100002726 3300005468 Bacteria 16796
25 Ga0070707_100801387 3300005468 Bacteria 906
26 Ga0070698_100001818 3300005471 Bacteria 23727
27 Ga0070698_100107819 3300005471 Unclassified 2753
28 Ga0070698_100191244 3300005471 Bacteria 1984
29 Ga0070698_100371299 3300005471 Unclassified 1363
30 Ga0070699_100019920 3300005518 Bacteria 5782
31 Ga0070699_100558913 3300005518 Unclassified 1042
32 Ga0070679_100054394 3300005530 Bacteria 3985
33 Ga0070679_100146102 3300005530 Bacteria 2342
34 Ga0070679_100415043 3300005530 Unclassified 1292
35 Ga0070684_100117419 3300005535 Bacteria 2391
36 Ga0070697_100234664 3300005536 Bacteria 1565
37 Ga0070686_100040958 3300005544 Bacteria 2892
38 Ga0070695_100080169 3300005545 Unclassified 2157
39 Ga0070696_100036519 3300005546 Bacteria 3388
40 Ga0070693_100097995 3300005547 Bacteria 1780
41 Ga0070693_100108466 3300005547 Unclassified 1703
42 Ga0070664_100104400 3300005564 Bacteria 2467
43 Ga0068857_100519872 3300005577 Bacteria 1119
44 Ga0068856_100446881 3300005614 Bacteria 1313
45 Ga0070702_100053226 3300005615 Bacteria 2324
46 Ga0070702_100063647 3300005615 Bacteria 2155
47 Ga0070702_100447628 3300005615 Unclassified 936
48 Ga0068852_100525423 3300005616 Bacteria 1181
49 Ga0068852_100561046 3300005616 Bacteria 1143
50 Ga0068861_100005030 3300005719 Bacteria 8913
51 Ga0068861_100154684 3300005719 Unclassified 1885
52 Ga0068862_100684913 3300005844 Unclassified 992
53 Ga0068862_100833041 3300005844 Unclassified 903
54 Ga0081455_10010824 3300005937 Bacteria 9214
55 Ga0081455_10039270 3300005937 Bacteria 4185
56 Ga0081455_10046787 3300005937 Bacteria 3750
57 Ga0081455_10146160 3300005937 Bacteria 1829
58 Ga0081455_10231729 3300005937 Bacteria 1363
59 Ga0081538_10000458 3300005981 Bacteria 45661
60 Ga0081538_10027904 3300005981 Bacteria 3898
61 Ga0081538_10150403 3300005981 Bacteria 1055
62 Ga0081540_1002817 3300005983 Bacteria 14079
63 Ga0081540_1113646 3300005983 Bacteria 1139
64 Ga0070716_100003224 3300006173 Bacteria 7656
65 Ga0070712_100069456 3300006175 Bacteria 2513
66 Ga0070712_100076612 3300006175 Bacteria 2408
67 Ga0070712_100112798 3300006175 Unclassified 2032
68 Ga0070712_100566009 3300006175 Bacteria 959
69 Ga0075362_10060998 3300006177 Unclassified 1706
70 Ga0097621_100016648 3300006237 Bacteria 5564
71 Ga0097621_100325572 3300006237 Bacteria 1362
72 Ga0068871_100020776 3300006358 Bacteria 5035
73 Ga0075428_100017374 3300006844 Bacteria 7950
74 Ga0075428_100191176 3300006844 Bacteria 2214
75 Ga0075431_100040366 3300006847 Bacteria 4810
76 Ga0075431_100099073 3300006847 Bacteria 3008
77 Ga0075433_10001748 3300006852 Bacteria 16223
78 Ga0075433_10045735 3300006852 Bacteria 3806
79 Ga0075433_10248420 3300006852 Bacteria 1579
80 Ga0075434_100001195 3300006871 Bacteria 21555
81 Ga0075434_100116801 3300006871 Bacteria 2681
82 Ga0075434_100820044 3300006871 Unclassified 946
83 Ga0075436_100062413 3300006914 Bacteria 2575
84 Ga0075436_100106096 3300006914 Bacteria 1959
85 Ga0075435_100007478 3300007076 Bacteria 7789
86 Ga0105240_10073083 3300009093 Bacteria 4236
87 Ga0111539_10100194 3300009094 Bacteria 3402
88 Ga0111539_10161721 3300009094 Unclassified 2618
89 Ga0105245_10058229 3300009098 Bacteria 3477
90 Ga0105245_10138742 3300009098 Unclassified 2288
91 Ga0105245_10178288 3300009098 Bacteria 2028
92 Ga0114129_10043890 3300009147 Bacteria 6290
93 Ga0114129_10154764 3300009147 Bacteria 3136
94 Ga0114129_10181131 3300009147 Bacteria 2866
95 Ga0114129_10807573 3300009147 Bacteria 1196
96 Ga0105243_10013559 3300009148 Bacteria 6166
97 Ga0105243_10110659 3300009148 Bacteria 2297
98 Ga0105243_10756585 3300009148 Bacteria 953
99 Ga0105242_10031008 3300009176 Bacteria 4268
100 Ga0105242_10139435 3300009176 Bacteria 2102
101 Ga0105242_10440356 3300009176 Bacteria 1226
102 Ga0105248_10376185 3300009177 Bacteria 1599
103 Ga0105249_10102956 3300009553 Bacteria 2688
104 Ga0105249_10224719 3300009553 Bacteria 1849
105 Ga0105239_10161149 3300010375 Bacteria 2506
106 Ga0105246_10045242 3300011119 Bacteria 2996
107 Ga0157370_10156987 3300013104 Bacteria 2117
108 Ga0157370_10170072 3300013104 Bacteria 2026
109 Ga0157369_10004745 3300013105 Bacteria 15975
110 Ga0157369_10031799 3300013105 Bacteria 5806
111 Ga0157369_10086429 3300013105 Bacteria 3349
112 Ga0163162_10074635 3300013306 Bacteria 3450
113 Ga0163162_10700508 3300013306 Unclassified 1134
114 Ga0157372_10144009 3300013307 Bacteria 2748
115 Ga0157379_10070900 3300014968 Bacteria 3118
116 Ga0157376_10005110 3300014969 Bacteria 9146
117 Ga0163161_10250813 3300017792 Bacteria 1380
118 Ga0206356_10918821 3300020070 Bacteria 2312
119 Ga0206354_10032689 3300020081 Bacteria 3434
120 Ga0207688_10026174 3300025901 Bacteria 3206
121 Ga0207705_10032090 3300025909 Bacteria 3752
122 Ga0207684_10008813 3300025910 Bacteria 8956
123 Ga0207707_10056379 3300025912 Bacteria 3418
124 Ga0207707_10729084 3300025912 Bacteria 830
125 Ga0207695_10046896 3300025913 Bacteria 4577
126 Ga0207693_10017111 3300025915 Bacteria 5784
127 Ga0207693_10034481 3300025915 Bacteria 3992
128 Ga0207693_10046170 3300025915 Bacteria 3422
129 Ga0207693_10046236 3300025915 Bacteria 3419
130 Ga0207693_10050131 3300025915 Bacteria 3279
131 Ga0207663_10022959 3300025916 Bacteria 3573
132 Ga0207663_10034741 3300025916 Bacteria 3018
133 Ga0207663_10369437 3300025916 Bacteria 1090
134 Ga0207660_10221038 3300025917 Bacteria 1486
135 Ga0207657_10131520 3300025919 Bacteria 2051
136 Ga0207657_10427035 3300025919 Bacteria 1041
137 Ga0207649_10205929 3300025920 Bacteria 1393
138 Ga0207652_10118181 3300025921 Bacteria 2356
139 Ga0207652_10317389 3300025921 Bacteria 1407
140 Ga0207652_10320518 3300025921 Bacteria 1399
141 Ga0207652_10731889 3300025921 Unclassified 881
142 Ga0207687_10094582 3300025927 Unclassified 2187
143 Ga0207700_10000001 3300025928 Bacteria 1122509
144 Ga0207700_10087780 3300025928 Bacteria 2447
145 Ga0207664_10072057 3300025929 Bacteria 2785
146 Ga0207664_10223085 3300025929 Bacteria 1636
147 Ga0207664_10295180 3300025929 Bacteria 1425
148 Ga0207644_10025558 3300025931 Bacteria 4061
149 Ga0207644_10283383 3300025931 Bacteria 1331
150 Ga0207706_10016903 3300025933 Bacteria 6581
151 Ga0207706_10059766 3300025933 Bacteria 3357
152 Ga0207686_10428464 3300025934 Unclassified 1013
153 Ga0207709_10105299 3300025935 Bacteria 1874
154 Ga0207709_10539309 3300025935 Unclassified 916
155 Ga0207669_10161019 3300025937 Bacteria 1585
156 Ga0207665_10002722 3300025939 Bacteria 11859
157 Ga0207665_10018443 3300025939 Bacteria 4585
158 Ga0207665_10029397 3300025939 Unclassified 3632
159 Ga0207711_10338305 3300025941 Bacteria 1393
160 Ga0207689_10068866 3300025942 Bacteria 2908
161 Ga0207661_10971948 3300025944 Bacteria 782
162 Ga0207679_10059600 3300025945 Bacteria 2833
163 Ga0207667_10070333 3300025949 Bacteria 3642
164 Ga0207667_10348441 3300025949 Bacteria 1510
165 Ga0207712_10051269 3300025961 Bacteria 2885
166 Ga0207668_10100203 3300025972 Bacteria 2151
167 Ga0207668_10467765 3300025972 Bacteria 1079
168 Ga0207677_10252295 3300026023 Unclassified 1433
169 Ga0207678_10112314 3300026067 Bacteria 2324
170 Ga0207708_10005214 3300026075 Bacteria 9584
171 Ga0207702_10039579 3300026078 Bacteria 3951
172 Ga0207702_10668051 3300026078 Bacteria 1023
173 Ga0207648_10041322 3300026089 Bacteria 4049
174 Ga0207674_10174086 3300026116 Unclassified 2105
175 Ga0207675_100000456 3300026118 Bacteria 39658
176 Ga0207675_100102653 3300026118 Bacteria 2695
177 Ga0207675_100107111 3300026118 Bacteria 2636
178 Ga0207683_10000966 3300026121 Bacteria 26320
179 Ga0207683_10801793 3300026121 Bacteria 874
180 Ga0207698_10235357 3300026142 Bacteria 1665
181 Ga0207428_10011431 3300027907 Bacteria 7846
182 Ga0207428_10034562 3300027907 Bacteria 4140
183 Ga0207428_10036509 3300027907 Bacteria 4007
184 Ga0207428_10042204 3300027907 Bacteria 3689
185 Ga0268265_10150192 3300028380 Bacteria 1964
186 Ga0265338_10005206 3300028800 Bacteria 17061
187 Ga0265330_10062128 3300031235 Bacteria 1625
188 Ga0265332_10050540 3300031238 Bacteria 1787
189 Ga0265325_10144864 3300031241 Bacteria 1127
190 Ga0265339_10010018 3300031249 Bacteria 5910
191 Ga0265316_10037081 3300031344 Bacteria 3938
192 Ga0307408_100086990 3300031548 Bacteria 2350
193 Ga0265313_10017849 3300031595 Bacteria 4008
194 Ga0265314_10048064 3300031711 Bacteria 2997
195 Ga0307405_10010149 3300031731 Bacteria 4862
196 Ga0307413_10074862 3300031824 Bacteria 2146
197 Ga0307406_10017374 3300031901 Bacteria 4187
198 Ga0307407_10006236 3300031903 Bacteria 5271
199 Ga0307409_100003774 3300031995 Bacteria 8338
200 Ga0307409_100330205 3300031995 Bacteria 1431
201 Ga0307416_100122329 3300032002 Bacteria 2322
202 Ga0307416_100591873 3300032002 Unclassified 1188
203 Ga0307411_10025505 3300032005 Bacteria 3543
204 Ga0307415_100080616 3300032126 Bacteria 2322
205 Ga0373926_0105242 3300035083 Bacteria 1057
206 Ga0373929_0009247 3300035085 Bacteria 1825
207 Ga0373944_0022981 3300035089 Bacteria 1815
208 Ga0373949_0036102 3300035090 Unclassified 1198
209 Ga0373932_0123822 3300035112 Unclassified 865
210 Ga0373945_0038152 3300035116 Bacteria 1727
211 Ga0373960_0076850 3300035121 Bacteria 1043
212 Ga0373943_0002967 3300035170 Bacteria 7700
213 Ga0373942_0052546 3300035207 Unclassified 1147
214 Ga0373931_0013398 3300035691 Bacteria 3992
215 Ga0373931_0055632 3300035691 Bacteria 2118
216 Ga0373935_0269980 3300035692 Bacteria 1195
217 Ga0373927_0175555 3300035695 Bacteria 1405
218 Ga0373925_0027249 3300037068 Bacteria 4184
219 Ga0395899_0001122 3300037312 Bacteria 23915
220 Ga0395899_0001661 3300037312 Bacteria 18540
221 Ga0395899_0004487 3300037312 Bacteria 10878
222 Ga0395899_0009564 3300037312 Bacteria 7441
223 Ga0395899_0017631 3300037312 Bacteria 5437
224 Ga0395899_0032360 3300037312 Bacteria 3928
225 Ga0395899_0143795 3300037312 Bacteria 1695
226 Ga0395900_0002317 3300037418 Bacteria 21119
227 Ga0395900_0003438 3300037418 Bacteria 17122
228 Ga0395900_0003596 3300037418 Bacteria 16662
229 Ga0395900_0007355 3300037418 Bacteria 11384
230 Ga0395900_0010807 3300037418 Bacteria 9338
231 Ga0395900_0011577 3300037418 Bacteria 9027
232 Ga0395900_0018537 3300037418 Bacteria 7097
233 Ga0395900_0067970 3300037418 Bacteria 3661
234 Ga0395900_0087128 3300037418 Bacteria 3209
235 Ga0395900_0193523 3300037418 Unclassified 2061
236 Ga0395900_0577778 3300037418 Bacteria 1066
237 Ga0395900_0971435 3300037418 Bacteria 770
238 Ga0395898_0002928 3300037466 Bacteria 19413
239 Ga0395898_0004496 3300037466 Bacteria 15252
240 Ga0395898_0005497 3300037466 Bacteria 13684
241 Ga0395898_0006490 3300037466 Bacteria 12491
242 Ga0395898_0007699 3300037466 Bacteria 11437
243 Ga0395898_0012098 3300037466 Bacteria 8936
244 Ga0395898_0015744 3300037466 Bacteria 7751
245 Ga0395898_0024515 3300037466 Bacteria 6083
246 Ga0395898_0038499 3300037466 Bacteria 4738
247 Ga0395898_0050871 3300037466 Bacteria 4053
248 Ga0395898_0139131 3300037466 Bacteria 2324
249 Ga0395898_0203979 3300037466 Unclassified 1887
250 Ga0395898_0225771 3300037466 Bacteria 1786
251 Ga0395898_0556144 3300037466 Bacteria 1090
252 Ga0395905_0000698 3300037471 Bacteria 44490
253 Ga0395905_0002131 3300037471 Bacteria 22440
254 Ga0395905_0002582 3300037471 Bacteria 19936
255 Ga0395905_0005008 3300037471 Bacteria 13644
256 Ga0395905_0010671 3300037471 Bacteria 8910
257 Ga0395905_0019443 3300037471 Bacteria 6439
258 Ga0395905_0057327 3300037471 Unclassified 3644
259 Ga0395905_0068540 3300037471 Bacteria 3322
260 Ga0395905_0739202 3300037471 Bacteria 886
261 Ga0395901_0001102 3300038443 Bacteria 28752
262 Ga0395901_0002813 3300038443 Bacteria 17572
263 Ga0395901_0004069 3300038443 Bacteria 14731
264 Ga0395901_0006375 3300038443 Bacteria 11955
265 Ga0395901_0016010 3300038443 Bacteria 7639
266 Ga0395901_0019191 3300038443 Bacteria 6989
267 Ga0395901_0028131 3300038443 Bacteria 5782
268 Ga0395901_0029178 3300038443 Bacteria 5677
269 Ga0395901_0030317 3300038443 Bacteria 5572
270 Ga0395901_0051379 3300038443 Bacteria 4286
271 Ga0395901_0102288 3300038443 Bacteria 3007
272 Ga0395901_0140152 3300038443 Bacteria 2541
273 Ga0395901_0151551 3300038443 Unclassified 2436
274 Ga0395901_0344234 3300038443 Bacteria 1540
275 Ga0395901_0498655 3300038443 Bacteria 1240
276 Ga0451793_0306043 3300041452 Bacteria 1371
277 Ga0451800_1675168 3300041459 Bacteria 1960
278 Ga0451804_0190983 3300041463 Bacteria 1204
279 Ga0451835_0458117 3300041492 Bacteria 7337
280 Ga0451841_1198872 3300041498 Bacteria 1392
281 Ga0451843_0646594 3300041509 Unclassified 988
282 Ga0451855_1787749 3300041511 Bacteria 2140
283 Ga0451853_0629942 3300041512 Bacteria 1959
284 Ga0450888_008706 3300042126 Unclassified 1148
285 Ga0453683_0419148 3300044673 Unclassified 864
286 Ga0466961_0164827 3300044693 Bacteria 1380
287 Ga0466963_0044692 3300044694 Bacteria 2916
288 Ga0466963_0073328 3300044694 Bacteria 2307
289 Ga0466957_0178698 3300044842 Bacteria 1385
290 Ga0451576_0023056 3300045051 Bacteria 6746
291 Ga0451576_0287639 3300045051 Bacteria 1718
292 Ga0451576_0693644 3300045051 Unclassified 1070
293 Ga0466958_0006781 3300045836 Bacteria 6257
294 Ga0466967_0006488 3300045976 Bacteria 8287
295 Ga0466967_0049447 3300045976 Bacteria 3677
296 Ga0466967_0463474 3300045976 Bacteria 1240
297 Ga0466967_0505518 3300045976 Bacteria 1186
298 Ga0495603_0013877 3300046455 Bacteria 4875
299 Ga0495590_0178805 3300046457 Unclassified 775
300 Ga0495641_0001479 3300046461 Bacteria 19965
301 Ga0495653_0102297 3300046463 Bacteria 2073
302 Ga0495582_0030821 3300046473 Bacteria 2946
303 Ga0495584_0025942 3300046491 Bacteria 2970
304 Ga0495585_0056579 3300046492 Bacteria 2166
305 Ga0495594_0024968 3300046499 Bacteria 3211
306 Ga0495596_0048617 3300046500 Bacteria 1663
307 Ga0495607_0035822 3300046501 Bacteria 2998
308 Ga0495607_0074305 3300046501 Bacteria 1887
309 Ga0495637_0139080 3300046520 Unclassified 922
310 Ga0495663_0129127 3300046525 Bacteria 851
311 Ga0495656_0005436 3300046615 Bacteria 4399
312 Ga0495611_0171833 3300046648 Unclassified 1013
313 Ga0495659_0005439 3300046664 Bacteria 4006
314 Ga0495588_0005935 3300046674 Bacteria 5475
315 Ga0495658_0040678 3300046683 Bacteria 2585
316 Ga0495670_0187125 3300046691 Unclassified 1094
317 Ga0495671_0190226 3300046692 Unclassified 996
318 Ga0495660_0180427 3300046810 Unclassified 1021
319 Ga0495581_0063929 3300047315 Bacteria 2126
320 Ga0495581_0077468 3300047315 Bacteria 1924
321 Ga0495676_0000629 3300047321 Bacteria 29228
322 Ga0495676_0309039 3300047321 Unclassified 1064
323 Ga0495615_0019423 3300048090 Bacteria 1509
324 Ga0496101_0601767 3300048904 Unclassified 869
325 Ga0496102_0013857 3300048905 Bacteria 6996
326 Ga0496102_0155906 3300048905 Bacteria 2146
327 Ga0496102_0516852 3300048905 Unclassified 1116
328 Ga0496103_0045265 3300048906 Bacteria 2715
329 Ga0496103_0163817 3300048906 Unclassified 1427
330 Ga0496103_0197899 3300048906 Bacteria 1292
331 Ga0496103_0201432 3300048906 Unclassified 1280
332 Ga0496104_0061366 3300048907 Bacteria 3564
333 Ga0496105_0090133 3300048908 Unclassified 2533
334 Ga0496105_0104668 3300048908 Bacteria 2336
335 Ga0496106_0223710 3300048909 Bacteria 1501
336 Ga0496107_0027200 3300048910 Bacteria 4061
337 Ga0496108_0037759 3300048911 Bacteria 4024
338 Ga0496108_0739675 3300048911 Unclassified 851
339 Ga0496109_0060788 3300048912 Bacteria 3453
340 Ga0496109_0098419 3300048912 Bacteria 2711
341 Ga0496110_0016084 3300048913 Bacteria 6238
342 Ga0496110_0036546 3300048913 Bacteria 4265
343 Ga0496110_0094043 3300048913 Bacteria 2683
344 Ga0496110_0302442 3300048913 Bacteria 1457
345 Ga0496110_0447686 3300048913 Unclassified 1177
346 Ga0496111_0001090 3300048914 Bacteria 15007
347 Ga0496111_0005132 3300048914 Bacteria 8344
348 Ga0496111_0036806 3300048914 Bacteria 3500
349 Ga0496111_0153198 3300048914 Bacteria 1710
350 Ga0496112_0011153 3300048915 Bacteria 8195
351 Ga0496112_0354112 3300048915 Bacteria 1410
352 Ga0496112_0699403 3300048915 Bacteria 942
353 Ga0496113_0032462 3300048916 Bacteria 3795
354 Ga0496113_0088910 3300048916 Bacteria 2377
355 Ga0496113_0233204 3300048916 Bacteria 1468
356 Ga0496114_0063139 3300048917 Bacteria 3101
357 Ga0496114_0163505 3300048917 Bacteria 1937
358 Ga0496115_0063563 3300048918 Bacteria 2978
359 Ga0501031_0261412 3300049568 Bacteria 1124
360 Ga0501032_0017559 3300049569 Bacteria 5022
361 Ga0501033_0069966 3300049570 Bacteria 2578
362 Ga0501036_0036690 3300049572 Bacteria 4148
363 Ga0501037_0045967 3300049573 Bacteria 3203
364 Ga0501038_0009753 3300049574 Bacteria 8803
365 Ga0501039_0004930 3300049575 Bacteria 10115
366 Ga0501041_0055292 3300049577 Bacteria 2422
367 Ga0501042_0001104 3300049578 Bacteria 15505
368 Ga0501043_0045439 3300049579 Bacteria 3454
369 Ga0501046_0002240 3300049580 Bacteria 18249
370 Ga0501046_0144685 3300049580 Bacteria 1796
371 Ga0501048_0009035 3300049582 Bacteria 7501
372 Ga0501067_0001089 3300049583 Bacteria 14641
373 Ga0501067_0012191 3300049583 Bacteria 4765
374 Ga0501068_0001492 3300049584 Bacteria 12457
375 Ga0501068_0008713 3300049584 Bacteria 5656
376 Ga0501069_0002405 3300049585 Bacteria 9509
377 Ga0501069_0007329 3300049585 Bacteria 5789
378 Ga0501069_0067646 3300049585 Bacteria 1998
379 Ga0501071_0156336 3300049587 Bacteria 1702
380 Ga0501071_0225960 3300049587 Bacteria 1410
381 Ga0501071_0319660 3300049587 Unclassified 1179
382 Ga0501072_0339715 3300049588 Unclassified 1193
383 Ga0501073_0000892 3300049589 Bacteria 21379
384 Ga0501074_0025653 3300049590 Bacteria 4277
385 Ga0501075_0016129 3300049591 Bacteria 5376
386 Ga0501080_0005519 3300049742 Bacteria 11292
387 Ga0501081_0149020 3300049743 Bacteria 1680
388 Ga0501083_0001459 3300049744 Bacteria 16146
389 Ga0501035_0009424 3300049822 Bacteria 9077
390 Ga0501044_0117073 3300049823 Bacteria 2669
391 Ga0501045_0001864 3300049824 Bacteria 14271
392 Ga0501045_0315759 3300049824 Bacteria 1163
393 nmdc:mga03683_137646_c1 3300050489 Bacteria 1096
394 nmdc:mga05p37_144680_c1 3300050507 Bacteria 2911
395 nmdc:mga05p37_162103_c1 3300050507 Bacteria 2730
396 nmdc:mga05p37_34917_c1 3300050507 Bacteria 6163
397 nmdc:mga05p37_774706_c1 3300050507 Bacteria 1054
398 nmdc:mga09592_94935_c1 3300050508 Unclassified 2551
399 nmdc:mga06r32_616937_c1 3300050510 Bacteria 1055
400 nmdc:mga06r32_752260_c1 3300050510 Bacteria 938
401 nmdc:mga08y16_126264_c1 3300050511 Bacteria 2661
402 nmdc:mga08y16_134215_c1 3300050511 Bacteria 2573
403 nmdc:mga08y16_157728_c1 3300050511 Unclassified 2358
404 nmdc:mga08y16_23110_c1 3300050511 Bacteria 6565
405 nmdc:mga0n895_276213_c1 3300050512 Bacteria 1704
406 nmdc:mga0n895_3263_c1 3300050512 Bacteria 13007
407 nmdc:mga0n895_929701_c1 3300050512 Unclassified 854
408 nmdc:mga0rr50_17598_c1 3300050513 Bacteria 4776
409 nmdc:mga08x19_133266_c1 3300050514 Bacteria 1673
410 nmdc:mga08x19_30095_c1 3300050514 Bacteria 3409
411 nmdc:mga0a205_460_c1 3300050515 Bacteria 31634
412 nmdc:mga0a205_55469_c1 3300050515 Bacteria 3827
413 Ga0495655_0061104 3300053083 Bacteria 1028
414 Ga0501084_0073187 3300054114 Bacteria 2869
415 Ga0530510_0016025 3300061734 Bacteria 5298
416 Ga0530510_0064428 3300061734 Bacteria 2654
417 Ga0530510_0273163 3300061734 Bacteria 1261
418 Ga0501067_0161810
419 JGI25407J50210_10014992
420 Ga0070658_10223413
421 Ga0070683_100419201
422 Ga0070682_100004344
423 Ga0070660_100022591
424 Ga0070689_100162537
425 Ga0070687_100146559
426 Ga0070661_100021907
427 Ga0070671_100282216
428 Ga0070714_100082860
429 Ga0070711_100124113
430 Ga0070705_100102144
431 Ga0070708_100030757
432 Ga0070663_100283535
433 Ga0070678_100239177
434 Ga0070681_10076414
435 Ga0070681_10213296
436 Ga0070681_10348138
437 Ga0068867_100330100
438 Ga0070706_100005941
439 Ga0070706_100009560
440 Ga0070706_100200135
441 Ga0070707_100002726
442 Ga0070707_100801387
443 Ga0070698_100001818
444 Ga0070698_100107819
445 Ga0070698_100191244
446 Ga0070698_100371299
447 Ga0070699_100019920
448 Ga0070699_100558913
449 Ga0070679_100054394
450 Ga0070679_100146102
451 Ga0070679_100415043
452 Ga0070684_100117419
453 Ga0070697_100234664
454 Ga0070686_100040958
455 Ga0070695_100080169
456 Ga0070696_100036519
457 Ga0070693_100097995
458 Ga0070693_100108466
459 Ga0070664_100104400
460 Ga0068857_100519872
461 Ga0068856_100446881
462 Ga0070702_100053226
463 Ga0070702_100063647
464 Ga0070702_100447628
465 Ga0068852_100525423
466 Ga0068852_100561046
467 Ga0068861_100005030
468 Ga0068861_100154684
469 Ga0068862_100684913
470 Ga0068862_100833041
471 Ga0081455_10010824
472 Ga0081455_10039270
473 Ga0081455_10046787
474 Ga0081455_10146160
475 Ga0081455_10231729
476 Ga0081538_10000458
477 Ga0081538_10027904
478 Ga0081538_10150403
479 Ga0081540_1002817
480 Ga0081540_1113646
481 Ga0070716_100003224
482 Ga0070712_100069456
483 Ga0070712_100076612
484 Ga0070712_100112798
485 Ga0070712_100566009
486 Ga0075362_10060998
487 Ga0097621_100016648
488 Ga0097621_100325572
489 Ga0068871_100020776
490 Ga0075428_100017374
491 Ga0075428_100191176
492 Ga0075431_100040366
493 Ga0075431_100099073
494 Ga0075433_10001748
495 Ga0075433_10045735
496 Ga0075433_10248420
497 Ga0075434_100001195
498 Ga0075434_100116801
499 Ga0075434_100820044
500 Ga0075436_100062413
501 Ga0075436_100106096
502 Ga0075435_100007478
503 Ga0105240_10073083
504 Ga0111539_10100194
505 Ga0111539_10161721
506 Ga0105245_10058229
507 Ga0105245_10138742
508 Ga0105245_10178288
509 Ga0114129_10043890
510 Ga0114129_10154764
511 Ga0114129_10181131
512 Ga0114129_10807573
513 Ga0105243_10013559
514 Ga0105243_10110659
515 Ga0105243_10756585
516 Ga0105242_10031008
517 Ga0105242_10139435
518 Ga0105242_10440356
519 Ga0105248_10376185
520 Ga0105249_10102956
521 Ga0105249_10224719
522 Ga0105239_10161149
523 Ga0105246_10045242
524 Ga0157370_10156987
525 Ga0157370_10170072
526 Ga0157369_10004745
527 Ga0157369_10031799
528 Ga0157369_10086429
529 Ga0163162_10074635
530 Ga0163162_10700508
531 Ga0157372_10144009
532 Ga0157379_10070900
533 Ga0157376_10005110
534 Ga0163161_10250813
535 Ga0206356_10918821
536 Ga0206354_10032689
537 Ga0207688_10026174
538 Ga0207705_10032090
539 Ga0207684_10008813
540 Ga0207707_10056379
541 Ga0207707_10729084
542 Ga0207695_10046896
543 Ga0207693_10017111
544 Ga0207693_10034481
545 Ga0207693_10046170
546 Ga0207693_10046236
547 Ga0207693_10050131
548 Ga0207663_10022959
549 Ga0207663_10034741
550 Ga0207663_10369437
551 Ga0207660_10221038
552 Ga0207657_10131520
553 Ga0207657_10427035
554 Ga0207649_10205929
555 Ga0207652_10118181
556 Ga0207652_10317389
557 Ga0207652_10320518
558 Ga0207652_10731889
559 Ga0207687_10094582
560 Ga0207700_10000001
561 Ga0207700_10087780
562 Ga0207664_10072057
563 Ga0207664_10223085
564 Ga0207664_10295180
565 Ga0207644_10025558
566 Ga0207644_10283383
567 Ga0207706_10016903
568 Ga0207706_10059766
569 Ga0207686_10428464
570 Ga0207709_10105299
571 Ga0207709_10539309
572 Ga0207669_10161019
573 Ga0207665_10002722
574 Ga0207665_10018443
575 Ga0207665_10029397
576 Ga0207711_10338305
577 Ga0207689_10068866
578 Ga0207661_10971948
579 Ga0207679_10059600
580 Ga0207667_10070333
581 Ga0207667_10348441
582 Ga0207712_10051269
583 Ga0207668_10100203
584 Ga0207668_10467765
585 Ga0207677_10252295
586 Ga0207678_10112314
587 Ga0207708_10005214
588 Ga0207702_10039579
589 Ga0207702_10668051
590 Ga0207648_10041322
591 Ga0207674_10174086
592 Ga0207675_100000456
593 Ga0207675_100102653
594 Ga0207675_100107111
595 Ga0207683_10000966
596 Ga0207683_10801793
597 Ga0207698_10235357
598 Ga0207428_10011431
599 Ga0207428_10034562
600 Ga0207428_10036509
601 Ga0207428_10042204
602 Ga0268265_10150192
603 Ga0265338_10005206
604 Ga0265330_10062128
605 Ga0265332_10050540
606 Ga0265325_10144864
607 Ga0265339_10010018
608 Ga0265316_10037081
609 Ga0307408_100086990
610 Ga0265313_10017849
611 Ga0265314_10048064
612 Ga0307405_10010149
613 Ga0307413_10074862
614 Ga0307406_10017374
615 Ga0307407_10006236
616 Ga0307409_100003774
617 Ga0307409_100330205
618 Ga0307416_100122329
619 Ga0307416_100591873
620 Ga0307411_10025505
621 Ga0307415_100080616
622 Ga0373926_0105242
623 Ga0373929_0009247
624 Ga0373944_0022981
625 Ga0373949_0036102
626 Ga0373932_0123822
627 Ga0373945_0038152
628 Ga0373960_0076850
629 Ga0373943_0002967
630 Ga0373942_0052546
631 Ga0373931_0013398
632 Ga0373931_0055632
633 Ga0373935_0269980
634 Ga0373927_0175555
635 Ga0373925_0027249
636 Ga0395899_0001122
637 Ga0395899_0001661
638 Ga0395899_0004487
639 Ga0395899_0009564
640 Ga0395899_0017631
641 Ga0395899_0032360
642 Ga0395899_0143795
643 Ga0395900_0002317
644 Ga0395900_0003438
645 Ga0395900_0003596
646 Ga0395900_0007355
647 Ga0395900_0010807
648 Ga0395900_0011577
649 Ga0395900_0018537
650 Ga0395900_0067970
651 Ga0395900_0087128
652 Ga0395900_0193523
653 Ga0395900_0577778
654 Ga0395900_0971435
655 Ga0395898_0002928
656 Ga0395898_0004496
657 Ga0395898_0005497
658 Ga0395898_0006490
659 Ga0395898_0007699
660 Ga0395898_0012098
661 Ga0395898_0015744
662 Ga0395898_0024515
663 Ga0395898_0038499
664 Ga0395898_0050871
665 Ga0395898_0139131
666 Ga0395898_0203979
667 Ga0395898_0225771
668 Ga0395898_0556144
669 Ga0395905_0000698
670 Ga0395905_0002131
671 Ga0395905_0002582
672 Ga0395905_0005008
673 Ga0395905_0010671
674 Ga0395905_0019443
675 Ga0395905_0057327
676 Ga0395905_0068540
677 Ga0395905_0739202
678 Ga0395901_0001102
679 Ga0395901_0002813
680 Ga0395901_0004069
681 Ga0395901_0006375
682 Ga0395901_0016010
683 Ga0395901_0019191
684 Ga0395901_0028131
685 Ga0395901_0029178
686 Ga0395901_0030317
687 Ga0395901_0051379
688 Ga0395901_0102288
689 Ga0395901_0140152
690 Ga0395901_0151551
691 Ga0395901_0344234
692 Ga0395901_0498655
693 Ga0451793_0306043
694 Ga0451800_1675168
695 Ga0451804_0190983
696 Ga0451835_0458117
697 Ga0451841_1198872
698 Ga0451843_0646594
699 Ga0451855_1787749
700 Ga0451853_0629942
701 Ga0450888_008706
702 Ga0453683_0419148
703 Ga0466961_0164827
704 Ga0466963_0044692
705 Ga0466963_0073328
706 Ga0466957_0178698
707 Ga0451576_0023056
708 Ga0451576_0287639
709 Ga0451576_0693644
710 Ga0466958_0006781
711 Ga0466967_0006488
712 Ga0466967_0049447
713 Ga0466967_0463474
714 Ga0466967_0505518
715 Ga0495603_0013877
716 Ga0495590_0178805
717 Ga0495641_0001479
718 Ga0495653_0102297
719 Ga0495582_0030821
720 Ga0495584_0025942
721 Ga0495585_0056579
722 Ga0495594_0024968
723 Ga0495596_0048617
724 Ga0495607_0035822
725 Ga0495607_0074305
726 Ga0495637_0139080
727 Ga0495663_0129127
728 Ga0495656_0005436
729 Ga0495611_0171833
730 Ga0495659_0005439
731 Ga0495588_0005935
732 Ga0495658_0040678
733 Ga0495670_0187125
734 Ga0495671_0190226
735 Ga0495660_0180427
736 Ga0495581_0063929
737 Ga0495581_0077468
738 Ga0495676_0000629
739 Ga0495676_0309039
740 Ga0495615_0019423
741 Ga0496101_0601767
742 Ga0496102_0013857
743 Ga0496102_0155906
744 Ga0496102_0516852
745 Ga0496103_0045265
746 Ga0496103_0163817
747 Ga0496103_0197899
748 Ga0496103_0201432
749 Ga0496104_0061366
750 Ga0496105_0090133
751 Ga0496105_0104668
752 Ga0496106_0223710
753 Ga0496107_0027200
754 Ga0496108_0037759
755 Ga0496108_0739675
756 Ga0496109_0060788
757 Ga0496109_0098419
758 Ga0496110_0016084
759 Ga0496110_0036546
760 Ga0496110_0094043
761 Ga0496110_0302442
762 Ga0496110_0447686
763 Ga0496111_0001090
764 Ga0496111_0005132
765 Ga0496111_0036806
766 Ga0496111_0153198
767 Ga0496112_0011153
768 Ga0496112_0354112
769 Ga0496112_0699403
770 Ga0496113_0032462
771 Ga0496113_0088910
772 Ga0496113_0233204
773 Ga0496114_0063139
774 Ga0496114_0163505
775 Ga0496115_0063563
776 Ga0501031_0261412
777 Ga0501032_0017559
778 Ga0501033_0069966
779 Ga0501036_0036690
780 Ga0501037_0045967
781 Ga0501038_0009753
782 Ga0501039_0004930
783 Ga0501041_0055292
784 Ga0501042_0001104
785 Ga0501043_0045439
786 Ga0501046_0002240
787 Ga0501046_0144685
788 Ga0501048_0009035
789 Ga0501067_0001089
790 Ga0501067_0012191
791 Ga0501068_0001492
792 Ga0501068_0008713
793 Ga0501069_0002405
794 Ga0501069_0007329
795 Ga0501069_0067646
796 Ga0501071_0156336
797 Ga0501071_0225960
798 Ga0501071_0319660
799 Ga0501072_0339715
800 Ga0501073_0000892
801 Ga0501074_0025653
802 Ga0501075_0016129
803 Ga0501080_0005519
804 Ga0501081_0149020
805 Ga0501083_0001459
806 Ga0501035_0009424
807 Ga0501044_0117073
808 Ga0501045_0001864
809 Ga0501045_0315759
810 nmdc:mga03683_137646_c1
811 nmdc:mga05p37_144680_c1
812 nmdc:mga05p37_162103_c1
813 nmdc:mga05p37_34917_c1
814 nmdc:mga05p37_774706_c1
815 nmdc:mga09592_94935_c1
816 nmdc:mga06r32_616937_c1
817 nmdc:mga06r32_752260_c1
818 nmdc:mga08y16_126264_c1
819 nmdc:mga08y16_134215_c1
820 nmdc:mga08y16_157728_c1
821 nmdc:mga08y16_23110_c1
822 nmdc:mga0n895_276213_c1
823 nmdc:mga0n895_3263_c1
824 nmdc:mga0n895_929701_c1
825 nmdc:mga0rr50_17598_c1
826 nmdc:mga08x19_133266_c1
827 nmdc:mga08x19_30095_c1
828 nmdc:mga0a205_460_c1
829 nmdc:mga0a205_55469_c1
830 Ga0495655_0061104
831 Ga0501084_0073187
832 Ga0530510_0016025
833 Ga0530510_0064428
834 Ga0530510_0273163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

151

217

0.91

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

5

197

0.85

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

2

191

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l8h-assembly4.cif.gz_D crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from b. bronchiseptica complexed with magnesium and phosphate 0.8042 95 222
1xpj-assembly1.cif.gz_D crystal structure of mcsg target apc26283 from vibrio cholerae 0.7886 98 149
2mu1-assembly1.cif.gz_A nmr structure of the core domain of np_346487.1, a putative phosphoglycolate phosphatase from streptococcus pneumoniae tigr4 0.7833 107 211
2pr7-assembly2.cif.gz_B crystal structure of uncharacterized protein (np_599989.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.44 a resolution 0.7828 104 225
3k1z-assembly1.cif.gz_A crystal structure of human haloacid dehalogenase-like hydrolase domain containing 3 (hdhd3) 0.7725 3 223
ID Description Score Start End Superfamily
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9331 99 220 3.40.50.1000
af_Q9BI82_131_243_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9095 109 215 3.40.50.1000
3k1zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8954 95 223 3.40.50.1000
af_Q9W4J7_113_224_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8934 96 199 3.40.50.1000
af_Q94915_113_247_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8878 105 215 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7Y6CTR9-F1-model_v4 HAD-IA family hydrolase 0.9925 107 225 GO:0016791
GO:0044283
AF-A0A7W0N097-F1-model_v4 HAD-IA family hydrolase 0.9917 2 202 GO:0016791
GO:0044283
AF-A0A7W0NMT4-F1-model_v4 HAD-IA family hydrolase 0.9864 133 225 GO:0016791
GO:0044283
AF-A0A6J6NNU3-F1-model_v4 Unannotated protein 0.986 3 225 GO:0016791
GO:0044283
AF-A0A7W1BUW1-F1-model_v4 HAD-IA family hydrolase 0.9841 30 225 GO:0016791
GO:0044283

Map