F439148

General Info

Members Datasets Scaffolds Average Seq Length
417 183 834 223

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0011437|Ga0496104_0011437_5153_5821
Length 209
Sequence MIGTFALVFAGCGAVMVDAKTHQLGHVGVAITFGLVILFGIYAVGHISGAHFNPAVTFAFALTRHFPWPRALAYWGAQVAGNIAHVGATLPSGSQGQSFLWEFVMSGFLMFVILAVATDTRAVGEAAAIAIGGTILFDAMFGGPISGASMNPARSFGPAVVSGDLHTLWLYILAPVLGASLGGLAYQYVRGEPTRPGEISEPAVPEELA

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
79 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
82 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
83 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
84 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
85 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
86 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
87 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
88 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
95 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
98 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
113 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
114 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
115 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
127 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
141 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.52
Metatranscriptomes 0.48
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 19.9
Rhizosphere 80.1
Stem 0
Stem Tuber 0
Unclassified 2.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0011437 3300048907 Bacteria 7950
2 Ga0070658_10051006 3300005327 Bacteria 3353
3 Ga0070683_100003342 3300005329 Bacteria 12980
4 Ga0070683_100037947 3300005329 Bacteria 4413
5 Ga0070683_100243482 3300005329 Bacteria 1710
6 Ga0070680_100061542 3300005336 Bacteria 3073
7 Ga0070680_100211885 3300005336 Unclassified 1635
8 Ga0070682_100108551 3300005337 Bacteria 1845
9 Ga0070671_100142500 3300005355 Bacteria 2023
10 Ga0070667_100002607 3300005367 Bacteria 15648
11 Ga0070709_10017441 3300005434 Bacteria 4118
12 Ga0070714_100014476 3300005435 Bacteria 6336
13 Ga0070714_100042305 3300005435 Bacteria 3848
14 Ga0070714_100093739 3300005435 Bacteria 2634
15 Ga0070714_100100460 3300005435 Bacteria 2548
16 Ga0070714_100305881 3300005435 Bacteria 1483
17 Ga0070714_100890756 3300005435 Unclassified 864
18 Ga0070710_10044124 3300005437 Bacteria 2472
19 Ga0070711_100120547 3300005439 Bacteria 1939
20 Ga0070708_100144171 3300005445 Bacteria 2211
21 Ga0070678_100018938 3300005456 Bacteria 4473
22 Ga0070681_10026938 3300005458 Bacteria 5780
23 Ga0070681_10167225 3300005458 Bacteria 2122
24 Ga0070681_10324654 3300005458 Bacteria 1449
25 Ga0070706_100162154 3300005467 Bacteria 2088
26 Ga0070706_100187873 3300005467 Bacteria 1931
27 Ga0070707_100000644 3300005468 Bacteria 34849
28 Ga0070707_100242889 3300005468 Bacteria 1752
29 Ga0070698_100196562 3300005471 Bacteria 1953
30 Ga0070679_100007476 3300005530 Bacteria 10214
31 Ga0070679_100049203 3300005530 Bacteria 4198
32 Ga0070679_100398201 3300005530 Bacteria 1323
33 Ga0070684_100003310 3300005535 Bacteria 12072
34 Ga0070684_100009303 3300005535 Bacteria 7735
35 Ga0070684_100009575 3300005535 Bacteria 7634
36 Ga0070697_100052928 3300005536 Bacteria 3299
37 Ga0070686_100339619 3300005544 Bacteria 1125
38 Ga0070695_100252618 3300005545 Bacteria 1284
39 Ga0070693_100023151 3300005547 Bacteria 3316
40 Ga0070665_100181389 3300005548 Bacteria 2106
41 Ga0070704_100309689 3300005549 Bacteria 1319
42 Ga0068856_100000869 3300005614 Bacteria 32365
43 Ga0068856_100068513 3300005614 Bacteria 3508
44 Ga0070702_100336115 3300005615 Bacteria 1058
45 Ga0081455_10011273 3300005937 Bacteria 8996
46 Ga0070717_10008801 3300006028 Bacteria 7558
47 Ga0070717_10120301 3300006028 Bacteria 2249
48 Ga0070717_10304360 3300006028 Bacteria 1417
49 Ga0070717_10617645 3300006028 Bacteria 983
50 Ga0070715_10143899 3300006163 Bacteria 1161
51 Ga0070716_100346441 3300006173 Bacteria 1050
52 Ga0070712_100167263 3300006175 Bacteria 1703
53 Ga0097621_100047203 3300006237 Bacteria 3489
54 Ga0068871_100184743 3300006358 Bacteria 1793
55 Ga0075430_100492944 3300006846 Bacteria 1011
56 Ga0068865_100273544 3300006881 Bacteria 1342
57 Ga0105240_10132913 3300009093 Bacteria 2982
58 Ga0105245_10083996 3300009098 Bacteria 2916
59 Ga0105245_10260596 3300009098 Bacteria 1687
60 Ga0114129_10029880 3300009147 Bacteria 7717
61 Ga0105241_10021681 3300009174 Bacteria 4752
62 Ga0105241_10079654 3300009174 Bacteria 2562
63 Ga0105242_10219704 3300009176 Bacteria 1698
64 Ga0105249_10173779 3300009553 Bacteria 2091
65 Ga0105239_10122631 3300010375 Bacteria 2887
66 Ga0157374_10138300 3300013296 Bacteria 2362
67 Ga0163162_10160611 3300013306 Bacteria 2369
68 Ga0157372_10612322 3300013307 Bacteria 1269
69 Ga0157372_10953203 3300013307 Bacteria 995
70 Ga0157375_10013678 3300013308 Bacteria 7234
71 Ga0157375_10967664 3300013308 Bacteria 992
72 Ga0157375_11490592 3300013308 Bacteria 798
73 Ga0182008_10003096 3300014497 Bacteria 10204
74 Ga0182008_10101627 3300014497 Bacteria 1421
75 Ga0182008_10373634 3300014497 Bacteria 760
76 Ga0157377_10078366 3300014745 Bacteria 1926
77 Ga0157376_10152283 3300014969 Bacteria 2087
78 Ga0206354_10631243 3300020081 Bacteria 1507
79 Ga0206353_10320973 3300020082 Bacteria 2981
80 Ga0207692_10017874 3300025898 Bacteria 3171
81 Ga0207692_10153343 3300025898 Bacteria 1321
82 Ga0207705_10147767 3300025909 Bacteria 1759
83 Ga0207654_10039100 3300025911 Bacteria 2666
84 Ga0207707_10028642 3300025912 Bacteria 4868
85 Ga0207707_10293814 3300025912 Bacteria 1406
86 Ga0207707_10378253 3300025912 Bacteria 1218
87 Ga0207695_10175433 3300025913 Unclassified 2066
88 Ga0207693_10040821 3300025915 Bacteria 3654
89 Ga0207693_10062329 3300025915 Bacteria 2921
90 Ga0207663_10001587 3300025916 Bacteria 10677
91 Ga0207660_10033163 3300025917 Bacteria 3569
92 Ga0207657_10036284 3300025919 Bacteria 4413
93 Ga0207657_10052709 3300025919 Bacteria 3529
94 Ga0207652_10001084 3300025921 Bacteria 24669
95 Ga0207652_10014130 3300025921 Bacteria 6464
96 Ga0207652_10315234 3300025921 Bacteria 1412
97 Ga0207646_10002340 3300025922 Bacteria 22414
98 Ga0207646_10067034 3300025922 Bacteria 3204
99 Ga0207687_10084727 3300025927 Bacteria 2298
100 Ga0207700_10301763 3300025928 Bacteria 1383
101 Ga0207664_10010035 3300025929 Bacteria 6673
102 Ga0207664_10125358 3300025929 Bacteria 2155
103 Ga0207664_10182923 3300025929 Bacteria 1800
104 Ga0207664_10191217 3300025929 Bacteria 1762
105 Ga0207664_10223823 3300025929 Bacteria 1633
106 Ga0207664_10287462 3300025929 Bacteria 1444
107 Ga0207664_10522395 3300025929 Unclassified 1064
108 Ga0207644_10269899 3300025931 Bacteria 1363
109 Ga0207665_10001535 3300025939 Bacteria 15537
110 Ga0207665_10151508 3300025939 Bacteria 1661
111 Ga0207711_10276499 3300025941 Bacteria 1546
112 Ga0207711_10466001 3300025941 Bacteria 1177
113 Ga0207661_10000505 3300025944 Bacteria 25193
114 Ga0207679_10277316 3300025945 Bacteria 1436
115 Ga0207658_10003173 3300025986 Bacteria 11731
116 Ga0207677_10704868 3300026023 Bacteria 896
117 Ga0207678_10019356 3300026067 Bacteria 5980
118 Ga0207678_10164401 3300026067 Bacteria 1895
119 Ga0207702_10017127 3300026078 Bacteria 5994
120 Ga0207702_10022492 3300026078 Bacteria 5227
121 Ga0207683_10002241 3300026121 Bacteria 16993
122 Ga0207683_10181305 3300026121 Bacteria 1909
123 Ga0268266_10148695 3300028379 Bacteria 2109
124 Ga0265334_10055345 3300028573 Bacteria 1510
125 Ga0265336_10003217 3300028666 Bacteria 6477
126 Ga0265336_10029266 3300028666 Bacteria 1719
127 Ga0265338_10014111 3300028800 Bacteria 8935
128 Ga0265338_10102552 3300028800 Bacteria 2326
129 Ga0265338_10144259 3300028800 Bacteria 1860
130 Ga0265338_10368912 3300028800 Bacteria 1028
131 Ga0265324_10013087 3300029957 Bacteria 3105
132 Ga0265332_10033198 3300031238 Bacteria 2247
133 Ga0265320_10086164 3300031240 Bacteria 1461
134 Ga0265340_10032451 3300031247 Bacteria 2607
135 Ga0265339_10026757 3300031249 Bacteria 3300
136 Ga0265327_10046501 3300031251 Bacteria 2296
137 Ga0265316_10531520 3300031344 Bacteria 838
138 Ga0265313_10010288 3300031595 Bacteria 5943
139 Ga0265313_10024397 3300031595 Bacteria 3231
140 Ga0265314_10021043 3300031711 Bacteria 5026
141 Ga0265314_10308112 3300031711 Bacteria 886
142 Ga0265342_10044741 3300031712 Bacteria 2667
143 Ga0307409_100393178 3300031995 Unclassified 1322
144 Ga0307416_100202760 3300032002 Bacteria 1884
145 Ga0373934_0078459 3300035086 Bacteria 1325
146 Ga0373934_0112450 3300035086 Bacteria 1105
147 Ga0373943_0088108 3300035170 Bacteria 1603
148 Ga0373955_0165873 3300035172 Bacteria 1306
149 Ga0373927_0000162 3300035695 Bacteria 52139
150 Ga0373933_0331476 3300035724 Bacteria 987
151 Ga0373933_0497039 3300035724 Bacteria 799
152 Ga0373947_0007064 3300035725 Bacteria 6507
153 Ga0373937_0000107 3300036401 Bacteria 79333
154 Ga0373937_0258813 3300036401 Bacteria 1641
155 Ga0395899_0001956 3300037312 Bacteria 16937
156 Ga0395899_0050779 3300037312 Bacteria 3078
157 Ga0395899_0116840 3300037312 Bacteria 1914
158 Ga0395900_0004915 3300037418 Bacteria 14072
159 Ga0395900_0009898 3300037418 Bacteria 9764
160 Ga0395900_0037133 3300037418 Bacteria 5024
161 Ga0395900_0038352 3300037418 Bacteria 4938
162 Ga0395900_0588161 3300037418 Unclassified 1054
163 Ga0395900_0678478 3300037418 Bacteria 965
164 Ga0395898_0001911 3300037466 Bacteria 26537
165 Ga0395898_0011017 3300037466 Bacteria 9422
166 Ga0395898_0101940 3300037466 Bacteria 2756
167 Ga0395898_0163450 3300037466 Bacteria 2129
168 Ga0395898_0321250 3300037466 Unclassified 1477
169 Ga0395898_0469944 3300037466 Bacteria 1197
170 Ga0395905_0004683 3300037471 Bacteria 14143
171 Ga0395905_0084521 3300037471 Bacteria 2973
172 Ga0395905_0164966 3300037471 Bacteria 2081
173 Ga0395905_0264443 3300037471 Bacteria 1605
174 Ga0395905_0441252 3300037471 Bacteria 1199
175 Ga0395905_0518536 3300037471 Bacteria 1092
176 Ga0395901_0003696 3300038443 Bacteria 15428
177 Ga0395901_0007126 3300038443 Bacteria 11290
178 Ga0395901_0012235 3300038443 Bacteria 8709
179 Ga0395901_0061283 3300038443 Bacteria 3915
180 Ga0395901_0077751 3300038443 Bacteria 3463
181 Ga0395901_0090751 3300038443 Bacteria 3198
182 Ga0395901_0117324 3300038443 Bacteria 2796
183 Ga0395901_0225481 3300038443 Bacteria 1958
184 Ga0395901_0569761 3300038443 Bacteria 1145
185 Ga0436362_0753487 3300039453 Archaea 692
186 Ga0466963_0120430 3300044694 Bacteria 1805
187 Ga0466957_0040283 3300044842 Bacteria 2821
188 Ga0466967_0030040 3300045976 Bacteria 4556
189 Ga0466967_0034362 3300045976 Bacteria 4302
190 Ga0466967_0919876 3300045976 Bacteria 870
191 Ga0495592_0000089 3300046454 Bacteria 80990
192 Ga0495592_0019587 3300046454 Bacteria 5147
193 Ga0495592_0034689 3300046454 Bacteria 3802
194 Ga0495603_0011712 3300046455 Bacteria 5308
195 Ga0495603_0470537 3300046455 Bacteria 720
196 Ga0495629_0083520 3300046459 Bacteria 2229
197 Ga0495629_0285400 3300046459 Bacteria 1132
198 Ga0495629_0376998 3300046459 Bacteria 966
199 Ga0495641_0082751 3300046461 Bacteria 1437
200 Ga0495641_0128255 3300046461 Bacteria 1132
201 Ga0495651_0000057 3300046462 Bacteria 82943
202 Ga0495651_0007223 3300046462 Bacteria 8492
203 Ga0495651_0430345 3300046462 Bacteria 856
204 Ga0495651_0440817 3300046462 Bacteria 843
205 Ga0495653_0001230 3300046463 Bacteria 19892
206 Ga0495653_0015247 3300046463 Bacteria 6263
207 Ga0495653_0028034 3300046463 Bacteria 4507
208 Ga0495653_0192738 3300046463 Bacteria 1389
209 Ga0495653_0497622 3300046463 Bacteria 760
210 Ga0495580_0420157 3300046472 Bacteria 900
211 Ga0495582_0030432 3300046473 Bacteria 2964
212 Ga0495582_0274410 3300046473 Bacteria 968
213 Ga0495664_0101921 3300046477 Bacteria 1730
214 Ga0495664_0263382 3300046477 Bacteria 1042
215 Ga0495608_0011459 3300046511 Bacteria 6171
216 Ga0495608_0052409 3300046511 Bacteria 2701
217 Ga0495608_0146044 3300046511 Bacteria 1509
218 Ga0495608_0216987 3300046511 Bacteria 1201
219 Ga0495608_0284688 3300046511 Bacteria 1025
220 Ga0495618_0000704 3300046514 Bacteria 23313
221 Ga0495628_0000066 3300046516 Bacteria 85699
222 Ga0495628_0009381 3300046516 Bacteria 8352
223 Ga0495628_0084449 3300046516 Bacteria 2464
224 Ga0495628_0728840 3300046516 Bacteria 698
225 Ga0495630_0025943 3300046517 Bacteria 4337
226 Ga0495630_0040249 3300046517 Bacteria 3493
227 Ga0495644_0075942 3300046523 Bacteria 1265
228 Ga0495666_0104914 3300046526 Bacteria 1330
229 Ga0495642_0138491 3300046528 Bacteria 1050
230 Ga0495652_0000118 3300046529 Bacteria 85706
231 Ga0495652_0096747 3300046529 Bacteria 2403
232 Ga0495652_0097259 3300046529 Bacteria 2395
233 Ga0495652_0115730 3300046529 Bacteria 2148
234 Ga0495652_0282395 3300046529 Bacteria 1215
235 Ga0495640_0052370 3300046533 Bacteria 2803
236 Ga0495640_0087328 3300046533 Bacteria 2063
237 Ga0495640_0272990 3300046533 Bacteria 1054
238 Ga0495640_0340554 3300046533 Bacteria 927
239 Ga0495586_0010903 3300046535 Bacteria 4829
240 Ga0495586_0293819 3300046535 Bacteria 931
241 Ga0495587_0000096 3300046536 Bacteria 68520
242 Ga0495587_0022877 3300046536 Bacteria 3845
243 Ga0495587_0041657 3300046536 Bacteria 2739
244 Ga0495587_0190015 3300046536 Bacteria 1163
245 Ga0495645_0000052 3300046543 Bacteria 86470
246 Ga0495645_0029216 3300046543 Bacteria 4007
247 Ga0495645_0229665 3300046543 Bacteria 1244
248 Ga0495645_0301440 3300046543 Bacteria 1047
249 Ga0495667_0116958 3300046559 Bacteria 1722
250 Ga0495667_0155260 3300046559 Bacteria 1473
251 Ga0495667_0206694 3300046559 Bacteria 1255
252 Ga0495656_0068484 3300046615 Bacteria 1569
253 Ga0495634_0058066 3300046642 Bacteria 2580
254 Ga0495634_0087826 3300046642 Bacteria 2023
255 Ga0495611_0053343 3300046648 Bacteria 1825
256 Ga0495635_0005732 3300046663 Bacteria 8651
257 Ga0495635_0031300 3300046663 Bacteria 3694
258 Ga0495635_0371865 3300046663 Bacteria 952
259 Ga0495659_0092215 3300046664 Bacteria 1164
260 Ga0495657_0002379 3300046675 Bacteria 15824
261 Ga0495657_0022527 3300046675 Bacteria 4511
262 Ga0495657_0044386 3300046675 Bacteria 3024
263 Ga0495657_0128765 3300046675 Bacteria 1587
264 Ga0495599_0000046 3300046678 Bacteria 85727
265 Ga0495599_0004409 3300046678 Bacteria 8325
266 Ga0495599_0267758 3300046678 Unclassified 1037
267 Ga0495623_0000061 3300046679 Bacteria 67279
268 Ga0495646_0001530 3300046680 Bacteria 13780
269 Ga0495647_0198976 3300046681 Bacteria 878
270 Ga0495658_0003986 3300046683 Bacteria 7274
271 Ga0495658_0161822 3300046683 Bacteria 1381
272 Ga0495613_0044389 3300046689 Bacteria 3289
273 Ga0495613_0113665 3300046689 Bacteria 1949
274 Ga0495670_0052517 3300046691 Bacteria 2041
275 Ga0495589_0123167 3300046794 Bacteria 1248
276 Ga0495600_0003166 3300046809 Bacteria 9630
277 Ga0495600_0225505 3300046809 Bacteria 1198
278 Ga0495600_0299302 3300046809 Bacteria 1015
279 Ga0495581_0111775 3300047315 Bacteria 1589
280 Ga0495604_0000075 3300047317 Bacteria 85370
281 Ga0495604_0169300 3300047317 Bacteria 1538
282 Ga0495674_0009852 3300047319 Bacteria 9071
283 Ga0495674_0020877 3300047319 Bacteria 6063
284 Ga0495674_0204181 3300047319 Bacteria 1639
285 Ga0495674_0341078 3300047319 Bacteria 1218
286 Ga0495674_0431017 3300047319 Bacteria 1061
287 Ga0495676_0031426 3300047321 Bacteria 4491
288 Ga0495676_0284089 3300047321 Bacteria 1120
289 Ga0495676_0382668 3300047321 Bacteria 936
290 Ga0495680_0001666 3300047322 Bacteria 23625
291 Ga0495680_0002544 3300047322 Bacteria 18608
292 Ga0495680_0005828 3300047322 Bacteria 11531
293 Ga0495680_0589176 3300047322 Unclassified 745
294 Ga0495675_0000089 3300047444 Bacteria 64853
295 Ga0495675_0158229 3300047444 Bacteria 1396
296 Ga0495679_054564 3300047446 Bacteria 1190
297 Ga0495684_0002756 3300047471 Bacteria 13883
298 Ga0495684_0005868 3300047471 Bacteria 9542
299 Ga0495684_0035005 3300047471 Bacteria 3852
300 Ga0495684_0217731 3300047471 Bacteria 1401
301 Ga0495684_0219910 3300047471 Bacteria 1393
302 Ga0495602_0000140 3300048088 Bacteria 68037
303 Ga0495602_0050026 3300048088 Bacteria 3738
304 Ga0495602_0074089 3300048088 Bacteria 2895
305 Ga0495602_0192009 3300048088 Bacteria 1565
306 Ga0496100_0007564 3300048903 Bacteria 6002
307 Ga0496100_0032173 3300048903 Bacteria 3267
308 Ga0496100_0168653 3300048903 Bacteria 1574
309 Ga0496100_0329836 3300048903 Bacteria 1148
310 Ga0496100_0459204 3300048903 Bacteria 977
311 Ga0496101_0003576 3300048904 Bacteria 9700
312 Ga0496101_0016550 3300048904 Bacteria 4986
313 Ga0496101_0017758 3300048904 Bacteria 4827
314 Ga0496101_0019711 3300048904 Bacteria 4610
315 Ga0496101_0040080 3300048904 Bacteria 3335
316 Ga0496101_0056717 3300048904 Bacteria 2832
317 Ga0496101_0081973 3300048904 Bacteria 2387
318 Ga0496101_0175433 3300048904 Bacteria 1648
319 Ga0496102_0001239 3300048905 Bacteria 23103
320 Ga0496102_0289426 3300048905 Bacteria 1544
321 Ga0496102_0436881 3300048905 Bacteria 1228
322 Ga0496102_0681409 3300048905 Bacteria 951
323 Ga0496103_0001010 3300048906 Bacteria 19673
324 Ga0496104_0000722 3300048907 Bacteria 28422
325 Ga0496104_0002242 3300048907 Bacteria 16680
326 Ga0496104_0007226 3300048907 Bacteria 9799
327 Ga0496104_0020574 3300048907 Bacteria 6050
328 Ga0496104_0150689 3300048907 Bacteria 2232
329 Ga0496104_0189360 3300048907 Bacteria 1968
330 Ga0496104_0328864 3300048907 Bacteria 1441
331 Ga0496104_0474590 3300048907 Bacteria 1162
332 Ga0496105_0000228 3300048908 Bacteria 37935
333 Ga0496105_0000741 3300048908 Bacteria 22135
334 Ga0496105_0015203 3300048908 Bacteria 6129
335 Ga0496105_0017551 3300048908 Bacteria 5741
336 Ga0496105_0092264 3300048908 Bacteria 2500
337 Ga0496106_0049502 3300048909 Bacteria 3166
338 Ga0496106_0196560 3300048909 Bacteria 1604
339 Ga0496107_0062401 3300048910 Bacteria 2700
340 Ga0496107_0137758 3300048910 Bacteria 1803
341 Ga0496107_0291248 3300048910 Bacteria 1215
342 Ga0496107_0318439 3300048910 Bacteria 1157
343 Ga0496107_0466098 3300048910 Bacteria 938
344 Ga0496108_0022746 3300048911 Bacteria 5156
345 Ga0496108_0028607 3300048911 Bacteria 4612
346 Ga0496108_0029699 3300048911 Bacteria 4529
347 Ga0496108_0080676 3300048911 Bacteria 2756
348 Ga0496108_0082837 3300048911 Bacteria 2720
349 Ga0496108_0554548 3300048911 Bacteria 1002
350 Ga0496109_0000638 3300048912 Bacteria 29181
351 Ga0496109_0001541 3300048912 Bacteria 19158
352 Ga0496109_0003779 3300048912 Bacteria 12640
353 Ga0496109_0005050 3300048912 Bacteria 11027
354 Ga0496109_0037899 3300048912 Bacteria 4357
355 Ga0496109_0041153 3300048912 Bacteria 4187
356 Ga0496109_0044361 3300048912 Bacteria 4033
357 Ga0496109_0274372 3300048912 Bacteria 1589
358 Ga0496109_0933183 3300048912 Bacteria 806
359 Ga0496110_0001269 3300048913 Bacteria 18061
360 Ga0496110_0010416 3300048913 Bacteria 7559
361 Ga0496110_0052967 3300048913 Bacteria 3566
362 Ga0496110_0130498 3300048913 Bacteria 2269
363 Ga0496110_0230717 3300048913 Bacteria 1684
364 Ga0496111_0000025 3300048914 Bacteria 62100
365 Ga0496111_0002767 3300048914 Bacteria 10671
366 Ga0496111_0015272 3300048914 Bacteria 5268
367 Ga0496111_0038930 3300048914 Bacteria 3407
368 Ga0496111_0073182 3300048914 Bacteria 2495
369 Ga0496111_0613902 3300048914 Bacteria 795
370 Ga0496112_0056106 3300048915 Bacteria 3876
371 Ga0496112_0415792 3300048915 Archaea 1284
372 Ga0496112_0720587 3300048915 Bacteria 925
373 Ga0496112_0937262 3300048915 Bacteria 787
374 Ga0496113_0095449 3300048916 Bacteria 2298
375 Ga0496113_0119694 3300048916 Bacteria 2057
376 Ga0496113_0152796 3300048916 Bacteria 1822
377 Ga0496114_0000264 3300048917 Bacteria 38127
378 Ga0496114_0008049 3300048917 Bacteria 8346
379 Ga0496114_0033307 3300048917 Bacteria 4245
380 Ga0496114_0061195 3300048917 Bacteria 3148
381 Ga0496114_0062635 3300048917 Bacteria 3113
382 Ga0496114_0115215 3300048917 Bacteria 2306
383 Ga0496114_0152019 3300048917 Bacteria 2008
384 Ga0496114_1226893 3300048917 Bacteria 636
385 Ga0496115_0028138 3300048918 Bacteria 4403
386 Ga0496115_0048662 3300048918 Bacteria 3391
387 Ga0496115_0157207 3300048918 Bacteria 1878
388 Ga0501038_0380881 3300049574 Bacteria 1094
389 Ga0501047_0081965 3300049581 Bacteria 3101
390 Ga0501067_0066910 3300049583 Bacteria 1988
391 Ga0501069_0261932 3300049585 Bacteria 1010
392 Ga0501070_0052124 3300049586 Bacteria 3396
393 Ga0501070_0633410 3300049586 Bacteria 850
394 Ga0501070_0836302 3300049586 Unclassified 721
395 Ga0501074_0105878 3300049590 Bacteria 2013
396 Ga0501080_0132942 3300049742 Bacteria 2303
397 Ga0501080_0515798 3300049742 Bacteria 1067
398 nmdc:mga05p37_28004_c1 3300050507 Bacteria 6865
399 nmdc:mga0qj67_427343_c1 3300050509 Bacteria 1068
400 nmdc:mga06r32_204657_c1 3300050510 Bacteria 1961
401 Ga0495601_0000273 3300053077 Bacteria 28075
402 Ga0495601_0003869 3300053077 Bacteria 8620
403 Ga0495601_0050767 3300053077 Bacteria 2617
404 Ga0495601_0051893 3300053077 Bacteria 2589
405 Ga0495601_0088191 3300053077 Bacteria 1995
406 Ga0495601_0101631 3300053077 Bacteria 1857
407 Ga0495601_0123782 3300053077 Bacteria 1681
408 Ga0495612_0019083 3300053078 Bacteria 2746
409 Ga0495612_0031257 3300053078 Bacteria 2146
410 Ga0495612_0191568 3300053078 Bacteria 900
411 Ga0495595_0004122 3300053084 Bacteria 5831
412 Ga0495595_0005879 3300053084 Bacteria 4974
413 Ga0495595_0016435 3300053084 Bacteria 3166
414 Ga0495619_0000618 3300053085 Bacteria 23510
415 Ga0495619_0021261 3300053085 Bacteria 4140
416 Ga0495619_0027689 3300053085 Bacteria 3653
417 Ga0495619_0331230 3300053085 Bacteria 1054
418 Ga0496104_0011437
419 Ga0070658_10051006
420 Ga0070683_100003342
421 Ga0070683_100037947
422 Ga0070683_100243482
423 Ga0070680_100061542
424 Ga0070680_100211885
425 Ga0070682_100108551
426 Ga0070671_100142500
427 Ga0070667_100002607
428 Ga0070709_10017441
429 Ga0070714_100014476
430 Ga0070714_100042305
431 Ga0070714_100093739
432 Ga0070714_100100460
433 Ga0070714_100305881
434 Ga0070714_100890756
435 Ga0070710_10044124
436 Ga0070711_100120547
437 Ga0070708_100144171
438 Ga0070678_100018938
439 Ga0070681_10026938
440 Ga0070681_10167225
441 Ga0070681_10324654
442 Ga0070706_100162154
443 Ga0070706_100187873
444 Ga0070707_100000644
445 Ga0070707_100242889
446 Ga0070698_100196562
447 Ga0070679_100007476
448 Ga0070679_100049203
449 Ga0070679_100398201
450 Ga0070684_100003310
451 Ga0070684_100009303
452 Ga0070684_100009575
453 Ga0070697_100052928
454 Ga0070686_100339619
455 Ga0070695_100252618
456 Ga0070693_100023151
457 Ga0070665_100181389
458 Ga0070704_100309689
459 Ga0068856_100000869
460 Ga0068856_100068513
461 Ga0070702_100336115
462 Ga0081455_10011273
463 Ga0070717_10008801
464 Ga0070717_10120301
465 Ga0070717_10304360
466 Ga0070717_10617645
467 Ga0070715_10143899
468 Ga0070716_100346441
469 Ga0070712_100167263
470 Ga0097621_100047203
471 Ga0068871_100184743
472 Ga0075430_100492944
473 Ga0068865_100273544
474 Ga0105240_10132913
475 Ga0105245_10083996
476 Ga0105245_10260596
477 Ga0114129_10029880
478 Ga0105241_10021681
479 Ga0105241_10079654
480 Ga0105242_10219704
481 Ga0105249_10173779
482 Ga0105239_10122631
483 Ga0157374_10138300
484 Ga0163162_10160611
485 Ga0157372_10612322
486 Ga0157372_10953203
487 Ga0157375_10013678
488 Ga0157375_10967664
489 Ga0157375_11490592
490 Ga0182008_10003096
491 Ga0182008_10101627
492 Ga0182008_10373634
493 Ga0157377_10078366
494 Ga0157376_10152283
495 Ga0206354_10631243
496 Ga0206353_10320973
497 Ga0207692_10017874
498 Ga0207692_10153343
499 Ga0207705_10147767
500 Ga0207654_10039100
501 Ga0207707_10028642
502 Ga0207707_10293814
503 Ga0207707_10378253
504 Ga0207695_10175433
505 Ga0207693_10040821
506 Ga0207693_10062329
507 Ga0207663_10001587
508 Ga0207660_10033163
509 Ga0207657_10036284
510 Ga0207657_10052709
511 Ga0207652_10001084
512 Ga0207652_10014130
513 Ga0207652_10315234
514 Ga0207646_10002340
515 Ga0207646_10067034
516 Ga0207687_10084727
517 Ga0207700_10301763
518 Ga0207664_10010035
519 Ga0207664_10125358
520 Ga0207664_10182923
521 Ga0207664_10191217
522 Ga0207664_10223823
523 Ga0207664_10287462
524 Ga0207664_10522395
525 Ga0207644_10269899
526 Ga0207665_10001535
527 Ga0207665_10151508
528 Ga0207711_10276499
529 Ga0207711_10466001
530 Ga0207661_10000505
531 Ga0207679_10277316
532 Ga0207658_10003173
533 Ga0207677_10704868
534 Ga0207678_10019356
535 Ga0207678_10164401
536 Ga0207702_10017127
537 Ga0207702_10022492
538 Ga0207683_10002241
539 Ga0207683_10181305
540 Ga0268266_10148695
541 Ga0265334_10055345
542 Ga0265336_10003217
543 Ga0265336_10029266
544 Ga0265338_10014111
545 Ga0265338_10102552
546 Ga0265338_10144259
547 Ga0265338_10368912
548 Ga0265324_10013087
549 Ga0265332_10033198
550 Ga0265320_10086164
551 Ga0265340_10032451
552 Ga0265339_10026757
553 Ga0265327_10046501
554 Ga0265316_10531520
555 Ga0265313_10010288
556 Ga0265313_10024397
557 Ga0265314_10021043
558 Ga0265314_10308112
559 Ga0265342_10044741
560 Ga0307409_100393178
561 Ga0307416_100202760
562 Ga0373934_0078459
563 Ga0373934_0112450
564 Ga0373943_0088108
565 Ga0373955_0165873
566 Ga0373927_0000162
567 Ga0373933_0331476
568 Ga0373933_0497039
569 Ga0373947_0007064
570 Ga0373937_0000107
571 Ga0373937_0258813
572 Ga0395899_0001956
573 Ga0395899_0050779
574 Ga0395899_0116840
575 Ga0395900_0004915
576 Ga0395900_0009898
577 Ga0395900_0037133
578 Ga0395900_0038352
579 Ga0395900_0588161
580 Ga0395900_0678478
581 Ga0395898_0001911
582 Ga0395898_0011017
583 Ga0395898_0101940
584 Ga0395898_0163450
585 Ga0395898_0321250
586 Ga0395898_0469944
587 Ga0395905_0004683
588 Ga0395905_0084521
589 Ga0395905_0164966
590 Ga0395905_0264443
591 Ga0395905_0441252
592 Ga0395905_0518536
593 Ga0395901_0003696
594 Ga0395901_0007126
595 Ga0395901_0012235
596 Ga0395901_0061283
597 Ga0395901_0077751
598 Ga0395901_0090751
599 Ga0395901_0117324
600 Ga0395901_0225481
601 Ga0395901_0569761
602 Ga0436362_0753487
603 Ga0466963_0120430
604 Ga0466957_0040283
605 Ga0466967_0030040
606 Ga0466967_0034362
607 Ga0466967_0919876
608 Ga0495592_0000089
609 Ga0495592_0019587
610 Ga0495592_0034689
611 Ga0495603_0011712
612 Ga0495603_0470537
613 Ga0495629_0083520
614 Ga0495629_0285400
615 Ga0495629_0376998
616 Ga0495641_0082751
617 Ga0495641_0128255
618 Ga0495651_0000057
619 Ga0495651_0007223
620 Ga0495651_0430345
621 Ga0495651_0440817
622 Ga0495653_0001230
623 Ga0495653_0015247
624 Ga0495653_0028034
625 Ga0495653_0192738
626 Ga0495653_0497622
627 Ga0495580_0420157
628 Ga0495582_0030432
629 Ga0495582_0274410
630 Ga0495664_0101921
631 Ga0495664_0263382
632 Ga0495608_0011459
633 Ga0495608_0052409
634 Ga0495608_0146044
635 Ga0495608_0216987
636 Ga0495608_0284688
637 Ga0495618_0000704
638 Ga0495628_0000066
639 Ga0495628_0009381
640 Ga0495628_0084449
641 Ga0495628_0728840
642 Ga0495630_0025943
643 Ga0495630_0040249
644 Ga0495644_0075942
645 Ga0495666_0104914
646 Ga0495642_0138491
647 Ga0495652_0000118
648 Ga0495652_0096747
649 Ga0495652_0097259
650 Ga0495652_0115730
651 Ga0495652_0282395
652 Ga0495640_0052370
653 Ga0495640_0087328
654 Ga0495640_0272990
655 Ga0495640_0340554
656 Ga0495586_0010903
657 Ga0495586_0293819
658 Ga0495587_0000096
659 Ga0495587_0022877
660 Ga0495587_0041657
661 Ga0495587_0190015
662 Ga0495645_0000052
663 Ga0495645_0029216
664 Ga0495645_0229665
665 Ga0495645_0301440
666 Ga0495667_0116958
667 Ga0495667_0155260
668 Ga0495667_0206694
669 Ga0495656_0068484
670 Ga0495634_0058066
671 Ga0495634_0087826
672 Ga0495611_0053343
673 Ga0495635_0005732
674 Ga0495635_0031300
675 Ga0495635_0371865
676 Ga0495659_0092215
677 Ga0495657_0002379
678 Ga0495657_0022527
679 Ga0495657_0044386
680 Ga0495657_0128765
681 Ga0495599_0000046
682 Ga0495599_0004409
683 Ga0495599_0267758
684 Ga0495623_0000061
685 Ga0495646_0001530
686 Ga0495647_0198976
687 Ga0495658_0003986
688 Ga0495658_0161822
689 Ga0495613_0044389
690 Ga0495613_0113665
691 Ga0495670_0052517
692 Ga0495589_0123167
693 Ga0495600_0003166
694 Ga0495600_0225505
695 Ga0495600_0299302
696 Ga0495581_0111775
697 Ga0495604_0000075
698 Ga0495604_0169300
699 Ga0495674_0009852
700 Ga0495674_0020877
701 Ga0495674_0204181
702 Ga0495674_0341078
703 Ga0495674_0431017
704 Ga0495676_0031426
705 Ga0495676_0284089
706 Ga0495676_0382668
707 Ga0495680_0001666
708 Ga0495680_0002544
709 Ga0495680_0005828
710 Ga0495680_0589176
711 Ga0495675_0000089
712 Ga0495675_0158229
713 Ga0495679_054564
714 Ga0495684_0002756
715 Ga0495684_0005868
716 Ga0495684_0035005
717 Ga0495684_0217731
718 Ga0495684_0219910
719 Ga0495602_0000140
720 Ga0495602_0050026
721 Ga0495602_0074089
722 Ga0495602_0192009
723 Ga0496100_0007564
724 Ga0496100_0032173
725 Ga0496100_0168653
726 Ga0496100_0329836
727 Ga0496100_0459204
728 Ga0496101_0003576
729 Ga0496101_0016550
730 Ga0496101_0017758
731 Ga0496101_0019711
732 Ga0496101_0040080
733 Ga0496101_0056717
734 Ga0496101_0081973
735 Ga0496101_0175433
736 Ga0496102_0001239
737 Ga0496102_0289426
738 Ga0496102_0436881
739 Ga0496102_0681409
740 Ga0496103_0001010
741 Ga0496104_0000722
742 Ga0496104_0002242
743 Ga0496104_0007226
744 Ga0496104_0020574
745 Ga0496104_0150689
746 Ga0496104_0189360
747 Ga0496104_0328864
748 Ga0496104_0474590
749 Ga0496105_0000228
750 Ga0496105_0000741
751 Ga0496105_0015203
752 Ga0496105_0017551
753 Ga0496105_0092264
754 Ga0496106_0049502
755 Ga0496106_0196560
756 Ga0496107_0062401
757 Ga0496107_0137758
758 Ga0496107_0291248
759 Ga0496107_0318439
760 Ga0496107_0466098
761 Ga0496108_0022746
762 Ga0496108_0028607
763 Ga0496108_0029699
764 Ga0496108_0080676
765 Ga0496108_0082837
766 Ga0496108_0554548
767 Ga0496109_0000638
768 Ga0496109_0001541
769 Ga0496109_0003779
770 Ga0496109_0005050
771 Ga0496109_0037899
772 Ga0496109_0041153
773 Ga0496109_0044361
774 Ga0496109_0274372
775 Ga0496109_0933183
776 Ga0496110_0001269
777 Ga0496110_0010416
778 Ga0496110_0052967
779 Ga0496110_0130498
780 Ga0496110_0230717
781 Ga0496111_0000025
782 Ga0496111_0002767
783 Ga0496111_0015272
784 Ga0496111_0038930
785 Ga0496111_0073182
786 Ga0496111_0613902
787 Ga0496112_0056106
788 Ga0496112_0415792
789 Ga0496112_0720587
790 Ga0496112_0937262
791 Ga0496113_0095449
792 Ga0496113_0119694
793 Ga0496113_0152796
794 Ga0496114_0000264
795 Ga0496114_0008049
796 Ga0496114_0033307
797 Ga0496114_0061195
798 Ga0496114_0062635
799 Ga0496114_0115215
800 Ga0496114_0152019
801 Ga0496114_1226893
802 Ga0496115_0028138
803 Ga0496115_0048662
804 Ga0496115_0157207
805 Ga0501038_0380881
806 Ga0501047_0081965
807 Ga0501067_0066910
808 Ga0501069_0261932
809 Ga0501070_0052124
810 Ga0501070_0633410
811 Ga0501070_0836302
812 Ga0501074_0105878
813 Ga0501080_0132942
814 Ga0501080_0515798
815 nmdc:mga05p37_28004_c1
816 nmdc:mga0qj67_427343_c1
817 nmdc:mga06r32_204657_c1
818 Ga0495601_0000273
819 Ga0495601_0003869
820 Ga0495601_0050767
821 Ga0495601_0051893
822 Ga0495601_0088191
823 Ga0495601_0101631
824 Ga0495601_0123782
825 Ga0495612_0019083
826 Ga0495612_0031257
827 Ga0495612_0191568
828 Ga0495595_0004122
829 Ga0495595_0005879
830 Ga0495595_0016435
831 Ga0495619_0000618
832 Ga0495619_0021261
833 Ga0495619_0027689
834 Ga0495619_0331230

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

85

186

0.95

PF00230

MIP

Major intrinsic protein

1

91

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9652 3 213
3ne2-assembly1.cif.gz_D archaeoglobus fulgidus aquaporin 0.9517 1 212
7nl4-assembly1.cif.gz_B osnip2;1 silicon transporter from rice 0.9509 3 213
7cjs-assembly2.cif.gz_E structure of aquaporin 0.9477 3 213
2d57-assembly1.cif.gz_A double layered 2d crystal structure of aquaporin-4 (aqp4m23) at 3.2 a resolution by electron crystallography 0.9448 2 212
ID Description Score Start End Superfamily
af_K7KZ85_1_217_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9745 19 212 1.20.1080.10
af_Q5Z9E2_22_272_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.974 1 213 1.20.1080.10
af_I1NH56_66_171_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9719 3 101 1.20.1080.10
af_Q9SAI4_73_301_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.967 3 220 1.20.1080.10
af_K7KZB2_21_183_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9654 62 217 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A836DH94-F1-model_v4 deleted 0.9869 3 208
AF-A0A0F9S1I0-F1-model_v4 Aquaporin 0.9847 3 213 GO:0015267
GO:0016020
AF-A0A6J6Q6W8-F1-model_v4 Unannotated protein 0.9845 3 213 GO:0015267
GO:0016020
AF-A0A6N8YXK0-F1-model_v4 Aquaporin 0.9831 12 215 GO:0015267
GO:0016020
AF-A0A7M2Z2B4-F1-model_v4 MIP: MIP family channel protein 0.9829 3 213 GO:0015267
GO:0016020

Map