F439145

General Info

Members Datasets Scaffolds Average Seq Length
417 254 830 109

Family's Representative Sequence

Representative Sequence 3300047321|Ga0495676_0069290|Ga0495676_0069290_1721_2074
Length 117
Sequence MTAKLDYRWHLRRVMADRGMFSTTDLIPPLAERGITLSTSQVYRLVVERPERLSLKILMALLDILDCRMDDLVEPIASATAVKRPKKAAAAGTAPPAADGLGDLRPKRARIRGVDLP

Samples

Sample ID Description Type Environment
1 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028019 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU1 Metagenome Unclassified
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
111 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
112 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
144 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
153 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
154 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
163 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
220 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
221 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
224 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
236 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
239 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
240 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
243 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
244 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
245 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
246 2643221647 Streptomyces sp. Root369 Isolate Unclassified
247 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
248 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
249 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
250 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
251 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
252 2867369537 Streptomyces sp. Z26 Isolate Unclassified
253 2867475112 Streptomyces sp. TM32 Isolate Unclassified
254 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.4
Metatranscriptomes 0.48
Isolates 3.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.44
Nodule 0
Rhizoplane 6.71
Rhizosphere 83.69
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495676_0069290 3300047321 Bacteria 2722
2 rootH1_10003491 3300003316 Bacteria 18956
3 rootH2_10057583 3300003320 Bacteria 6322
4 rootL2_10033632 3300003322 Bacteria 9817
5 rootL2_10082242 3300003322 Bacteria 5914
6 rootH1_10099985 3300003323 Bacteria 4973
7 Ga0070658_10560169 3300005327 Bacteria 989
8 Ga0070683_100319776 3300005329 Bacteria 1477
9 Ga0070670_100167904 3300005331 Bacteria 1903
10 Ga0068869_100850204 3300005334 Bacteria 787
11 Ga0070680_100612955 3300005336 Bacteria 934
12 Ga0070682_100057088 3300005337 Bacteria 2458
13 Ga0070682_102065502 3300005337 Bacteria 502
14 Ga0070661_100101719 3300005344 Bacteria 2138
15 Ga0070668_100002223 3300005347 Bacteria 14256
16 Ga0070688_100445697 3300005365 Bacteria 967
17 Ga0070688_101093134 3300005365 Bacteria 637
18 Ga0070659_100153423 3300005366 Bacteria 1880
19 Ga0070667_100982545 3300005367 Bacteria 787
20 Ga0070709_10479648 3300005434 Bacteria 941
21 Ga0070714_100006584 3300005435 Bacteria 8988
22 Ga0070714_100056540 3300005435 Bacteria 3356
23 Ga0070714_100098426 3300005435 Bacteria 2573
24 Ga0070711_100341960 3300005439 Bacteria 1201
25 Ga0070711_100604445 3300005439 Bacteria 915
26 Ga0070700_102015921 3300005441 Bacteria 501
27 Ga0070708_100012560 3300005445 Bacteria 6913
28 Ga0070708_100034766 3300005445 Bacteria 4386
29 Ga0070708_100044723 3300005445 Bacteria 3895
30 Ga0070708_100273634 3300005445 Bacteria 1589
31 Ga0070708_101458483 3300005445 Bacteria 638
32 Ga0070663_100028522 3300005455 Bacteria 3801
33 Ga0070663_100063422 3300005455 Bacteria 2668
34 Ga0070678_100118314 3300005456 Bacteria 2085
35 Ga0070685_10368751 3300005466 Bacteria 986
36 Ga0070706_100002787 3300005467 Bacteria 17471
37 Ga0070706_100006477 3300005467 Bacteria 11052
38 Ga0070706_100006746 3300005467 Bacteria 10837
39 Ga0070706_100041495 3300005467 Bacteria 4248
40 Ga0070706_100044322 3300005467 Bacteria 4109
41 Ga0070706_100055225 3300005467 Bacteria 3666
42 Ga0070706_100064656 3300005467 Bacteria 3382
43 Ga0070706_100073018 3300005467 Bacteria 3175
44 Ga0070706_100102415 3300005467 Bacteria 2662
45 Ga0070706_100124795 3300005467 Bacteria 2400
46 Ga0070706_100125124 3300005467 Bacteria 2397
47 Ga0070707_100017329 3300005468 Bacteria 6772
48 Ga0070707_100018682 3300005468 Bacteria 6524
49 Ga0070707_100018972 3300005468 Bacteria 6478
50 Ga0070707_100022838 3300005468 Bacteria 5915
51 Ga0070707_100046574 3300005468 Bacteria 4150
52 Ga0070707_100047537 3300005468 Bacteria 4108
53 Ga0070707_100078223 3300005468 Bacteria 3191
54 Ga0070707_100199227 3300005468 Bacteria 1952
55 Ga0070707_100273265 3300005468 Bacteria 1643
56 Ga0070698_100000045 3300005471 Bacteria 87520
57 Ga0070698_100025266 3300005471 Bacteria 6189
58 Ga0070698_100037999 3300005471 Bacteria 4962
59 Ga0070698_100040503 3300005471 Bacteria 4787
60 Ga0070698_100047312 3300005471 Bacteria 4397
61 Ga0070698_100052524 3300005471 Bacteria 4146
62 Ga0070698_100056837 3300005471 Bacteria 3962
63 Ga0070698_100072993 3300005471 Bacteria 3439
64 Ga0070698_100081273 3300005471 Bacteria 3235
65 Ga0070698_100104974 3300005471 Bacteria 2795
66 Ga0070698_100736277 3300005471 Bacteria 929
67 Ga0070698_101806899 3300005471 Unclassified 564
68 Ga0070698_102008030 3300005471 Bacteria 532
69 Ga0070699_100025079 3300005518 Bacteria 5141
70 Ga0070699_100040448 3300005518 Bacteria 4037
71 Ga0070699_100047113 3300005518 Bacteria 3730
72 Ga0070699_100082486 3300005518 Bacteria 2803
73 Ga0070699_100717411 3300005518 Bacteria 914
74 Ga0070679_100076526 3300005530 Bacteria 3336
75 Ga0070684_100602729 3300005535 Bacteria 1021
76 Ga0070684_100898620 3300005535 Unclassified 830
77 Ga0070697_100004374 3300005536 Bacteria 10843
78 Ga0070664_100509917 3300005564 Bacteria 1109
79 Ga0068857_100675241 3300005577 Bacteria 980
80 Ga0068852_100864713 3300005616 Bacteria 920
81 Ga0068852_101146630 3300005616 Bacteria 798
82 Ga0068859_100691655 3300005617 Bacteria 1111
83 Ga0068864_100057310 3300005618 Bacteria 3366
84 Ga0068858_100584402 3300005842 Bacteria 1083
85 Ga0068858_101892817 3300005842 Bacteria 589
86 Ga0068862_100221721 3300005844 Bacteria 1712
87 Ga0081540_1000623 3300005983 Bacteria 33684
88 Ga0070717_10022279 3300006028 Bacteria 5004
89 Ga0070717_10039983 3300006028 Bacteria 3818
90 Ga0070717_10086525 3300006028 Bacteria 2638
91 Ga0070717_10151359 3300006028 Bacteria 2007
92 Ga0070717_10307853 3300006028 Bacteria 1409
93 Ga0070717_10869851 3300006028 Bacteria 820
94 Ga0070717_10907003 3300006028 Bacteria 802
95 Ga0070717_11531635 3300006028 Bacteria 605
96 Ga0070716_100756383 3300006173 Bacteria 748
97 Ga0070712_100081106 3300006175 Bacteria 2350
98 Ga0068871_100396160 3300006358 Bacteria 1229
99 Ga0075428_100048234 3300006844 Bacteria 4675
100 Ga0075428_100522741 3300006844 Bacteria 1269
101 Ga0075430_100414312 3300006846 Bacteria 1112
102 Ga0075431_100055885 3300006847 Bacteria 4072
103 Ga0075434_100714542 3300006871 Bacteria 1019
104 Ga0075434_101857508 3300006871 Bacteria 609
105 Ga0075429_100030216 3300006880 Bacteria 4707
106 Ga0075436_100032146 3300006914 Bacteria 3616
107 Ga0097620_100691638 3300006931 Bacteria 1111
108 Ga0075435_100105843 3300007076 Bacteria 2335
109 Ga0075435_100261694 3300007076 Bacteria 1474
110 Ga0099794_10500954 3300007265 Bacteria 639
111 Ga0111539_10053202 3300009094 Bacteria 4819
112 Ga0105245_10651884 3300009098 Bacteria 1083
113 Ga0105245_12946357 3300009098 Bacteria 528
114 Ga0114129_10034044 3300009147 Bacteria 7196
115 Ga0114129_11015261 3300009147 Bacteria 1044
116 Ga0105243_11178283 3300009148 Bacteria 778
117 Ga0105243_11745119 3300009148 Bacteria 652
118 Ga0105242_11277345 3300009176 Bacteria 757
119 Ga0105238_11561501 3300009551 Bacteria 689
120 Ga0099796_10234983 3300010159 Bacteria 756
121 Ga0105246_10123112 3300011119 Bacteria 1925
122 Ga0157370_11300039 3300013104 Bacteria 655
123 Ga0157369_10233362 3300013105 Unclassified 1923
124 Ga0157369_10269086 3300013105 Bacteria 1776
125 Ga0157369_10308623 3300013105 Bacteria 1645
126 Ga0157369_11129242 3300013105 Bacteria 801
127 Ga0157369_12533557 3300013105 Bacteria 519
128 Ga0157374_10321271 3300013296 Bacteria 1534
129 Ga0157378_12742366 3300013297 Bacteria 545
130 Ga0163162_11981499 3300013306 Bacteria 667
131 Ga0157372_11304613 3300013307 Bacteria 838
132 Ga0157372_11978075 3300013307 Bacteria 670
133 Ga0157375_10258843 3300013308 Bacteria 1902
134 Ga0157375_10406834 3300013308 Bacteria 1527
135 Ga0157375_11465495 3300013308 Bacteria 805
136 Ga0163163_10037581 3300014325 Bacteria 4711
137 Ga0182008_10438229 3300014497 Bacteria 708
138 Ga0157377_10042749 3300014745 Bacteria 2518
139 Ga0157379_11514630 3300014968 Bacteria 653
140 Ga0157376_12622160 3300014969 Bacteria 544
141 Ga0206353_10377128 3300020082 Unclassified 753
142 Ga0213875_10063217 3300021388 Bacteria 1731
143 Ga0228600_1002074 3300024123 Bacteria 1521
144 Ga0207688_10044429 3300025901 Bacteria 2476
145 Ga0207688_10212403 3300025901 Bacteria 1163
146 Ga0207647_10172334 3300025904 Bacteria 1260
147 Ga0207643_10207649 3300025908 Bacteria 1194
148 Ga0207705_10400180 3300025909 Bacteria 1062
149 Ga0207684_10001090 3300025910 Bacteria 30453
150 Ga0207684_10006941 3300025910 Bacteria 10245
151 Ga0207684_10008907 3300025910 Bacteria 8908
152 Ga0207684_10019491 3300025910 Bacteria 5801
153 Ga0207684_10046717 3300025910 Bacteria 3673
154 Ga0207684_10057560 3300025910 Bacteria 3299
155 Ga0207684_10082687 3300025910 Bacteria 2735
156 Ga0207684_10086065 3300025910 Bacteria 2677
157 Ga0207707_10756766 3300025912 Bacteria 812
158 Ga0207660_10555712 3300025917 Bacteria 934
159 Ga0207652_10462923 3300025921 Bacteria 1143
160 Ga0207646_10020724 3300025922 Bacteria 6087
161 Ga0207646_10022221 3300025922 Bacteria 5848
162 Ga0207646_10024539 3300025922 Bacteria 5524
163 Ga0207646_10034830 3300025922 Bacteria 4551
164 Ga0207646_10041244 3300025922 Bacteria 4150
165 Ga0207646_10042014 3300025922 Bacteria 4108
166 Ga0207646_10119107 3300025922 Bacteria 2371
167 Ga0207646_10181366 3300025922 Bacteria 1902
168 Ga0207646_10295462 3300025922 Bacteria 1464
169 Ga0207694_11051557 3300025924 Bacteria 689
170 Ga0207650_10262510 3300025925 Bacteria 1401
171 Ga0207687_10043341 3300025927 Bacteria 3100
172 Ga0207687_10725414 3300025927 Bacteria 845
173 Ga0207664_10059074 3300025929 Bacteria 3053
174 Ga0207664_10086458 3300025929 Bacteria 2561
175 Ga0207664_10114765 3300025929 Bacteria 2245
176 Ga0207709_10206046 3300025935 Bacteria 1408
177 Ga0207665_10833228 3300025939 Bacteria 730
178 Ga0207661_10031396 3300025944 Bacteria 4103
179 Ga0207661_10226979 3300025944 Bacteria 1652
180 Ga0207661_10582609 3300025944 Bacteria 1026
181 Ga0207661_10646555 3300025944 Bacteria 972
182 Ga0207679_10613221 3300025945 Bacteria 982
183 Ga0207668_10002379 3300025972 Bacteria 10986
184 Ga0207658_11112588 3300025986 Bacteria 722
185 Ga0207678_10043041 3300026067 Bacteria 3909
186 Ga0207678_10098461 3300026067 Bacteria 2498
187 Ga0207678_10491675 3300026067 Bacteria 1069
188 Ga0207702_10782063 3300026078 Bacteria 943
189 Ga0207648_10106986 3300026089 Bacteria 2455
190 Ga0207676_10124202 3300026095 Bacteria 2182
191 Ga0207674_10383485 3300026116 Bacteria 1359
192 Ga0207675_100200877 3300026118 Bacteria 1915
193 Ga0207683_10101005 3300026121 Bacteria 2575
194 Ga0207698_10584832 3300026142 Bacteria 1099
195 Ga0207428_10047623 3300027907 Bacteria 3442
196 Ga0224573_1000419 3300028019 Bacteria 5350
197 Ga0268265_10687236 3300028380 Bacteria 987
198 Ga0265337_1110020 3300028556 Bacteria 748
199 Ga0307511_10007297 3300030521 Bacteria 11135
200 Ga0265760_10200484 3300031090 Bacteria 674
201 Ga0265340_10013769 3300031247 Bacteria 4241
202 Ga0265340_10037084 3300031247 Bacteria 2415
203 Ga0307509_10004838 3300031507 Bacteria 19135
204 Ga0307509_10022878 3300031507 Bacteria 7030
205 Ga0307509_10026918 3300031507 Bacteria 6406
206 Ga0307508_10001984 3300031616 Bacteria 22367
207 Ga0307516_10113391 3300031730 Bacteria 2509
208 Ga0307516_10157453 3300031730 Bacteria 2025
209 Ga0307410_10005556 3300031852 Bacteria 6689
210 Ga0307407_10181311 3300031903 Bacteria 1396
211 Ga0307412_10119625 3300031911 Bacteria 1894
212 Ga0307414_10233755 3300032004 Bacteria 1517
213 Ga0307411_10007187 3300032005 Bacteria 5646
214 Ga0307507_10037135 3300033179 Bacteria 4963
215 Ga0316214_1068813 3300033545 Bacteria 521
216 Ga0373959_0066223 3300034820 Bacteria 808
217 Ga0373959_0095268 3300034820 Bacteria 702
218 Ga0373926_0019021 3300035083 Bacteria 2366
219 Ga0373934_0063860 3300035086 Bacteria 1469
220 Ga0373934_0095440 3300035086 Bacteria 1201
221 Ga0373923_0051802 3300035111 Bacteria 1723
222 Ga0373936_0061986 3300035113 Bacteria 1528
223 Ga0373941_0264457 3300035115 Bacteria 676
224 Ga0373945_0006181 3300035116 Bacteria 3852
225 Ga0373957_0431049 3300035120 Bacteria 569
226 Ga0373943_0006982 3300035170 Bacteria 5065
227 Ga0373943_0863889 3300035170 Bacteria 540
228 Ga0373946_0050520 3300035171 Bacteria 1737
229 Ga0373946_0663488 3300035171 Bacteria 544
230 Ga0373955_0398687 3300035172 Bacteria 836
231 Ga0373931_0056256 3300035691 Bacteria 2107
232 Ga0373935_0013401 3300035692 Bacteria 4946
233 Ga0373927_0014849 3300035695 Bacteria 5151
234 Ga0373927_0748058 3300035695 Bacteria 646
235 Ga0373933_0010182 3300035724 Bacteria 5150
236 Ga0373933_0344252 3300035724 Bacteria 968
237 Ga0373947_0012774 3300035725 Bacteria 4812
238 Ga0373937_0041543 3300036401 Bacteria 4194
239 Ga0373937_0484107 3300036401 Bacteria 1175
240 Ga0373937_0517980 3300036401 Bacteria 1133
241 Ga0373937_0621658 3300036401 Bacteria 1025
242 Ga0373925_0019496 3300037068 Bacteria 4934
243 Ga0436364_0136580 3300037853 Bacteria 659
244 Ga0436364_0742626 3300037853 Bacteria 3610
245 Ga0436365_0558696 3300039437 Bacteria 1009
246 Ga0436365_1568420 3300039437 Bacteria 3467
247 Ga0436361_0720606 3300039447 Bacteria 571
248 Ga0436363_0163367 3300039450 Bacteria 4147
249 Ga0436363_0876867 3300039450 Bacteria 1481
250 Ga0436362_0414415 3300039453 Bacteria 1060
251 Ga0451847_0248573 3300041503 Bacteria 548
252 Ga0451849_0660103 3300041505 Bacteria 1163
253 Ga0451853_0165080 3300041512 Bacteria 914
254 Ga0451853_2675460 3300041512 Bacteria 961
255 Ga0439450_146724 3300042008 Bacteria 617
256 Ga0466960_0051237 3300044901 Bacteria 1993
257 Ga0495617_054464 3300046452 Bacteria 1328
258 Ga0495592_0020696 3300046454 Bacteria 5005
259 Ga0495592_0360308 3300046454 Bacteria 930
260 Ga0495592_0760563 3300046454 Bacteria 578
261 Ga0495603_0026721 3300046455 Bacteria 3486
262 Ga0495590_0158930 3300046457 Bacteria 821
263 Ga0495629_0081386 3300046459 Bacteria 2260
264 Ga0495641_0027008 3300046461 Bacteria 2796
265 Ga0495641_0489840 3300046461 Bacteria 560
266 Ga0495641_0535156 3300046461 Bacteria 535
267 Ga0495651_0019251 3300046462 Bacteria 5290
268 Ga0495651_0141056 3300046462 Bacteria 1747
269 Ga0495653_0004065 3300046463 Bacteria 11823
270 Ga0495582_0038270 3300046473 Bacteria 2639
271 Ga0495582_0157403 3300046473 Bacteria 1291
272 Ga0495639_0013734 3300046475 Bacteria 3502
273 Ga0495662_0063684 3300046476 Bacteria 1781
274 Ga0495662_0246143 3300046476 Bacteria 881
275 Ga0495662_0458360 3300046476 Bacteria 625
276 Ga0495664_0016629 3300046477 Bacteria 4193
277 Ga0495664_0086781 3300046477 Bacteria 1880
278 Ga0495664_0402728 3300046477 Bacteria 822
279 Ga0495585_0170619 3300046492 Bacteria 1124
280 Ga0495608_0017725 3300046511 Bacteria 4923
281 Ga0495618_0013232 3300046514 Bacteria 5020
282 Ga0495618_0536780 3300046514 Bacteria 702
283 Ga0495618_0630358 3300046514 Bacteria 636
284 Ga0495620_0152324 3300046515 Bacteria 901
285 Ga0495628_0019924 3300046516 Bacteria 5542
286 Ga0495628_0373139 3300046516 Bacteria 1046
287 Ga0495630_0016599 3300046517 Bacteria 5385
288 Ga0495630_1063096 3300046517 Bacteria 614
289 Ga0495652_0018936 3300046529 Bacteria 6135
290 Ga0495652_0038210 3300046529 Bacteria 4160
291 Ga0495652_0449731 3300046529 Bacteria 902
292 Ga0495665_0011138 3300046531 Bacteria 4867
293 Ga0495665_0248831 3300046531 Bacteria 915
294 Ga0495640_0020157 3300046533 Bacteria 4912
295 Ga0495586_0062458 3300046535 Bacteria 2028
296 Ga0495587_0275207 3300046536 Bacteria 944
297 Ga0495598_0124828 3300046537 Bacteria 876
298 Ga0495645_0019674 3300046543 Bacteria 4863
299 Ga0495667_0017530 3300046559 Bacteria 4836
300 Ga0495656_0094326 3300046615 Bacteria 1374
301 Ga0495634_0022863 3300046642 Bacteria 4402
302 Ga0495611_0024942 3300046648 Bacteria 2603
303 Ga0495611_0129780 3300046648 Bacteria 1176
304 Ga0495625_0469959 3300046660 Bacteria 774
305 Ga0495625_0871531 3300046660 Bacteria 518
306 Ga0495635_0018773 3300046663 Bacteria 4824
307 Ga0495635_0074240 3300046663 Bacteria 2330
308 Ga0495588_0240617 3300046674 Bacteria 955
309 Ga0495657_0019613 3300046675 Bacteria 4876
310 Ga0495599_0015269 3300046678 Bacteria 4763
311 Ga0495599_0120954 3300046678 Bacteria 1628
312 Ga0495646_0015707 3300046680 Bacteria 4805
313 Ga0495658_0120925 3300046683 Bacteria 1584
314 Ga0495613_0137641 3300046689 Bacteria 1746
315 Ga0495613_0534334 3300046689 Bacteria 786
316 Ga0495624_0017947 3300046690 Bacteria 4741
317 Ga0495624_0249842 3300046690 Bacteria 1073
318 Ga0495670_0798311 3300046691 Unclassified 515
319 Ga0495589_0341893 3300046794 Bacteria 690
320 Ga0495600_0015447 3300046809 Bacteria 4825
321 Ga0495660_0072586 3300046810 Bacteria 1822
322 Ga0495581_0012895 3300047315 Bacteria 4843
323 Ga0495581_0160159 3300047315 Bacteria 1316
324 Ga0495581_0203818 3300047315 Bacteria 1157
325 Ga0495604_0082272 3300047317 Bacteria 2408
326 Ga0495604_0108414 3300047317 Bacteria 2029
327 Ga0495674_0031658 3300047319 Bacteria 4803
328 Ga0495674_0062131 3300047319 Bacteria 3253
329 Ga0495674_0329324 3300047319 Bacteria 1243
330 Ga0495676_0037677 3300047321 Bacteria 4022
331 Ga0495676_0094179 3300047321 Bacteria 2232
332 Ga0495676_0644843 3300047321 Bacteria 687
333 Ga0495680_0024552 3300047322 Bacteria 4999
334 Ga0495680_0199287 3300047322 Bacteria 1437
335 Ga0495683_0013022 3300047323 Bacteria 4355
336 Ga0495683_0431673 3300047323 Bacteria 543
337 Ga0495687_033721 3300047443 Bacteria 2319
338 Ga0495687_073644 3300047443 Bacteria 1361
339 Ga0495675_0487962 3300047444 Bacteria 709
340 Ga0495685_021588 3300047447 Bacteria 2215
341 Ga0495684_0021861 3300047471 Bacteria 4924
342 Ga0495593_0012238 3300047673 Bacteria 4904
343 Ga0495593_0150119 3300047673 Bacteria 1179
344 Ga0495602_0045675 3300048088 Bacteria 3962
345 Ga0495602_0593379 3300048088 Bacteria 763
346 Ga0495614_0039707 3300048089 Bacteria 2020
347 Ga0496100_0044653 3300048903 Bacteria 2840
348 Ga0496100_0163925 3300048903 Bacteria 1595
349 Ga0496100_0260576 3300048903 Bacteria 1286
350 Ga0496101_0066193 3300048904 Bacteria 2635
351 Ga0496101_0484078 3300048904 Bacteria 977
352 Ga0496101_0833141 3300048904 Bacteria 727
353 Ga0496102_0157758 3300048905 Bacteria 2133
354 Ga0496102_0220810 3300048905 Bacteria 1786
355 Ga0496102_0866588 3300048905 Bacteria 825
356 Ga0496103_0015974 3300048906 Bacteria 4477
357 Ga0496104_0123676 3300048907 Bacteria 2483
358 Ga0496105_0107535 3300048908 Bacteria 2302
359 Ga0496106_0385875 3300048909 Bacteria 1126
360 Ga0496107_0216475 3300048910 Bacteria 1424
361 Ga0496108_0054658 3300048911 Bacteria 3350
362 Ga0496108_0362263 3300048911 Bacteria 1266
363 Ga0496109_0188149 3300048912 Bacteria 1939
364 Ga0496109_0407786 3300048912 Bacteria 1284
365 Ga0496110_0009899 3300048913 Bacteria 7729
366 Ga0496111_0037308 3300048914 Bacteria 3477
367 Ga0496112_0032908 3300048915 Bacteria 5035
368 Ga0496113_0023840 3300048916 Bacteria 4343
369 Ga0496114_0032436 3300048917 Bacteria 4299
370 Ga0496114_0097595 3300048917 Bacteria 2503
371 Ga0496114_0152897 3300048917 Bacteria 2002
372 Ga0496114_0158190 3300048917 Bacteria 1968
373 Ga0496115_0027513 3300048918 Bacteria 4448
374 Ga0496115_1079961 3300048918 Bacteria 609
375 Ga0496124_0093886 3300048927 Bacteria 2441
376 Ga0501290_045438 3300049513 Bacteria 670
377 Ga0501299_113060 3300049522 Bacteria 645
378 Ga0501303_039114 3300049526 Bacteria 586
379 Ga0501047_1011548 3300049581 Bacteria 644
380 Ga0501261_014073 3300049690 Bacteria 1091
381 Ga0501268_024107 3300049765 Bacteria 1061
382 Ga0501044_1089785 3300049823 Bacteria 668
383 Ga0501045_0046401 3300049824 Bacteria 3164
384 nmdc:mga05p37_11096_c1 3300050507 Bacteria 10706
385 nmdc:mga09592_82576_c1 3300050508 Plasmid 2738
386 nmdc:mga0qj67_44097_c1 3300050509 Bacteria 3513
387 nmdc:mga06r32_48212_c1 3300050510 Bacteria 4072
388 nmdc:mga08y16_52432_c1 3300050511 Bacteria 4268
389 nmdc:mga0n895_938248_c1 3300050512 Bacteria 849
390 nmdc:mga0rr50_236178_c1 3300050513 Bacteria 1514
391 nmdc:mga0rr50_36879_c1 3300050513 Bacteria 3524
392 nmdc:mga08x19_24516_c1 3300050514 Bacteria 3750
393 Ga0495601_0013241 3300053077 Bacteria 4958
394 Ga0495612_0115457 3300053078 Bacteria 1152
395 Ga0495619_0040847 3300053085 Bacteria 3032
396 Ga0500646_0000155 3300053090 Bacteria 20110
397 Ga0500646_0010166 3300053090 Bacteria 2412
398 Ga0500560_009400 3300053107 Bacteria 2402
399 Ga0500573_0036766 3300053140 Bacteria 2828
400 Ga0500577_0000081 3300053142 Bacteria 22221
401 Ga0500600_0185340 3300053149 Bacteria 997
402 Ga0501084_0549691 3300054114 Bacteria 976
403 2515721964 2515154129 Bacteria 5584369
404 2585322045 2582581314 Bacteria 11452267
405 2644266117 2643221647 Bacteria 10741251
406 2776375379 2775506925 Bacteria 7237746
407 2809589815 2808606522 Bacteria 9488490
408 2855389332 2855386786 Bacteria 4752232
409 2856864131 2856858025 Bacteria 7255264
410 2863068022 2863067949 Bacteria 8541735
411 2863072027 2863067949 Bacteria 8541735
412 2863075344 2863067949 Bacteria 8541735
413 2867374072 2867369537 Bacteria 6501581
414 2867477724 2867475112 Bacteria 6909112
415 2912764797 2912757875 Bacteria 7940295
416 Ga0495676_0069290
417 rootH1_10003491
418 rootH2_10057583
419 rootL2_10033632
420 rootL2_10082242
421 rootH1_10099985
422 Ga0070658_10560169
423 Ga0070683_100319776
424 Ga0070670_100167904
425 Ga0068869_100850204
426 Ga0070680_100612955
427 Ga0070682_100057088
428 Ga0070682_102065502
429 Ga0070661_100101719
430 Ga0070668_100002223
431 Ga0070688_100445697
432 Ga0070688_101093134
433 Ga0070659_100153423
434 Ga0070667_100982545
435 Ga0070709_10479648
436 Ga0070714_100006584
437 Ga0070714_100056540
438 Ga0070714_100098426
439 Ga0070711_100341960
440 Ga0070711_100604445
441 Ga0070700_102015921
442 Ga0070708_100012560
443 Ga0070708_100034766
444 Ga0070708_100044723
445 Ga0070708_100273634
446 Ga0070708_101458483
447 Ga0070663_100028522
448 Ga0070663_100063422
449 Ga0070678_100118314
450 Ga0070685_10368751
451 Ga0070706_100002787
452 Ga0070706_100006477
453 Ga0070706_100006746
454 Ga0070706_100041495
455 Ga0070706_100044322
456 Ga0070706_100055225
457 Ga0070706_100064656
458 Ga0070706_100073018
459 Ga0070706_100102415
460 Ga0070706_100124795
461 Ga0070706_100125124
462 Ga0070707_100017329
463 Ga0070707_100018682
464 Ga0070707_100018972
465 Ga0070707_100022838
466 Ga0070707_100046574
467 Ga0070707_100047537
468 Ga0070707_100078223
469 Ga0070707_100199227
470 Ga0070707_100273265
471 Ga0070698_100000045
472 Ga0070698_100025266
473 Ga0070698_100037999
474 Ga0070698_100040503
475 Ga0070698_100047312
476 Ga0070698_100052524
477 Ga0070698_100056837
478 Ga0070698_100072993
479 Ga0070698_100081273
480 Ga0070698_100104974
481 Ga0070698_100736277
482 Ga0070698_101806899
483 Ga0070698_102008030
484 Ga0070699_100025079
485 Ga0070699_100040448
486 Ga0070699_100047113
487 Ga0070699_100082486
488 Ga0070699_100717411
489 Ga0070679_100076526
490 Ga0070684_100602729
491 Ga0070684_100898620
492 Ga0070697_100004374
493 Ga0070664_100509917
494 Ga0068857_100675241
495 Ga0068852_100864713
496 Ga0068852_101146630
497 Ga0068859_100691655
498 Ga0068864_100057310
499 Ga0068858_100584402
500 Ga0068858_101892817
501 Ga0068862_100221721
502 Ga0081540_1000623
503 Ga0070717_10022279
504 Ga0070717_10039983
505 Ga0070717_10086525
506 Ga0070717_10151359
507 Ga0070717_10307853
508 Ga0070717_10869851
509 Ga0070717_10907003
510 Ga0070717_11531635
511 Ga0070716_100756383
512 Ga0070712_100081106
513 Ga0068871_100396160
514 Ga0075428_100048234
515 Ga0075428_100522741
516 Ga0075430_100414312
517 Ga0075431_100055885
518 Ga0075434_100714542
519 Ga0075434_101857508
520 Ga0075429_100030216
521 Ga0075436_100032146
522 Ga0097620_100691638
523 Ga0075435_100105843
524 Ga0075435_100261694
525 Ga0099794_10500954
526 Ga0111539_10053202
527 Ga0105245_10651884
528 Ga0105245_12946357
529 Ga0114129_10034044
530 Ga0114129_11015261
531 Ga0105243_11178283
532 Ga0105243_11745119
533 Ga0105242_11277345
534 Ga0105238_11561501
535 Ga0099796_10234983
536 Ga0105246_10123112
537 Ga0157370_11300039
538 Ga0157369_10233362
539 Ga0157369_10269086
540 Ga0157369_10308623
541 Ga0157369_11129242
542 Ga0157369_12533557
543 Ga0157374_10321271
544 Ga0157378_12742366
545 Ga0163162_11981499
546 Ga0157372_11304613
547 Ga0157372_11978075
548 Ga0157375_10258843
549 Ga0157375_10406834
550 Ga0157375_11465495
551 Ga0163163_10037581
552 Ga0182008_10438229
553 Ga0157377_10042749
554 Ga0157379_11514630
555 Ga0157376_12622160
556 Ga0206353_10377128
557 Ga0213875_10063217
558 Ga0228600_1002074
559 Ga0207688_10044429
560 Ga0207688_10212403
561 Ga0207647_10172334
562 Ga0207643_10207649
563 Ga0207705_10400180
564 Ga0207684_10001090
565 Ga0207684_10006941
566 Ga0207684_10008907
567 Ga0207684_10019491
568 Ga0207684_10046717
569 Ga0207684_10057560
570 Ga0207684_10082687
571 Ga0207684_10086065
572 Ga0207707_10756766
573 Ga0207660_10555712
574 Ga0207652_10462923
575 Ga0207646_10020724
576 Ga0207646_10022221
577 Ga0207646_10024539
578 Ga0207646_10034830
579 Ga0207646_10041244
580 Ga0207646_10042014
581 Ga0207646_10119107
582 Ga0207646_10181366
583 Ga0207646_10295462
584 Ga0207694_11051557
585 Ga0207650_10262510
586 Ga0207687_10043341
587 Ga0207687_10725414
588 Ga0207664_10059074
589 Ga0207664_10086458
590 Ga0207664_10114765
591 Ga0207709_10206046
592 Ga0207665_10833228
593 Ga0207661_10031396
594 Ga0207661_10226979
595 Ga0207661_10582609
596 Ga0207661_10646555
597 Ga0207679_10613221
598 Ga0207668_10002379
599 Ga0207658_11112588
600 Ga0207678_10043041
601 Ga0207678_10098461
602 Ga0207678_10491675
603 Ga0207702_10782063
604 Ga0207648_10106986
605 Ga0207676_10124202
606 Ga0207674_10383485
607 Ga0207675_100200877
608 Ga0207683_10101005
609 Ga0207698_10584832
610 Ga0207428_10047623
611 Ga0224573_1000419
612 Ga0268265_10687236
613 Ga0265337_1110020
614 Ga0307511_10007297
615 Ga0265760_10200484
616 Ga0265340_10013769
617 Ga0265340_10037084
618 Ga0307509_10004838
619 Ga0307509_10022878
620 Ga0307509_10026918
621 Ga0307508_10001984
622 Ga0307516_10113391
623 Ga0307516_10157453
624 Ga0307410_10005556
625 Ga0307407_10181311
626 Ga0307412_10119625
627 Ga0307414_10233755
628 Ga0307411_10007187
629 Ga0307507_10037135
630 Ga0316214_1068813
631 Ga0373959_0066223
632 Ga0373959_0095268
633 Ga0373926_0019021
634 Ga0373934_0063860
635 Ga0373934_0095440
636 Ga0373923_0051802
637 Ga0373936_0061986
638 Ga0373941_0264457
639 Ga0373945_0006181
640 Ga0373957_0431049
641 Ga0373943_0006982
642 Ga0373943_0863889
643 Ga0373946_0050520
644 Ga0373946_0663488
645 Ga0373955_0398687
646 Ga0373931_0056256
647 Ga0373935_0013401
648 Ga0373927_0014849
649 Ga0373927_0748058
650 Ga0373933_0010182
651 Ga0373933_0344252
652 Ga0373947_0012774
653 Ga0373937_0041543
654 Ga0373937_0484107
655 Ga0373937_0517980
656 Ga0373937_0621658
657 Ga0373925_0019496
658 Ga0436364_0136580
659 Ga0436364_0742626
660 Ga0436365_0558696
661 Ga0436365_1568420
662 Ga0436361_0720606
663 Ga0436363_0163367
664 Ga0436363_0876867
665 Ga0436362_0414415
666 Ga0451847_0248573
667 Ga0451849_0660103
668 Ga0451853_0165080
669 Ga0451853_2675460
670 Ga0439450_146724
671 Ga0466960_0051237
672 Ga0495617_054464
673 Ga0495592_0020696
674 Ga0495592_0360308
675 Ga0495592_0760563
676 Ga0495603_0026721
677 Ga0495590_0158930
678 Ga0495629_0081386
679 Ga0495641_0027008
680 Ga0495641_0489840
681 Ga0495641_0535156
682 Ga0495651_0019251
683 Ga0495651_0141056
684 Ga0495653_0004065
685 Ga0495582_0038270
686 Ga0495582_0157403
687 Ga0495639_0013734
688 Ga0495662_0063684
689 Ga0495662_0246143
690 Ga0495662_0458360
691 Ga0495664_0016629
692 Ga0495664_0086781
693 Ga0495664_0402728
694 Ga0495585_0170619
695 Ga0495608_0017725
696 Ga0495618_0013232
697 Ga0495618_0536780
698 Ga0495618_0630358
699 Ga0495620_0152324
700 Ga0495628_0019924
701 Ga0495628_0373139
702 Ga0495630_0016599
703 Ga0495630_1063096
704 Ga0495652_0018936
705 Ga0495652_0038210
706 Ga0495652_0449731
707 Ga0495665_0011138
708 Ga0495665_0248831
709 Ga0495640_0020157
710 Ga0495586_0062458
711 Ga0495587_0275207
712 Ga0495598_0124828
713 Ga0495645_0019674
714 Ga0495667_0017530
715 Ga0495656_0094326
716 Ga0495634_0022863
717 Ga0495611_0024942
718 Ga0495611_0129780
719 Ga0495625_0469959
720 Ga0495625_0871531
721 Ga0495635_0018773
722 Ga0495635_0074240
723 Ga0495588_0240617
724 Ga0495657_0019613
725 Ga0495599_0015269
726 Ga0495599_0120954
727 Ga0495646_0015707
728 Ga0495658_0120925
729 Ga0495613_0137641
730 Ga0495613_0534334
731 Ga0495624_0017947
732 Ga0495624_0249842
733 Ga0495670_0798311
734 Ga0495589_0341893
735 Ga0495600_0015447
736 Ga0495660_0072586
737 Ga0495581_0012895
738 Ga0495581_0160159
739 Ga0495581_0203818
740 Ga0495604_0082272
741 Ga0495604_0108414
742 Ga0495674_0031658
743 Ga0495674_0062131
744 Ga0495674_0329324
745 Ga0495676_0037677
746 Ga0495676_0094179
747 Ga0495676_0644843
748 Ga0495680_0024552
749 Ga0495680_0199287
750 Ga0495683_0013022
751 Ga0495683_0431673
752 Ga0495687_033721
753 Ga0495687_073644
754 Ga0495675_0487962
755 Ga0495685_021588
756 Ga0495684_0021861
757 Ga0495593_0012238
758 Ga0495593_0150119
759 Ga0495602_0045675
760 Ga0495602_0593379
761 Ga0495614_0039707
762 Ga0496100_0044653
763 Ga0496100_0163925
764 Ga0496100_0260576
765 Ga0496101_0066193
766 Ga0496101_0484078
767 Ga0496101_0833141
768 Ga0496102_0157758
769 Ga0496102_0220810
770 Ga0496102_0866588
771 Ga0496103_0015974
772 Ga0496104_0123676
773 Ga0496105_0107535
774 Ga0496106_0385875
775 Ga0496107_0216475
776 Ga0496108_0054658
777 Ga0496108_0362263
778 Ga0496109_0188149
779 Ga0496109_0407786
780 Ga0496110_0009899
781 Ga0496111_0037308
782 Ga0496112_0032908
783 Ga0496113_0023840
784 Ga0496114_0032436
785 Ga0496114_0097595
786 Ga0496114_0152897
787 Ga0496114_0158190
788 Ga0496115_0027513
789 Ga0496115_1079961
790 Ga0496124_0093886
791 Ga0501290_045438
792 Ga0501299_113060
793 Ga0501303_039114
794 Ga0501047_1011548
795 Ga0501261_014073
796 Ga0501268_024107
797 Ga0501044_1089785
798 Ga0501045_0046401
799 nmdc:mga05p37_11096_c1
800 nmdc:mga09592_82576_c1
801 nmdc:mga0qj67_44097_c1
802 nmdc:mga06r32_48212_c1
803 nmdc:mga08y16_52432_c1
804 nmdc:mga0n895_938248_c1
805 nmdc:mga0rr50_236178_c1
806 nmdc:mga0rr50_36879_c1
807 nmdc:mga08x19_24516_c1
808 Ga0495601_0013241
809 Ga0495612_0115457
810 Ga0495619_0040847
811 Ga0500646_0000155
812 Ga0500646_0010166
813 Ga0500560_009400
814 Ga0500573_0036766
815 Ga0500577_0000081
816 Ga0500600_0185340
817 Ga0501084_0549691
818 2515721964
819 2585322045
820 2644266117
821 2776375379
822 2809589815
823 2855389332
824 2856864131
825 2863068022
826 2863072027
827 2863075344
828 2867374072
829 2867477724
830 2912764797

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

10

78

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qwg-assembly1.cif.gz_A crystal structure of esprdelta10, c-terminal 10 amino acids deletion mutant of espr transcription factor from mycobacterium tuberculosis 0.6732 7 54
3r1f-assembly7.cif.gz_M crystal structure of a key regulator of virulence in mycobacterium tuberculosis 0.666 7 62
3r1f-assembly8.cif.gz_O crystal structure of a key regulator of virulence in mycobacterium tuberculosis 0.6522 7 58
3r1f-assembly9.cif.gz_R crystal structure of a key regulator of virulence in mycobacterium tuberculosis 0.6503 7 60
3qyx-assembly1.cif.gz_D crystal structure of mycobacterium tuberculosis espr in complex with a small dna fragment 0.6463 7 54
ID Description Score Start End Superfamily
3qwgB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.7102 7 58 1.10.260.40
2gzuA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.6928 3 57 1.10.260.40
2lylA00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.658 3 60 1.10.260.40
2lylB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.6507 3 60 1.10.260.40
3qyxD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.6463 7 54 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1F4A086-F1-model_v4 Uncharacterized protein 0.7226 1 61
AF-A0A6N4UXM3-F1-model_v4 HTH cro/C1-type domain-containing protein 0.7147 7 58 GO:0003677
AF-A0A1M5CM69-F1-model_v4 Helix-turn-helix 0.7113 7 58 GO:0003677
AF-Q9CIA4-F1-model_v4 Prophage pi1 protein 27 0.7048 3 58 GO:0003677
AF-A0A1F4A086-F1-model_v4 Uncharacterized protein 0.7038 1 61

Map