F439077

General Info

Members Datasets Scaffolds Average Seq Length
417 249 834 306

Family's Representative Sequence

Representative Sequence 3300025904|Ga0207647_10069770|Ga0207647_100697702
Length 341
Sequence VSVTALDRPRRCGRALDLGGSRGGFQEAIAITTTSRAAHPHTVRPRSDRSLRSTVRAYFLLTKPRVMELLLVSTVPVMFLAAGGLPNLWLVLATVVGGAMSAGSAASFNMYLDRDIDVHMHRTENRPLVTGAVSPRGALVFSWTLAVVSTIWLAVFTNWLAAALSAFAIFFYVVIYTMLLKRRTEQNIVWGGIAGCFPVLIGWAAVTGSLDWPPFVLFAVIFLWTPPHYWPLSMKYKDDYNDVDVPMLGVTRSAAQVGMQVILYAWATIVCSLLLIPVAQMGLVYSVSAVVFGGWFLYEAHVLYARAVRDAAPKPMRVFHASITYLTLLFLAVAVDPLLPF

Samples

Sample ID Description Type Environment
1 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
60 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
87 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
88 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
94 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
98 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
99 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
100 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
101 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
102 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
103 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
104 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
105 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
106 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
109 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
115 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
116 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
117 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
118 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
121 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
122 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
123 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
124 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
125 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
126 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
134 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
135 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
136 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
137 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
142 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
143 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
174 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
175 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
180 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
181 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
182 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
183 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
186 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
187 2643221546 Microbacterium sp. Root53 Isolate Unclassified
188 2643221553 Microbacterium sp. Root553 Isolate Unclassified
189 2643221566 Microbacterium sp. Root166 Isolate Unclassified
190 2643221575 Microbacterium sp. Root61 Isolate Unclassified
191 2643221616 Leifsonia sp. Root227 Isolate Unclassified
192 2643221630 Microbacterium sp. Root322 Isolate Unclassified
193 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
194 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
195 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
196 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
197 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
198 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
199 2773857759 Microbacterium sp. 1294 Isolate Unclassified
200 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
201 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
202 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
203 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
204 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
205 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
206 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
207 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
208 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
209 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
210 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
211 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
212 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
213 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
214 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
215 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
216 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
217 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
218 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
219 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
220 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
221 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
222 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
223 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
224 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
225 2919069694 Microbacterium sp. 1154 Isolate Unclassified
226 2919395869 Microbacterium resistens 2980 Isolate Unclassified
227 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
228 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
229 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
230 2928153084 Leifsonia sp. 563 Isolate Unclassified
231 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
232 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
233 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
234 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
235 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
236 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
237 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
238 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
239 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
240 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
241 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
242 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
243 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
244 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
245 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
246 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
247 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
248 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
249 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.49
Metatranscriptomes 1.68
Isolates 15.83

Biome Distribution

Category Percentage (%)
Aerial Root 0.48
Bulb 0
Endosphere 11.75
Nodule 0
Rhizoplane 7.67
Rhizosphere 56.83
Stem 0
Stem Tuber 0.24
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207647_10069770 3300025904 Bacteria 2124
2 JGI24740J21852_10011084 3300001979 Bacteria 3443
3 JGI24735J21928_10015904 3300002067 Bacteria 2342
4 JGI24735J21928_10016058 3300002067 Bacteria 2329
5 JGI25154J39366_1001271 3300002738 Bacteria 9400
6 JGI25164J39214_1000465 3300002772 Bacteria 20556
7 JGI25165J46597_1000330 3300003214 Bacteria 56543
8 Ga0006562J51391_1038054 3300003578 Bacteria 1440
9 Ga0055539_1000008 3300003752 Bacteria 537665
10 Ga0055533_1000001 3300003756 Bacteria 1863437
11 Ga0055525_1000493 3300003759 Bacteria 20269
12 Ga0055525_1002254 3300003759 Bacteria 2109
13 Ga0055542_1009680 3300003762 Bacteria 1804
14 Ga0070658_10002027 3300005327 Bacteria 16977
15 Ga0070658_10007533 3300005327 Bacteria 8784
16 Ga0070658_10026664 3300005327 Bacteria 4637
17 Ga0070670_100379605 3300005331 Bacteria 1245
18 Ga0070666_10207263 3300005335 Bacteria 1380
19 Ga0070682_100018884 3300005337 Bacteria 4038
20 Ga0068868_100050830 3300005338 Bacteria 3257
21 Ga0070660_100013633 3300005339 Bacteria 5840
22 Ga0070659_100022503 3300005366 Bacteria 4813
23 Ga0070710_10013095 3300005437 Bacteria 4141
24 Ga0070663_100030523 3300005455 Bacteria 3695
25 Ga0070663_100168919 3300005455 Bacteria 1689
26 Ga0070685_10027392 3300005466 Bacteria 3149
27 Ga0068853_100085808 3300005539 Bacteria 2760
28 Ga0068853_100175927 3300005539 Bacteria 1938
29 Ga0070672_100017839 3300005543 Bacteria 5117
30 Ga0068855_100001400 3300005563 Bacteria 29906
31 Ga0068855_100051211 3300005563 Bacteria 4864
32 Ga0068855_100067307 3300005563 Bacteria 4173
33 Ga0068855_100144423 3300005563 Bacteria 2710
34 Ga0068855_100146068 3300005563 Bacteria 2692
35 Ga0068857_100002185 3300005577 Bacteria 15913
36 Ga0068857_100368333 3300005577 Bacteria 1333
37 Ga0068852_100007045 3300005616 Bacteria 8187
38 Ga0068852_100017657 3300005616 Bacteria 5604
39 Ga0068851_10000061 3300005834 Bacteria 60738
40 Ga0068858_100000153 3300005842 Bacteria 72963
41 Ga0075365_10007211 3300006038 Bacteria 6209
42 Ga0075365_10007857 3300006038 Bacteria 6009
43 Ga0075365_10270089 3300006038 Bacteria 1196
44 Ga0075368_10008324 3300006042 Bacteria 3688
45 Ga0075363_100050234 3300006048 Bacteria 2222
46 Ga0075364_10101370 3300006051 Bacteria 1917
47 Ga0075367_10004898 3300006178 Bacteria 6595
48 Ga0075369_10015893 3300006186 Bacteria 3028
49 Ga0075369_10028015 3300006186 Bacteria 2359
50 Ga0075431_100036781 3300006847 Bacteria 5043
51 Ga0105240_10002502 3300009093 Bacteria 29534
52 Ga0105245_10007946 3300009098 Bacteria 9277
53 Ga0105245_10083741 3300009098 Bacteria 2920
54 Ga0105247_10208465 3300009101 Bacteria 1317
55 Ga0114129_10443566 3300009147 Bacteria 1703
56 Ga0105241_10000229 3300009174 Bacteria 42324
57 Ga0105248_10000378 3300009177 Bacteria 51937
58 Ga0105248_10002763 3300009177 Bacteria 19507
59 Ga0105237_10000827 3300009545 Bacteria 42359
60 Ga0105237_10301822 3300009545 Bacteria 1604
61 Ga0105238_10000640 3300009551 Bacteria 36820
62 Ga0157371_10009058 3300013102 Bacteria 7870
63 Ga0157371_10298465 3300013102 Bacteria 1166
64 Ga0157370_10004734 3300013104 Bacteria 15512
65 Ga0157369_10079915 3300013105 Bacteria 3502
66 Ga0157369_10095383 3300013105 Bacteria 3174
67 Ga0157369_10237576 3300013105 Bacteria 1904
68 Ga0157369_10322967 3300013105 Bacteria 1604
69 Ga0171462_1003 3300013250 Bacteria 853796
70 Ga0163162_10036949 3300013306 Bacteria 4872
71 Ga0163162_10281049 3300013306 Bacteria 1796
72 Ga0157372_10033036 3300013307 Bacteria 5680
73 Ga0157372_10138451 3300013307 Bacteria 2804
74 Ga0157372_10140781 3300013307 Bacteria 2779
75 Ga0157379_10034399 3300014968 Bacteria 4518
76 Ga0197907_10239469 3300020069 Bacteria 1832
77 Ga0206354_11267577 3300020081 Bacteria 3229
78 Ga0206353_10281988 3300020082 Bacteria 3283
79 Ga0206353_10900026 3300020082 Bacteria 1099
80 Ga0209566_100050 3300025225 Bacteria 234653
81 Ga0209674_100001 3300025226 Bacteria 4013750
82 Ga0209563_100001 3300025230 Bacteria 4013775
83 Ga0209563_101726 3300025230 Bacteria 5519
84 Ga0207427_100052 3300025231 Bacteria 218228
85 Ga0209437_100484 3300025233 Bacteria 29919
86 Ga0209646_1000071 3300025246 Bacteria 228702
87 Ga0209677_100001 3300025253 Bacteria 4013787
88 Ga0209148_1002128 3300025254 Bacteria 7419
89 Ga0209233_1000001 3300025261 Bacteria 2992747
90 Ga0209455_1000606 3300025272 Bacteria 22799
91 Ga0207656_10000012 3300025321 Bacteria 190545
92 Ga0207655_1009867 3300025728 Bacteria 5875
93 Ga0207710_10080895 3300025900 Bacteria 1507
94 Ga0207680_10226153 3300025903 Bacteria 1284
95 Ga0207705_10000006 3300025909 Bacteria 657147
96 Ga0207705_10077789 3300025909 Bacteria 2413
97 Ga0207705_10121144 3300025909 Bacteria 1941
98 Ga0207654_10000003 3300025911 Bacteria 1030378
99 Ga0207695_10014002 3300025913 Bacteria 9525
100 Ga0207695_10018361 3300025913 Bacteria 8091
101 Ga0207671_10000002 3300025914 Bacteria 1144816
102 Ga0207671_10060471 3300025914 Bacteria 2810
103 Ga0207671_10189478 3300025914 Bacteria 1603
104 Ga0207657_10006607 3300025919 Bacteria 12003
105 Ga0207657_10070387 3300025919 Bacteria 2965
106 Ga0207694_10000061 3300025924 Bacteria 141236
107 Ga0207690_10001116 3300025932 Bacteria 17117
108 Ga0207690_10081366 3300025932 Bacteria 2263
109 Ga0207691_10151883 3300025940 Bacteria 2036
110 Ga0207711_10000548 3300025941 Bacteria 38342
111 Ga0207667_10015030 3300025949 Bacteria 8806
112 Ga0207667_10026053 3300025949 Bacteria 6394
113 Ga0207667_10080064 3300025949 Bacteria 3385
114 Ga0207667_10404686 3300025949 Bacteria 1389
115 Ga0207667_10647047 3300025949 Bacteria 1063
116 Ga0207658_10006724 3300025986 Bacteria 7829
117 Ga0207677_10055478 3300026023 Bacteria 2710
118 Ga0207703_10000044 3300026035 Bacteria 158471
119 Ga0207639_10013349 3300026041 Bacteria 5749
120 Ga0207639_10073122 3300026041 Bacteria 2687
121 Ga0207678_10049744 3300026067 Bacteria 3622
122 Ga0207702_10042071 3300026078 Bacteria 3832
123 Ga0207674_10009720 3300026116 Bacteria 10962
124 Ga0207698_10002215 3300026142 Bacteria 11485
125 Ga0207698_10002786 3300026142 Bacteria 10433
126 Ga0209813_10009565 3300027866 Bacteria 2484
127 Ga0265338_10061460 3300028800 Bacteria 3292
128 Ga0265327_10000660 3300031251 Bacteria 55433
129 Ga0307406_10000186 3300031901 Bacteria 37012
130 Ga0307406_10000634 3300031901 Bacteria 20089
131 Ga0307406_10002718 3300031901 Bacteria 9639
132 Ga0307406_10065636 3300031901 Bacteria 2359
133 Ga0307406_10426360 3300031901 Bacteria 1058
134 Ga0307415_100440138 3300032126 Bacteria 1124
135 Ga0395899_0003562 3300037312 Bacteria 12328
136 Ga0395900_0002028 3300037418 Bacteria 22775
137 Ga0395900_0275918 3300037418 Bacteria 1675
138 Ga0395898_0000131 3300037466 Bacteria 192369
139 Ga0395898_0027166 3300037466 Bacteria 5749
140 Ga0395901_0386185 3300038443 Bacteria 1440
141 Ga0395901_0426194 3300038443 Bacteria 1360
142 Ga0436363_0928018 3300039450 Bacteria 970
143 Ga0436362_0965106 3300039453 Bacteria 1010
144 Ga0451791_0793231 3300041451 Bacteria 1013
145 Ga0451795_1513721 3300041456 Bacteria 1127
146 Ga0466972_0006526 3300044658 Bacteria 5862
147 Ga0466972_0016924 3300044658 Bacteria 3647
148 Ga0466972_0025349 3300044658 Bacteria 2940
149 Ga0466965_0005956 3300044683 Bacteria 5509
150 Ga0466965_0027394 3300044683 Bacteria 2767
151 Ga0466965_0089238 3300044683 Bacteria 1566
152 Ga0466966_0031692 3300044684 Bacteria 3428
153 Ga0466966_0053995 3300044684 Bacteria 2547
154 Ga0466961_0040845 3300044693 Bacteria 2973
155 Ga0466961_0043311 3300044693 Bacteria 2884
156 Ga0466961_0061833 3300044693 Bacteria 2380
157 Ga0466968_0034194 3300044735 Bacteria 2120
158 Ga0466968_0075759 3300044735 Bacteria 1471
159 Ga0466970_0000029 3300044765 Bacteria 52034
160 Ga0466970_0076578 3300044765 Bacteria 1802
161 Ga0466970_0225559 3300044765 Bacteria 1046
162 Ga0466957_0039645 3300044842 Bacteria 2842
163 Ga0466960_0002063 3300044901 Bacteria 7470
164 Ga0466959_0144559 3300045049 Bacteria 1679
165 Ga0466958_0026352 3300045836 Bacteria 3435
166 Ga0466958_0100073 3300045836 Bacteria 1802
167 Ga0495627_000998 3300046453 Bacteria 19032
168 Ga0495627_005209 3300046453 Bacteria 5285
169 Ga0495650_0001368 3300046471 Bacteria 24092
170 Ga0495654_0036147 3300046530 Bacteria 2484
171 Ga0495645_0198786 3300046543 Bacteria 1361
172 Ga0495625_0119478 3300046660 Bacteria 1795
173 Ga0495625_0260331 3300046660 Bacteria 1123
174 Ga0495672_0031872 3300047320 Bacteria 3286
175 Ga0495681_0098436 3300047470 Bacteria 1282
176 Ga0495686_0063560 3300047472 Bacteria 2287
177 Ga0495686_0112865 3300047472 Bacteria 1628
178 Ga0495686_0123158 3300047472 Bacteria 1543
179 Ga0495686_0139055 3300047472 Bacteria 1434
180 Ga0496100_0019113 3300048903 Bacteria 4080
181 Ga0496101_0011486 3300048904 Bacteria 5878
182 Ga0496101_0016446 3300048904 Bacteria 4997
183 Ga0496101_0054486 3300048904 Bacteria 2888
184 Ga0496102_0144163 3300048905 Bacteria 2234
185 Ga0496103_0003139 3300048906 Bacteria 10164
186 Ga0496103_0027854 3300048906 Bacteria 3427
187 Ga0496104_0036089 3300048907 Bacteria 4618
188 Ga0496104_0071020 3300048907 Bacteria 3310
189 Ga0496104_0150497 3300048907 Bacteria 2234
190 Ga0496105_0027743 3300048908 Bacteria 4628
191 Ga0496105_0029294 3300048908 Bacteria 4505
192 Ga0496105_0035664 3300048908 Bacteria 4094
193 Ga0496107_0007438 3300048910 Bacteria 7550
194 Ga0496108_0027370 3300048911 Bacteria 4707
195 Ga0496108_0027866 3300048911 Bacteria 4670
196 Ga0496109_0083410 3300048912 Bacteria 2947
197 Ga0496109_0089643 3300048912 Bacteria 2844
198 Ga0496110_0026659 3300048913 Bacteria 4948
199 Ga0496110_0092090 3300048913 Bacteria 2712
200 Ga0496111_0022540 3300048914 Bacteria 4411
201 Ga0496112_0030392 3300048915 Bacteria 5227
202 Ga0496113_0005979 3300048916 Bacteria 7657
203 Ga0496114_0046934 3300048917 Bacteria 3590
204 Ga0496114_0059352 3300048917 Bacteria 3195
205 Ga0496115_0012430 3300048918 Bacteria 6407
206 Ga0496115_0012979 3300048918 Bacteria 6285
207 Ga0496115_0058796 3300048918 Bacteria 3095
208 Ga0496115_0242028 3300048918 Bacteria 1487
209 Ga0496115_0402452 3300048918 Bacteria 1110
210 Ga0496116_0009700 3300048919 Bacteria 8181
211 Ga0496117_0000471 3300048920 Bacteria 66939
212 Ga0496117_0001264 3300048920 Bacteria 37571
213 Ga0496117_0002993 3300048920 Bacteria 20350
214 Ga0496117_0006383 3300048920 Bacteria 11967
215 Ga0496117_0037551 3300048920 Bacteria 3607
216 Ga0496117_0038239 3300048920 Bacteria 3562
217 Ga0496117_0054020 3300048920 Bacteria 2817
218 Ga0496117_0063721 3300048920 Bacteria 2518
219 Ga0496118_0005622 3300048921 Bacteria 14156
220 Ga0496118_0007527 3300048921 Bacteria 11507
221 Ga0496118_0063513 3300048921 Bacteria 2716
222 Ga0496119_0006570 3300048922 Bacteria 10719
223 Ga0496119_0009936 3300048922 Bacteria 8074
224 Ga0496119_0013684 3300048922 Bacteria 6436
225 Ga0496119_0017772 3300048922 Bacteria 5331
226 Ga0496119_0034058 3300048922 Bacteria 3363
227 Ga0496119_0112312 3300048922 Bacteria 1510
228 Ga0496119_0147670 3300048922 Bacteria 1263
229 Ga0496120_0000566 3300048923 Bacteria 56431
230 Ga0496120_0000593 3300048923 Bacteria 54794
231 Ga0496120_0001691 3300048923 Bacteria 25302
232 Ga0496120_0003709 3300048923 Bacteria 13617
233 Ga0496120_0012438 3300048923 Bacteria 5795
234 Ga0496120_0058111 3300048923 Bacteria 2174
235 Ga0496120_0073260 3300048923 Bacteria 1875
236 Ga0496121_0000040 3300048924 Bacteria 348494
237 Ga0496121_0075930 3300048924 Bacteria 2682
238 Ga0496122_0000054 3300048925 Bacteria 259135
239 Ga0496122_0000120 3300048925 Bacteria 182539
240 Ga0496122_0001347 3300048925 Bacteria 40068
241 Ga0496122_0001923 3300048925 Bacteria 31387
242 Ga0496122_0007745 3300048925 Bacteria 11816
243 Ga0496122_0029374 3300048925 Bacteria 4639
244 Ga0496122_0104733 3300048925 Bacteria 1879
245 Ga0496123_0000039 3300048926 Bacteria 259107
246 Ga0496123_0000051 3300048926 Bacteria 237095
247 Ga0496123_0011520 3300048926 Bacteria 7659
248 Ga0496123_0011853 3300048926 Bacteria 7500
249 Ga0496123_0056573 3300048926 Bacteria 2562
250 Ga0496124_0002245 3300048927 Bacteria 25691
251 Ga0496124_0020501 3300048927 Bacteria 6105
252 Ga0496124_0044572 3300048927 Bacteria 3805
253 Ga0496125_0002360 3300048928 Bacteria 24729
254 Ga0496125_0005214 3300048928 Bacteria 14583
255 Ga0496125_0005465 3300048928 Bacteria 14112
256 Ga0496125_0023383 3300048928 Bacteria 5705
257 Ga0496125_0024104 3300048928 Bacteria 5603
258 Ga0496125_0073243 3300048928 Bacteria 2664
259 Ga0496126_0001388 3300048929 Bacteria 38310
260 Ga0496126_0002236 3300048929 Bacteria 26771
261 Ga0496126_0003610 3300048929 Bacteria 19352
262 Ga0496126_0013398 3300048929 Bacteria 8342
263 Ga0496126_0019697 3300048929 Bacteria 6639
264 Ga0496126_0037054 3300048929 Bacteria 4554
265 Ga0496126_0068277 3300048929 Bacteria 3174
266 Ga0501032_0096586 3300049569 Bacteria 1958
267 Ga0501033_0021771 3300049570 Bacteria 4838
268 Ga0501033_0022140 3300049570 Bacteria 4795
269 Ga0501033_0023915 3300049570 Bacteria 4608
270 Ga0501033_0077907 3300049570 Bacteria 2432
271 Ga0501033_0113410 3300049570 Bacteria 1971
272 Ga0501034_0002208 3300049571 Bacteria 24087
273 Ga0501034_0003742 3300049571 Bacteria 17185
274 Ga0501034_0004274 3300049571 Bacteria 15928
275 Ga0501034_0007703 3300049571 Bacteria 11458
276 Ga0501034_0032955 3300049571 Bacteria 5260
277 Ga0501034_0054353 3300049571 Bacteria 4031
278 Ga0501034_0070796 3300049571 Bacteria 3498
279 Ga0501034_0074764 3300049571 Bacteria 3396
280 Ga0501034_0259543 3300049571 Bacteria 1680
281 Ga0501034_0389501 3300049571 Bacteria 1317
282 Ga0501036_0158057 3300049572 Bacteria 1912
283 Ga0501037_0172356 3300049573 Bacteria 1537
284 Ga0501037_0280276 3300049573 Bacteria 1161
285 Ga0501038_0017114 3300049574 Bacteria 6557
286 Ga0501038_0154787 3300049574 Bacteria 1867
287 Ga0501038_0169734 3300049574 Bacteria 1767
288 Ga0501038_0188028 3300049574 Bacteria 1663
289 Ga0501039_0047226 3300049575 Bacteria 3327
290 Ga0501042_0008396 3300049578 Bacteria 6812
291 Ga0501043_0006105 3300049579 Bacteria 9679
292 Ga0501043_0146957 3300049579 Bacteria 1845
293 Ga0501046_0010472 3300049580 Bacteria 7961
294 Ga0501046_0163255 3300049580 Bacteria 1674
295 Ga0501047_0029649 3300049581 Bacteria 5275
296 Ga0501047_0098718 3300049581 Bacteria 2799
297 Ga0501047_0187499 3300049581 Bacteria 1933
298 Ga0501047_0291469 3300049581 Bacteria 1475
299 Ga0501067_0139145 3300049583 Bacteria 1352
300 Ga0501068_0188437 3300049584 Bacteria 1306
301 Ga0501069_0034724 3300049585 Bacteria 2777
302 Ga0501070_0000300 3300049586 Bacteria 45950
303 Ga0501070_0000473 3300049586 Bacteria 36519
304 Ga0501070_0001151 3300049586 Bacteria 23680
305 Ga0501070_0485514 3300049586 Bacteria 993
306 Ga0501072_0107578 3300049588 Bacteria 2218
307 Ga0501073_0000029 3300049589 Bacteria 117147
308 Ga0501073_0003717 3300049589 Bacteria 11463
309 Ga0501073_0019594 3300049589 Bacteria 4881
310 Ga0501073_0115169 3300049589 Bacteria 1863
311 Ga0501077_0275575 3300049593 Bacteria 1070
312 Ga0501080_0001375 3300049742 Bacteria 20355
313 Ga0501080_0149250 3300049742 Bacteria 2161
314 Ga0501083_0000042 3300049744 Bacteria 92618
315 Ga0501083_0011776 3300049744 Bacteria 6130
316 Ga0501035_0009360 3300049822 Bacteria 9106
317 Ga0501035_0034641 3300049822 Bacteria 4586
318 Ga0501035_0073862 3300049822 Bacteria 3017
319 Ga0501035_0090803 3300049822 Bacteria 2689
320 Ga0501035_0162332 3300049822 Bacteria 1933
321 Ga0501044_0006300 3300049823 Bacteria 13114
322 Ga0501044_0084051 3300049823 Bacteria 3217
323 Ga0501045_0274752 3300049824 Bacteria 1254
324 nmdc:mga00v17_137280_c1 3300050491 Bacteria 1566
325 nmdc:mga00v17_17042_c1 3300050491 Bacteria 4103
326 nmdc:mga00v17_22241_c1 3300050491 Bacteria 3656
327 nmdc:mga00v17_85138_c1 3300050491 Bacteria 1979
328 nmdc:mga0yw44_2380_c1 3300050492 Bacteria 7993
329 nmdc:mga0yw44_9850_c1 3300050492 Bacteria 4853
330 nmdc:mga06z11_3184_c1 3300050494 Bacteria 6336
331 nmdc:mga04h51_11193_c1 3300050495 Bacteria 2484
332 nmdc:mga07m45_80214_c1 3300050496 Bacteria 1863
333 nmdc:mga0qj67_184323_c1 3300050509 Bacteria 1696
334 nmdc:mga06r32_97532_c1 3300050510 Bacteria 2881
335 nmdc:mga0sz30_25644_c1 3300050516 Bacteria 2411
336 Ga0500635_0000012 3300053080 Bacteria 138781
337 Ga0500643_000425 3300053087 Bacteria 32082
338 Ga0500556_0000001 3300053104 Bacteria 1135060
339 Ga0500652_022522 3300053131 Bacteria 2385
340 Ga0500568_0000006 3300053139 Bacteria 522235
341 Ga0500568_0000014 3300053139 Bacteria 223550
342 Ga0500568_0001140 3300053139 Bacteria 17832
343 Ga0500568_0005214 3300053139 Bacteria 6770
344 Ga0500573_0026668 3300053140 Bacteria 3321
345 Ga0500616_0000021 3300053153 Bacteria 484527
346 Ga0500616_0000125 3300053153 Bacteria 135146
347 Ga0500620_000008 3300053155 Bacteria 52879
348 Ga0501084_0093958 3300054114 Bacteria 2518
349 Ga0501084_0151313 3300054114 Bacteria 1956
350 Ga0587084_010586 3300059477 Bacteria 1212
351 Ga0587115_015193 3300059626 Bacteria 1017
352 2588108300 2585428157 Bacteria 3018951
353 2643733523 2643221542 Bacteria 3563959
354 2643752721 2643221546 Bacteria 2910897
355 2643785984 2643221553 Bacteria 3544260
356 2643848134 2643221566 Bacteria 3460379
357 2643885179 2643221575 Bacteria 4022601
358 2644096107 2643221616 Bacteria 4066575
359 2644170098 2643221630 Bacteria 3601215
360 2644183541 2643221632 Bacteria 3406696
361 2644680399 2643221724 Bacteria 3593515
362 2730229852 2728369380 Bacteria 3620317
363 2747954286 2747842429 Bacteria 3914386
364 2758226337 2757320536 Bacteria 3629334
365 2774380728 2773857758 Bacteria 3592392
366 2774384678 2773857759 Bacteria 2963774
367 2774399766 2773857763 Bacteria 4180068
368 2808631397 2808606306 Bacteria 3608896
369 2808885448 2808606368 Bacteria 3174172
370 2809227208 2808606447 Bacteria 3572005
371 2812322898 2811994872 Bacteria 4121241
372 2821269803 2821268502 Bacteria 3750023
373 2833710726 2833709550 Bacteria 4008291
374 2837273345 2837268691 Bacteria 7850704
375 2844842519 2844841374 Bacteria 3917147
376 2844855464 2844852863 Bacteria 3849151
377 2852633411 2852632344 Bacteria 3463163
378 2852645433 2852643534 Bacteria 3013378
379 2852647475 2852646457 Bacteria 3408613
380 2852663932 2852663356 Bacteria 4090475
381 2852665403 2852663356 Bacteria 4090475
382 2857721658 2857720070 Bacteria 3189373
383 2857724028 2857723135 Bacteria 4217853
384 2857732580 2857729791 Bacteria 4040535
385 2857735635 2857733635 Bacteria 3532004
386 2857737390 2857737099 Bacteria 3104305
387 2868089033 2868088558 Bacteria 7609351
388 2870630136 2870628048 Bacteria 3696012
389 2884765473 2884763398 Bacteria 4091164
390 2904512877 2904509784 Bacteria 3520416
391 2908681154 2908678064 Bacteria 3482747
392 2919058204 2919055335 Bacteria 3875751
393 2919072968 2919069694 Bacteria 3622919
394 2919398769 2919395869 Bacteria 3704152
395 2919524578 2919523602 Bacteria 3788128
396 2928092305 2928090899 Bacteria 3158267
397 2928122922 2928121344 Bacteria 3972376
398 2928156499 2928153084 Bacteria 4020257
399 2939661022 2939660829 Bacteria 3784848
400 2945971992 2945968032 Bacteria 4111363
401 2946033630 2946033335 Bacteria 3835514
402 2946044363 2946041624 Bacteria 4191385
403 2946080791 2946080515 Bacteria 4310960
404 2974296942 2974294766 Bacteria 3767688
405 2974326826 2974324384 Bacteria 3750535
406 2977231131 2977228692 Bacteria 3450105
407 2977239924 2977236895 Bacteria 3569373
408 2977253741 2977251589 Bacteria 2952848
409 2977266381 2977264416 Bacteria 3750737
410 2984545804 2984542743 Bacteria 3569378
411 2984580919 2984580707 Bacteria 3351387
412 8004185027 8004182704 Bacteria 3391155
413 8004214098 8004212874 Bacteria 2861420
414 8016257772 8016254467 Bacteria 3797036
415 8055038549 8055037949 Bacteria 3337834
416 8056037545 8056037122 Bacteria 3854319
417 8057348691 8057345674 Bacteria 4160394
418 Ga0207647_10069770
419 JGI24740J21852_10011084
420 JGI24735J21928_10015904
421 JGI24735J21928_10016058
422 JGI25154J39366_1001271
423 JGI25164J39214_1000465
424 JGI25165J46597_1000330
425 Ga0006562J51391_1038054
426 Ga0055539_1000008
427 Ga0055533_1000001
428 Ga0055525_1000493
429 Ga0055525_1002254
430 Ga0055542_1009680
431 Ga0070658_10002027
432 Ga0070658_10007533
433 Ga0070658_10026664
434 Ga0070670_100379605
435 Ga0070666_10207263
436 Ga0070682_100018884
437 Ga0068868_100050830
438 Ga0070660_100013633
439 Ga0070659_100022503
440 Ga0070710_10013095
441 Ga0070663_100030523
442 Ga0070663_100168919
443 Ga0070685_10027392
444 Ga0068853_100085808
445 Ga0068853_100175927
446 Ga0070672_100017839
447 Ga0068855_100001400
448 Ga0068855_100051211
449 Ga0068855_100067307
450 Ga0068855_100144423
451 Ga0068855_100146068
452 Ga0068857_100002185
453 Ga0068857_100368333
454 Ga0068852_100007045
455 Ga0068852_100017657
456 Ga0068851_10000061
457 Ga0068858_100000153
458 Ga0075365_10007211
459 Ga0075365_10007857
460 Ga0075365_10270089
461 Ga0075368_10008324
462 Ga0075363_100050234
463 Ga0075364_10101370
464 Ga0075367_10004898
465 Ga0075369_10015893
466 Ga0075369_10028015
467 Ga0075431_100036781
468 Ga0105240_10002502
469 Ga0105245_10007946
470 Ga0105245_10083741
471 Ga0105247_10208465
472 Ga0114129_10443566
473 Ga0105241_10000229
474 Ga0105248_10000378
475 Ga0105248_10002763
476 Ga0105237_10000827
477 Ga0105237_10301822
478 Ga0105238_10000640
479 Ga0157371_10009058
480 Ga0157371_10298465
481 Ga0157370_10004734
482 Ga0157369_10079915
483 Ga0157369_10095383
484 Ga0157369_10237576
485 Ga0157369_10322967
486 Ga0171462_1003
487 Ga0163162_10036949
488 Ga0163162_10281049
489 Ga0157372_10033036
490 Ga0157372_10138451
491 Ga0157372_10140781
492 Ga0157379_10034399
493 Ga0197907_10239469
494 Ga0206354_11267577
495 Ga0206353_10281988
496 Ga0206353_10900026
497 Ga0209566_100050
498 Ga0209674_100001
499 Ga0209563_100001
500 Ga0209563_101726
501 Ga0207427_100052
502 Ga0209437_100484
503 Ga0209646_1000071
504 Ga0209677_100001
505 Ga0209148_1002128
506 Ga0209233_1000001
507 Ga0209455_1000606
508 Ga0207656_10000012
509 Ga0207655_1009867
510 Ga0207710_10080895
511 Ga0207680_10226153
512 Ga0207705_10000006
513 Ga0207705_10077789
514 Ga0207705_10121144
515 Ga0207654_10000003
516 Ga0207695_10014002
517 Ga0207695_10018361
518 Ga0207671_10000002
519 Ga0207671_10060471
520 Ga0207671_10189478
521 Ga0207657_10006607
522 Ga0207657_10070387
523 Ga0207694_10000061
524 Ga0207690_10001116
525 Ga0207690_10081366
526 Ga0207691_10151883
527 Ga0207711_10000548
528 Ga0207667_10015030
529 Ga0207667_10026053
530 Ga0207667_10080064
531 Ga0207667_10404686
532 Ga0207667_10647047
533 Ga0207658_10006724
534 Ga0207677_10055478
535 Ga0207703_10000044
536 Ga0207639_10013349
537 Ga0207639_10073122
538 Ga0207678_10049744
539 Ga0207702_10042071
540 Ga0207674_10009720
541 Ga0207698_10002215
542 Ga0207698_10002786
543 Ga0209813_10009565
544 Ga0265338_10061460
545 Ga0265327_10000660
546 Ga0307406_10000186
547 Ga0307406_10000634
548 Ga0307406_10002718
549 Ga0307406_10065636
550 Ga0307406_10426360
551 Ga0307415_100440138
552 Ga0395899_0003562
553 Ga0395900_0002028
554 Ga0395900_0275918
555 Ga0395898_0000131
556 Ga0395898_0027166
557 Ga0395901_0386185
558 Ga0395901_0426194
559 Ga0436363_0928018
560 Ga0436362_0965106
561 Ga0451791_0793231
562 Ga0451795_1513721
563 Ga0466972_0006526
564 Ga0466972_0016924
565 Ga0466972_0025349
566 Ga0466965_0005956
567 Ga0466965_0027394
568 Ga0466965_0089238
569 Ga0466966_0031692
570 Ga0466966_0053995
571 Ga0466961_0040845
572 Ga0466961_0043311
573 Ga0466961_0061833
574 Ga0466968_0034194
575 Ga0466968_0075759
576 Ga0466970_0000029
577 Ga0466970_0076578
578 Ga0466970_0225559
579 Ga0466957_0039645
580 Ga0466960_0002063
581 Ga0466959_0144559
582 Ga0466958_0026352
583 Ga0466958_0100073
584 Ga0495627_000998
585 Ga0495627_005209
586 Ga0495650_0001368
587 Ga0495654_0036147
588 Ga0495645_0198786
589 Ga0495625_0119478
590 Ga0495625_0260331
591 Ga0495672_0031872
592 Ga0495681_0098436
593 Ga0495686_0063560
594 Ga0495686_0112865
595 Ga0495686_0123158
596 Ga0495686_0139055
597 Ga0496100_0019113
598 Ga0496101_0011486
599 Ga0496101_0016446
600 Ga0496101_0054486
601 Ga0496102_0144163
602 Ga0496103_0003139
603 Ga0496103_0027854
604 Ga0496104_0036089
605 Ga0496104_0071020
606 Ga0496104_0150497
607 Ga0496105_0027743
608 Ga0496105_0029294
609 Ga0496105_0035664
610 Ga0496107_0007438
611 Ga0496108_0027370
612 Ga0496108_0027866
613 Ga0496109_0083410
614 Ga0496109_0089643
615 Ga0496110_0026659
616 Ga0496110_0092090
617 Ga0496111_0022540
618 Ga0496112_0030392
619 Ga0496113_0005979
620 Ga0496114_0046934
621 Ga0496114_0059352
622 Ga0496115_0012430
623 Ga0496115_0012979
624 Ga0496115_0058796
625 Ga0496115_0242028
626 Ga0496115_0402452
627 Ga0496116_0009700
628 Ga0496117_0000471
629 Ga0496117_0001264
630 Ga0496117_0002993
631 Ga0496117_0006383
632 Ga0496117_0037551
633 Ga0496117_0038239
634 Ga0496117_0054020
635 Ga0496117_0063721
636 Ga0496118_0005622
637 Ga0496118_0007527
638 Ga0496118_0063513
639 Ga0496119_0006570
640 Ga0496119_0009936
641 Ga0496119_0013684
642 Ga0496119_0017772
643 Ga0496119_0034058
644 Ga0496119_0112312
645 Ga0496119_0147670
646 Ga0496120_0000566
647 Ga0496120_0000593
648 Ga0496120_0001691
649 Ga0496120_0003709
650 Ga0496120_0012438
651 Ga0496120_0058111
652 Ga0496120_0073260
653 Ga0496121_0000040
654 Ga0496121_0075930
655 Ga0496122_0000054
656 Ga0496122_0000120
657 Ga0496122_0001347
658 Ga0496122_0001923
659 Ga0496122_0007745
660 Ga0496122_0029374
661 Ga0496122_0104733
662 Ga0496123_0000039
663 Ga0496123_0000051
664 Ga0496123_0011520
665 Ga0496123_0011853
666 Ga0496123_0056573
667 Ga0496124_0002245
668 Ga0496124_0020501
669 Ga0496124_0044572
670 Ga0496125_0002360
671 Ga0496125_0005214
672 Ga0496125_0005465
673 Ga0496125_0023383
674 Ga0496125_0024104
675 Ga0496125_0073243
676 Ga0496126_0001388
677 Ga0496126_0002236
678 Ga0496126_0003610
679 Ga0496126_0013398
680 Ga0496126_0019697
681 Ga0496126_0037054
682 Ga0496126_0068277
683 Ga0501032_0096586
684 Ga0501033_0021771
685 Ga0501033_0022140
686 Ga0501033_0023915
687 Ga0501033_0077907
688 Ga0501033_0113410
689 Ga0501034_0002208
690 Ga0501034_0003742
691 Ga0501034_0004274
692 Ga0501034_0007703
693 Ga0501034_0032955
694 Ga0501034_0054353
695 Ga0501034_0070796
696 Ga0501034_0074764
697 Ga0501034_0259543
698 Ga0501034_0389501
699 Ga0501036_0158057
700 Ga0501037_0172356
701 Ga0501037_0280276
702 Ga0501038_0017114
703 Ga0501038_0154787
704 Ga0501038_0169734
705 Ga0501038_0188028
706 Ga0501039_0047226
707 Ga0501042_0008396
708 Ga0501043_0006105
709 Ga0501043_0146957
710 Ga0501046_0010472
711 Ga0501046_0163255
712 Ga0501047_0029649
713 Ga0501047_0098718
714 Ga0501047_0187499
715 Ga0501047_0291469
716 Ga0501067_0139145
717 Ga0501068_0188437
718 Ga0501069_0034724
719 Ga0501070_0000300
720 Ga0501070_0000473
721 Ga0501070_0001151
722 Ga0501070_0485514
723 Ga0501072_0107578
724 Ga0501073_0000029
725 Ga0501073_0003717
726 Ga0501073_0019594
727 Ga0501073_0115169
728 Ga0501077_0275575
729 Ga0501080_0001375
730 Ga0501080_0149250
731 Ga0501083_0000042
732 Ga0501083_0011776
733 Ga0501035_0009360
734 Ga0501035_0034641
735 Ga0501035_0073862
736 Ga0501035_0090803
737 Ga0501035_0162332
738 Ga0501044_0006300
739 Ga0501044_0084051
740 Ga0501045_0274752
741 nmdc:mga00v17_137280_c1
742 nmdc:mga00v17_17042_c1
743 nmdc:mga00v17_22241_c1
744 nmdc:mga00v17_85138_c1
745 nmdc:mga0yw44_2380_c1
746 nmdc:mga0yw44_9850_c1
747 nmdc:mga06z11_3184_c1
748 nmdc:mga04h51_11193_c1
749 nmdc:mga07m45_80214_c1
750 nmdc:mga0qj67_184323_c1
751 nmdc:mga06r32_97532_c1
752 nmdc:mga0sz30_25644_c1
753 Ga0500635_0000012
754 Ga0500643_000425
755 Ga0500556_0000001
756 Ga0500652_022522
757 Ga0500568_0000006
758 Ga0500568_0000014
759 Ga0500568_0001140
760 Ga0500568_0005214
761 Ga0500573_0026668
762 Ga0500616_0000021
763 Ga0500616_0000125
764 Ga0500620_000008
765 Ga0501084_0093958
766 Ga0501084_0151313
767 Ga0587084_010586
768 Ga0587115_015193
769 2588108300
770 2643733523
771 2643752721
772 2643785984
773 2643848134
774 2643885179
775 2644096107
776 2644170098
777 2644183541
778 2644680399
779 2730229852
780 2747954286
781 2758226337
782 2774380728
783 2774384678
784 2774399766
785 2808631397
786 2808885448
787 2809227208
788 2812322898
789 2821269803
790 2833710726
791 2837273345
792 2844842519
793 2844855464
794 2852633411
795 2852645433
796 2852647475
797 2852663932
798 2852665403
799 2857721658
800 2857724028
801 2857732580
802 2857735635
803 2857737390
804 2868089033
805 2870630136
806 2884765473
807 2904512877
808 2908681154
809 2919058204
810 2919072968
811 2919398769
812 2919524578
813 2928092305
814 2928122922
815 2928156499
816 2939661022
817 2945971992
818 2946033630
819 2946044363
820 2946080791
821 2974296942
822 2974326826
823 2977231131
824 2977239924
825 2977253741
826 2977266381
827 2984545804
828 2984580919
829 8004185027
830 8004214098
831 8016257772
832 8055038549
833 8056037545
834 8057348691

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

70

323

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7678 23 282
7bpu-assembly1.cif.gz_A structural and mechanistic insights into the biosynthesis of digeranylgeranylglyceryl phosphate synthase in membranes 0.7198 23 282
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7057 34 281
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.6937 27 280
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.6596 26 279
ID Description Score Start End Superfamily
af_P9WFR7_30_178_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.931 34 158 1.10.357.140
af_P9WFR7_179_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.9305 160 285 1.20.120.550
af_P0AEA5_14_182_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9183 35 178 1.10.357.140
af_Q2G2B9_23_180_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.9173 59 159 1.10.357.140
af_Q57727_161_283_1.20.120.1780 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);UbiA prenyltransferase 0.8997 160 282 1.20.120.1780
ID Description Score Start End GO Terms
AF-A0A2N3GL48-F1-model_v4 deleted 0.9977 167 286
AF-A0A3B8MRL2-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9911 141 286 GO:0005886
GO:0006783
GO:0008495
AF-A0A2N3GL48-F1-model_v4 deleted 0.9895 167 286
AF-A0A212T184-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9835 23 282 GO:0005886
GO:0008495
GO:0048034
AF-A0A1V2IFU4-F1-model_v4 Protoheme IX farnesyltransferase (EC 2.5.1.141) (Heme B farnesyltransferase) (Heme O synthase) 0.9807 15 284 GO:0005886
GO:0008495
GO:0048034

Map