F438992

General Info

Members Datasets Scaffolds Average Seq Length
417 200 834 293

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100009169|Ga0070706_1000091691
Length 337
Sequence VAQFADGMGHSPARVRARPEKGGRRMMQRPDVSIIVVSTNNRGDLLANLPAVADGSDELIVVDNGSSDGSPDLVRELAPRARVVELDKNVGFGAANNEGMIVASGRYFLLVNPDARPLGDAIERLVAFADAHPEVGVAGPKLLNADGSLQRSIRGYPTAWWGGRPPRRAPRLSMFFFARRWITGRAGXXXEQQENRRRPLRNEWLKGAVLLLRREAVDKVGGFDSDFFIYNEELDLCYRMSEAGWTIELVPEATFVHVGGTTTARMAPRAYRELLRGHLRMLAKHRSPTHAEHARRYLALVLRFRALLSRGDMRRLYGDGARWLSSGDVQALLRGEG

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
80 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
89 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
90 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
91 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
100 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
106 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
107 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
108 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
109 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
110 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
111 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
112 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
113 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
114 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
115 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
119 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
120 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
129 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
135 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
197 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
198 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
200 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.03
Rhizosphere 87.77
Stem 0
Stem Tuber 0
Unclassified 7.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100009169 3300005467 Bacteria 9212
2 Ga0070658_10036574 3300005327 Bacteria 3957
3 Ga0070658_10229995 3300005327 Bacteria 1570
4 Ga0070658_10348424 3300005327 Bacteria 1267
5 Ga0070683_100122190 3300005329 Bacteria 2460
6 Ga0070680_100017672 3300005336 Bacteria 5626
7 Ga0070680_100035378 3300005336 Bacteria 4031
8 Ga0070680_100045600 3300005336 Unclassified 3565
9 Ga0070682_100031052 3300005337 Bacteria 3229
10 Ga0068868_100496077 3300005338 Bacteria 1069
11 Ga0070660_100000839 3300005339 Bacteria 20439
12 Ga0070660_100006743 3300005339 Bacteria 7966
13 Ga0070660_100027483 3300005339 Bacteria 4246
14 Ga0070660_100227379 3300005339 Bacteria 1517
15 Ga0070660_100368361 3300005339 Bacteria 1185
16 Ga0070661_100038239 3300005344 Bacteria 3492
17 Ga0070661_100047701 3300005344 Bacteria 3135
18 Ga0070661_100273936 3300005344 Bacteria 1308
19 Ga0070659_100096861 3300005366 Bacteria 2370
20 Ga0070659_100494866 3300005366 Bacteria 1042
21 Ga0070667_100106069 3300005367 Unclassified 2432
22 Ga0070714_100352872 3300005435 Bacteria 1382
23 Ga0070713_100267348 3300005436 Unclassified 1565
24 Ga0070713_100341193 3300005436 Bacteria 1388
25 Ga0070711_100027337 3300005439 Bacteria 3745
26 Ga0070711_100063986 3300005439 Bacteria 2569
27 Ga0070694_100181237 3300005444 Bacteria 1558
28 Ga0070708_100034554 3300005445 Unclassified 4399
29 Ga0070681_10001932 3300005458 Bacteria 18705
30 Ga0070681_10005682 3300005458 Bacteria 12054
31 Ga0070681_10084763 3300005458 Unclassified 3121
32 Ga0070681_10159723 3300005458 Bacteria 2178
33 Ga0070681_10201116 3300005458 Bacteria 1910
34 Ga0070681_10204396 3300005458 Bacteria 1893
35 Ga0068867_100298501 3300005459 Bacteria 1327
36 Ga0070707_100001140 3300005468 Bacteria 26182
37 Ga0070698_100088906 3300005471 Bacteria 3073
38 Ga0070699_100093395 3300005518 Bacteria 2632
39 Ga0070679_100014057 3300005530 Bacteria 7677
40 Ga0070679_100016515 3300005530 Bacteria 7125
41 Ga0070679_100059792 3300005530 Bacteria 3798
42 Ga0070679_100060100 3300005530 Bacteria 3787
43 Ga0070679_100111223 3300005530 Bacteria 2725
44 Ga0070679_100368916 3300005530 Bacteria 1383
45 Ga0070684_100005208 3300005535 Bacteria 9944
46 Ga0070684_100267273 3300005535 Bacteria 1565
47 Ga0068853_100287647 3300005539 Bacteria 1516
48 Ga0070696_100041065 3300005546 Bacteria 3195
49 Ga0070665_100107098 3300005548 Bacteria 2797
50 Ga0068855_100018915 3300005563 Bacteria 8279
51 Ga0068855_100114134 3300005563 Bacteria 3097
52 Ga0068855_100117643 3300005563 Bacteria 3044
53 Ga0068855_100164927 3300005563 Bacteria 2512
54 Ga0068855_100228111 3300005563 Bacteria 2086
55 Ga0068855_100311718 3300005563 Bacteria 1741
56 Ga0068855_100441682 3300005563 Bacteria 1421
57 Ga0070664_100109116 3300005564 Bacteria 2414
58 Ga0068857_100035278 3300005577 Bacteria 4429
59 Ga0068857_100135487 3300005577 Bacteria 2223
60 Ga0068856_100034663 3300005614 Bacteria 4943
61 Ga0068856_100233965 3300005614 Bacteria 1853
62 Ga0068856_100444216 3300005614 Bacteria 1317
63 Ga0068852_100028666 3300005616 Bacteria 4561
64 Ga0068852_100225607 3300005616 Bacteria 1784
65 Ga0068852_100583911 3300005616 Unclassified 1120
66 Ga0070716_100075483 3300006173 Bacteria 1995
67 Ga0070712_100027828 3300006175 Bacteria 3777
68 Ga0075428_100631706 3300006844 Bacteria 1143
69 Ga0075433_10015379 3300006852 Bacteria 6275
70 Ga0075434_100001349 3300006871 Bacteria 20608
71 Ga0075436_100100901 3300006914 Bacteria 2010
72 Ga0075435_100001647 3300007076 Bacteria 14485
73 Ga0105240_10038035 3300009093 Bacteria 6177
74 Ga0105240_10068943 3300009093 Bacteria 4379
75 Ga0105240_10102401 3300009093 Bacteria 3480
76 Ga0105240_10148654 3300009093 Bacteria 2792
77 Ga0105245_10262188 3300009098 Bacteria 1682
78 Ga0105245_10406435 3300009098 Bacteria 1362
79 Ga0114129_10064187 3300009147 Bacteria 5124
80 Ga0105241_10185128 3300009174 Bacteria 1730
81 Ga0105237_10032907 3300009545 Bacteria 5250
82 Ga0105237_10212500 3300009545 Bacteria 1934
83 Ga0105237_10268643 3300009545 Unclassified 1709
84 Ga0105238_10152534 3300009551 Bacteria 2286
85 Ga0105238_10194644 3300009551 Unclassified 2003
86 Ga0105239_10200380 3300010375 Bacteria 2236
87 Ga0105239_10492510 3300010375 Bacteria 1393
88 Ga0157373_10138240 3300013100 Bacteria 1713
89 Ga0157370_10014920 3300013104 Bacteria 7924
90 Ga0157370_10045152 3300013104 Bacteria 4229
91 Ga0157370_10084056 3300013104 Bacteria 2992
92 Ga0157369_10000641 3300013105 Bacteria 45168
93 Ga0157369_10012689 3300013105 Bacteria 9556
94 Ga0157369_10090025 3300013105 Bacteria 3276
95 Ga0157369_10179312 3300013105 Bacteria 2229
96 Ga0157369_10298471 3300013105 Bacteria 1676
97 Ga0157374_10375990 3300013296 Bacteria 1415
98 Ga0157374_10519650 3300013296 Bacteria 1196
99 Ga0157372_10068244 3300013307 Bacteria 3997
100 Ga0157372_10107603 3300013307 Bacteria 3190
101 Ga0157372_10386003 3300013307 Bacteria 1632
102 Ga0157375_10376093 3300013308 Bacteria 1587
103 Ga0206356_10182918 3300020070 Unclassified 1437
104 Ga0206353_11006773 3300020082 Bacteria 2515
105 Ga0206353_11365894 3300020082 Bacteria 1616
106 Ga0206353_11829314 3300020082 Bacteria 7343
107 Ga0213876_10091223 3300021384 Bacteria 1614
108 Ga0207707_10044933 3300025912 Bacteria 3850
109 Ga0207707_10091998 3300025912 Bacteria 2651
110 Ga0207707_10108692 3300025912 Bacteria 2425
111 Ga0207707_10176744 3300025912 Bacteria 1865
112 Ga0207707_10212623 3300025912 Bacteria 1684
113 Ga0207707_10314117 3300025912 Bacteria 1354
114 Ga0207695_10088669 3300025913 Bacteria 3113
115 Ga0207695_10104997 3300025913 Bacteria 2813
116 Ga0207695_10113059 3300025913 Bacteria 2692
117 Ga0207693_10020553 3300025915 Bacteria 5250
118 Ga0207693_10085445 3300025915 Bacteria 2472
119 Ga0207663_10032052 3300025916 Bacteria 3116
120 Ga0207660_10022896 3300025917 Bacteria 4213
121 Ga0207660_10181804 3300025917 Unclassified 1633
122 Ga0207657_10000954 3300025919 Bacteria 30553
123 Ga0207657_10004419 3300025919 Bacteria 14875
124 Ga0207657_10022658 3300025919 Bacteria 5870
125 Ga0207657_10037322 3300025919 Bacteria 4340
126 Ga0207657_10061689 3300025919 Bacteria 3213
127 Ga0207657_10083624 3300025919 Bacteria 2677
128 Ga0207649_10021177 3300025920 Bacteria 3738
129 Ga0207649_10124694 3300025920 Bacteria 1741
130 Ga0207649_10193838 3300025920 Bacteria 1431
131 Ga0207652_10013259 3300025921 Bacteria 6676
132 Ga0207652_10066069 3300025921 Bacteria 3134
133 Ga0207652_10133860 3300025921 Unclassified 2212
134 Ga0207652_10379107 3300025921 Unclassified 1276
135 Ga0207646_10009165 3300025922 Bacteria 9815
136 Ga0207694_10085562 3300025924 Bacteria 2482
137 Ga0207687_10348172 3300025927 Bacteria 1206
138 Ga0207700_10010084 3300025928 Bacteria 5939
139 Ga0207700_10074115 3300025928 Bacteria 2632
140 Ga0207700_10108392 3300025928 Bacteria 2230
141 Ga0207700_10389536 3300025928 Unclassified 1220
142 Ga0207664_10396965 3300025929 Unclassified 1226
143 Ga0207644_10096230 3300025931 Bacteria 2216
144 Ga0207690_10040023 3300025932 Bacteria 3062
145 Ga0207690_10070108 3300025932 Bacteria 2414
146 Ga0207690_10311731 3300025932 Bacteria 1234
147 Ga0207669_10294327 3300025937 Bacteria 1231
148 Ga0207661_10032436 3300025944 Bacteria 4047
149 Ga0207661_10067484 3300025944 Bacteria 2909
150 Ga0207667_10044843 3300025949 Bacteria 4684
151 Ga0207667_10121875 3300025949 Bacteria 2687
152 Ga0207667_10185786 3300025949 Bacteria 2134
153 Ga0207658_10067864 3300025986 Unclassified 2688
154 Ga0207677_10403616 3300026023 Bacteria 1160
155 Ga0207639_10225090 3300026041 Bacteria 1622
156 Ga0207702_10199550 3300026078 Bacteria 1853
157 Ga0207674_10053008 3300026116 Bacteria 4135
158 Ga0207674_10083566 3300026116 Bacteria 3192
159 Ga0207674_10370667 3300026116 Bacteria 1384
160 Ga0207683_10636348 3300026121 Unclassified 988
161 Ga0207698_10037756 3300026142 Bacteria 3561
162 Ga0207698_10274990 3300026142 Bacteria 1555
163 Ga0265318_10033204 3300028577 Bacteria 1994
164 Ga0265338_10020475 3300028800 Bacteria 6956
165 Ga0265338_10023589 3300028800 Bacteria 6319
166 Ga0265327_10024589 3300031251 Bacteria 3532
167 Ga0307412_10039923 3300031911 Bacteria 3034
168 Ga0307416_100093477 3300032002 Bacteria 2590
169 Ga0307415_100041904 3300032126 Bacteria 3043
170 Ga0373936_0125819 3300035113 Bacteria 1098
171 Ga0373945_0016543 3300035116 Bacteria 2489
172 Ga0373945_0035482 3300035116 Bacteria 1782
173 Ga0373943_0000814 3300035170 Bacteria 13690
174 Ga0373943_0003226 3300035170 Bacteria 7403
175 Ga0373946_0122616 3300035171 Bacteria 1188
176 Ga0373924_0061535 3300035410 Bacteria 1571
177 Ga0373935_0146185 3300035692 Bacteria 1600
178 Ga0373927_0041138 3300035695 Bacteria 2998
179 Ga0373927_0155827 3300035695 Bacteria 1496
180 Ga0373933_0048001 3300035724 Bacteria 2541
181 Ga0373947_0007484 3300035725 Bacteria 6319
182 Ga0373937_0147054 3300036401 Bacteria 2206
183 Ga0373925_0003734 3300037068 Bacteria 11691
184 Ga0395899_0098460 3300037312 Unclassified 2113
185 Ga0395899_0121895 3300037312 Bacteria 1867
186 Ga0395899_0140505 3300037312 Bacteria 1718
187 Ga0395900_0037516 3300037418 Bacteria 4996
188 Ga0395900_0118759 3300037418 Bacteria 2714
189 Ga0395900_0294943 3300037418 Bacteria 1609
190 Ga0395900_0313801 3300037418 Bacteria 1550
191 Ga0395900_0458968 3300037418 Unclassified 1229
192 Ga0395898_0004479 3300037466 Bacteria 15275
193 Ga0395898_0009918 3300037466 Bacteria 9976
194 Ga0395898_0094833 3300037466 Bacteria 2867
195 Ga0395905_0069036 3300037471 Bacteria 3310
196 Ga0395905_0237402 3300037471 Bacteria 1704
197 Ga0395905_0257323 3300037471 Bacteria 1630
198 Ga0395905_0302902 3300037471 Bacteria 1486
199 Ga0436364_1486331 3300037853 Bacteria 3467
200 Ga0395901_0055201 3300038443 Bacteria 4130
201 Ga0395901_0063609 3300038443 Bacteria 3840
202 Ga0395901_0205630 3300038443 Bacteria 2063
203 Ga0395901_0243405 3300038443 Bacteria 1875
204 Ga0395901_0245736 3300038443 Bacteria 1865
205 Ga0395901_0381429 3300038443 Bacteria 1451
206 Ga0395901_0493888 3300038443 Bacteria 1247
207 Ga0395901_0753172 3300038443 Bacteria 967
208 Ga0436365_0437067 3300039437 Bacteria 5097
209 Ga0436365_0747109 3300039437 Bacteria 2157
210 Ga0436360_1255887 3300039438 Bacteria 7230
211 Ga0436363_0390910 3300039450 Bacteria 1351
212 Ga0436362_0722336 3300039453 Bacteria 1547
213 Ga0466969_0038038 3300044656 Bacteria 2424
214 Ga0466972_0057180 3300044658 Bacteria 1874
215 Ga0466966_0016931 3300044684 Bacteria 4818
216 Ga0466966_0023625 3300044684 Bacteria 4024
217 Ga0466961_0015130 3300044693 Bacteria 4952
218 Ga0466961_0069456 3300044693 Bacteria 2236
219 Ga0466961_0231133 3300044693 Unclassified 1138
220 Ga0466963_0001075 3300044694 Bacteria 14257
221 Ga0466963_0002437 3300044694 Bacteria 10407
222 Ga0466963_0019435 3300044694 Bacteria 4262
223 Ga0466963_0058068 3300044694 Bacteria 2579
224 Ga0466963_0101171 3300044694 Bacteria 1973
225 Ga0466963_0179897 3300044694 Bacteria 1476
226 Ga0466963_0251598 3300044694 Bacteria 1240
227 Ga0466964_0000875 3300044706 Bacteria 9862
228 Ga0466971_0000066 3300044719 Bacteria 39780
229 Ga0466971_0026128 3300044719 Bacteria 2609
230 Ga0466968_0002530 3300044735 Bacteria 6722
231 Ga0466970_0023359 3300044765 Bacteria 3228
232 Ga0466970_0109212 3300044765 Bacteria 1510
233 Ga0466957_0000016 3300044842 Bacteria 66255
234 Ga0466957_0067961 3300044842 Bacteria 2199
235 Ga0466960_0046469 3300044901 Bacteria 2079
236 Ga0466959_0005909 3300045049 Bacteria 8429
237 Ga0466959_0020088 3300045049 Bacteria 4918
238 Ga0466959_0058957 3300045049 Bacteria 2796
239 Ga0466958_0000822 3300045836 Bacteria 13714
240 Ga0466958_0036695 3300045836 Bacteria 2935
241 Ga0466958_0040664 3300045836 Bacteria 2794
242 Ga0466958_0120521 3300045836 Bacteria 1642
243 Ga0466967_0001616 3300045976 Bacteria 13299
244 Ga0466967_0013952 3300045976 Bacteria 6235
245 Ga0466967_0040303 3300045976 Bacteria 4020
246 Ga0466967_0062718 3300045976 Bacteria 3300
247 Ga0466967_0087783 3300045976 Bacteria 2820
248 Ga0466967_0089555 3300045976 Bacteria 2794
249 Ga0466967_0108501 3300045976 Bacteria 2547
250 Ga0466967_0138342 3300045976 Bacteria 2266
251 Ga0466967_0191334 3300045976 Bacteria 1934
252 Ga0466967_0258244 3300045976 Bacteria 1666
253 Ga0466967_0429766 3300045976 Bacteria 1288
254 Ga0466967_0519203 3300045976 Bacteria 1170
255 Ga0466967_0555883 3300045976 Bacteria 1130
256 Ga0495592_0033603 3300046454 Bacteria 3868
257 Ga0495603_0056173 3300046455 Bacteria 2331
258 Ga0495629_0019264 3300046459 Bacteria 4877
259 Ga0495629_0112370 3300046459 Bacteria 1899
260 Ga0495629_0151966 3300046459 Bacteria 1609
261 Ga0495629_0229554 3300046459 Bacteria 1279
262 Ga0495641_0002293 3300046461 Bacteria 15222
263 Ga0495641_0024112 3300046461 Bacteria 3008
264 Ga0495641_0051303 3300046461 Bacteria 1884
265 Ga0495651_0008052 3300046462 Bacteria 8082
266 Ga0495651_0058554 3300046462 Unclassified 2956
267 Ga0495651_0302399 3300046462 Unclassified 1072
268 Ga0495653_0030508 3300046463 Bacteria 4293
269 Ga0495582_0000466 3300046473 Bacteria 22163
270 Ga0495639_0011301 3300046475 Bacteria 3847
271 Ga0495662_0005245 3300046476 Bacteria 6495
272 Ga0495664_0029012 3300046477 Bacteria 3234
273 Ga0495608_0050628 3300046511 Bacteria 2755
274 Ga0495618_0337259 3300046514 Bacteria 931
275 Ga0495630_0051198 3300046517 Bacteria 3091
276 Ga0495630_0063661 3300046517 Bacteria 2770
277 Ga0495630_0367509 3300046517 Unclassified 1101
278 Ga0495630_0470822 3300046517 Bacteria 963
279 Ga0495666_0043525 3300046526 Unclassified 2169
280 Ga0495652_0011112 3300046529 Bacteria 8157
281 Ga0495652_0083702 3300046529 Bacteria 2625
282 Ga0495665_0003184 3300046531 Bacteria 8890
283 Ga0495586_0015269 3300046535 Bacteria 4085
284 Ga0495586_0209995 3300046535 Bacteria 1105
285 Ga0495587_0040798 3300046536 Bacteria 2772
286 Ga0495667_0005840 3300046559 Bacteria 8339
287 Ga0495667_0139712 3300046559 Archaea 1561
288 Ga0495667_0147733 3300046559 Bacteria 1514
289 Ga0495667_0202689 3300046559 Bacteria 1269
290 Ga0495634_0017631 3300046642 Bacteria 5093
291 Ga0495634_0090757 3300046642 Bacteria 1984
292 Ga0495634_0254113 3300046642 Bacteria 1074
293 Ga0495635_0051387 3300046663 Bacteria 2840
294 Ga0495657_0018187 3300046675 Bacteria 5091
295 Ga0495657_0025293 3300046675 Bacteria 4219
296 Ga0495599_0019703 3300046678 Bacteria 4205
297 Ga0495599_0088785 3300046678 Bacteria 1930
298 Ga0495623_0010404 3300046679 Bacteria 6020
299 Ga0495646_0096292 3300046680 Unclassified 1702
300 Ga0495647_0002956 3300046681 Bacteria 5392
301 Ga0495647_0025800 3300046681 Unclassified 2149
302 Ga0495658_0001410 3300046683 Bacteria 12622
303 Ga0495613_0003414 3300046689 Bacteria 11871
304 Ga0495613_0028106 3300046689 Bacteria 4184
305 Ga0495613_0163688 3300046689 Bacteria 1581
306 Ga0495624_0005202 3300046690 Bacteria 9405
307 Ga0495600_0033004 3300046809 Bacteria 3360
308 Ga0495581_0002504 3300047315 Bacteria 10424
309 Ga0495604_0053296 3300047317 Bacteria 3127
310 Ga0495674_0008669 3300047319 Bacteria 9670
311 Ga0495674_0060739 3300047319 Bacteria 3297
312 Ga0495674_0092961 3300047319 Bacteria 2574
313 Ga0495674_0156415 3300047319 Bacteria 1909
314 Ga0495676_0000951 3300047321 Bacteria 24308
315 Ga0495676_0003369 3300047321 Bacteria 14440
316 Ga0495680_0020436 3300047322 Bacteria 5571
317 Ga0495680_0022295 3300047322 Bacteria 5281
318 Ga0495680_0025844 3300047322 Bacteria 4854
319 Ga0495680_0068628 3300047322 Bacteria 2707
320 Ga0495680_0108274 3300047322 Bacteria 2063
321 Ga0495680_0321091 3300047322 Bacteria 1084
322 Ga0495675_0106482 3300047444 Bacteria 1752
323 Ga0495684_0012774 3300047471 Bacteria 6480
324 Ga0495684_0027244 3300047471 Bacteria 4388
325 Ga0495593_0177837 3300047673 Bacteria 1072
326 Ga0495602_0097042 3300048088 Bacteria 2429
327 Ga0495614_0003440 3300048089 Bacteria 7085
328 Ga0495614_0044433 3300048089 Bacteria 1906
329 Ga0496100_0045013 3300048903 Bacteria 2830
330 Ga0496100_0064695 3300048903 Bacteria 2421
331 Ga0496100_0101959 3300048903 Bacteria 1979
332 Ga0496100_0121335 3300048903 Unclassified 1829
333 Ga0496101_0003229 3300048904 Bacteria 10115
334 Ga0496101_0031393 3300048904 Bacteria 3734
335 Ga0496101_0040709 3300048904 Bacteria 3310
336 Ga0496101_0233826 3300048904 Bacteria 1429
337 Ga0496102_0012810 3300048905 Bacteria 7259
338 Ga0496102_0254228 3300048905 Bacteria 1657
339 Ga0496103_0024627 3300048906 Bacteria 3633
340 Ga0496104_0002890 3300048907 Bacteria 14795
341 Ga0496104_0007147 3300048907 Bacteria 9840
342 Ga0496104_0227970 3300048907 Unclassified 1775
343 Ga0496104_0415070 3300048907 Bacteria 1258
344 Ga0496105_0011295 3300048908 Bacteria 7050
345 Ga0496105_0020604 3300048908 Bacteria 5330
346 Ga0496105_0170277 3300048908 Bacteria 1786
347 Ga0496105_0328917 3300048908 Bacteria 1224
348 Ga0496106_0020295 3300048909 Bacteria 4931
349 Ga0496106_0023748 3300048909 Bacteria 4556
350 Ga0496107_0007519 3300048910 Bacteria 7517
351 Ga0496108_0141493 3300048911 Bacteria 2073
352 Ga0496108_0270392 3300048911 Bacteria 1479
353 Ga0496108_0407667 3300048911 Bacteria 1187
354 Ga0496109_0003222 3300048912 Bacteria 13592
355 Ga0496109_0146962 3300048912 Bacteria 2206
356 Ga0496109_0486418 3300048912 Bacteria 1165
357 Ga0496110_0009157 3300048913 Bacteria 7996
358 Ga0496110_0298696 3300048913 Bacteria 1467
359 Ga0496111_0075990 3300048914 Bacteria 2448
360 Ga0496111_0076240 3300048914 Bacteria 2444
361 Ga0496112_0072491 3300048915 Bacteria 3405
362 Ga0496112_0092547 3300048915 Bacteria 2993
363 Ga0496112_0221254 3300048915 Bacteria 1849
364 Ga0496112_0339474 3300048915 Bacteria 1446
365 Ga0496113_0055424 3300048916 Bacteria 2972
366 Ga0496113_0214805 3300048916 Bacteria 1532
367 Ga0496114_0011805 3300048917 Bacteria 6990
368 Ga0496114_0029332 3300048917 Bacteria 4521
369 Ga0496114_0055077 3300048917 Bacteria 3316
370 Ga0496114_0150037 3300048917 Bacteria 2022
371 Ga0496115_0004556 3300048918 Bacteria 10030
372 Ga0496115_0007390 3300048918 Bacteria 8083
373 Ga0496115_0026201 3300048918 Bacteria 4548
374 Ga0496115_0215857 3300048918 Bacteria 1584
375 Ga0501034_0027510 3300049571 Bacteria 5786
376 Ga0501040_0191618 3300049576 Bacteria 1451
377 Ga0501046_0095493 3300049580 Bacteria 2284
378 Ga0501047_0142642 3300049581 Bacteria 2273
379 Ga0501047_0351337 3300049581 Bacteria 1311
380 Ga0501067_0002140 3300049583 Bacteria 10873
381 Ga0501067_0004316 3300049583 Bacteria 7832
382 Ga0501069_0114271 3300049585 Bacteria 1539
383 Ga0501070_0000124 3300049586 Bacteria 68928
384 Ga0501070_0079483 3300049586 Bacteria 2714
385 Ga0501070_0174704 3300049586 Unclassified 1769
386 Ga0501070_0363858 3300049586 Bacteria 1173
387 Ga0501072_0330695 3300049588 Bacteria 1211
388 Ga0501074_0127119 3300049590 Bacteria 1824
389 Ga0501077_0028856 3300049593 Bacteria 3527
390 Ga0501079_0033339 3300049741 Bacteria 3962
391 Ga0501079_0064576 3300049741 Bacteria 2824
392 Ga0501080_0097425 3300049742 Bacteria 2731
393 Ga0501080_0134372 3300049742 Bacteria 2290
394 Ga0501044_0274610 3300049823 Bacteria 1620
395 Ga0501045_0130903 3300049824 Bacteria 1865
396 nmdc:mga05p37_39036_c1 3300050507 Bacteria 4091
397 nmdc:mga08y16_521080_c1 3300050511 Bacteria 1205
398 nmdc:mga0n895_17475_c1 3300050512 Bacteria 6610
399 nmdc:mga0rr50_161433_c1 3300050513 Bacteria 1819
400 nmdc:mga0rr50_4298_c1 3300050513 Bacteria 8343
401 nmdc:mga0a205_207252_c1 3300050515 Unclassified 1849
402 nmdc:mga0a205_3107_c1 3300050515 Bacteria 14728
403 Ga0495601_0055451 3300053077 Bacteria 2509
404 Ga0495601_0063668 3300053077 Bacteria 2344
405 Ga0495595_0009371 3300053084 Bacteria 4049
406 Ga0495595_0026562 3300053084 Bacteria 2573
407 Ga0495619_0012964 3300053085 Bacteria 5251
408 Ga0495619_0033719 3300053085 Bacteria 3326
409 Ga0495619_0065564 3300053085 Bacteria 2423
410 Ga0495619_0066767 3300053085 Unclassified 2400
411 Ga0495619_0084608 3300053085 Bacteria 2141
412 Ga0495619_0185004 3300053085 Bacteria 1441
413 Ga0501082_0269022 3300060353 Bacteria 1483
414 Ga0466962_0000960 3300061719 Bacteria 13098
415 Ga0530510_0024225 3300061734 Bacteria 4330
416 Ga0530510_0076831 3300061734 Bacteria 2427
417 Ga0530510_0289626 3300061734 Bacteria 1224
418 Ga0070706_100009169
419 Ga0070658_10036574
420 Ga0070658_10229995
421 Ga0070658_10348424
422 Ga0070683_100122190
423 Ga0070680_100017672
424 Ga0070680_100035378
425 Ga0070680_100045600
426 Ga0070682_100031052
427 Ga0068868_100496077
428 Ga0070660_100000839
429 Ga0070660_100006743
430 Ga0070660_100027483
431 Ga0070660_100227379
432 Ga0070660_100368361
433 Ga0070661_100038239
434 Ga0070661_100047701
435 Ga0070661_100273936
436 Ga0070659_100096861
437 Ga0070659_100494866
438 Ga0070667_100106069
439 Ga0070714_100352872
440 Ga0070713_100267348
441 Ga0070713_100341193
442 Ga0070711_100027337
443 Ga0070711_100063986
444 Ga0070694_100181237
445 Ga0070708_100034554
446 Ga0070681_10001932
447 Ga0070681_10005682
448 Ga0070681_10084763
449 Ga0070681_10159723
450 Ga0070681_10201116
451 Ga0070681_10204396
452 Ga0068867_100298501
453 Ga0070707_100001140
454 Ga0070698_100088906
455 Ga0070699_100093395
456 Ga0070679_100014057
457 Ga0070679_100016515
458 Ga0070679_100059792
459 Ga0070679_100060100
460 Ga0070679_100111223
461 Ga0070679_100368916
462 Ga0070684_100005208
463 Ga0070684_100267273
464 Ga0068853_100287647
465 Ga0070696_100041065
466 Ga0070665_100107098
467 Ga0068855_100018915
468 Ga0068855_100114134
469 Ga0068855_100117643
470 Ga0068855_100164927
471 Ga0068855_100228111
472 Ga0068855_100311718
473 Ga0068855_100441682
474 Ga0070664_100109116
475 Ga0068857_100035278
476 Ga0068857_100135487
477 Ga0068856_100034663
478 Ga0068856_100233965
479 Ga0068856_100444216
480 Ga0068852_100028666
481 Ga0068852_100225607
482 Ga0068852_100583911
483 Ga0070716_100075483
484 Ga0070712_100027828
485 Ga0075428_100631706
486 Ga0075433_10015379
487 Ga0075434_100001349
488 Ga0075436_100100901
489 Ga0075435_100001647
490 Ga0105240_10038035
491 Ga0105240_10068943
492 Ga0105240_10102401
493 Ga0105240_10148654
494 Ga0105245_10262188
495 Ga0105245_10406435
496 Ga0114129_10064187
497 Ga0105241_10185128
498 Ga0105237_10032907
499 Ga0105237_10212500
500 Ga0105237_10268643
501 Ga0105238_10152534
502 Ga0105238_10194644
503 Ga0105239_10200380
504 Ga0105239_10492510
505 Ga0157373_10138240
506 Ga0157370_10014920
507 Ga0157370_10045152
508 Ga0157370_10084056
509 Ga0157369_10000641
510 Ga0157369_10012689
511 Ga0157369_10090025
512 Ga0157369_10179312
513 Ga0157369_10298471
514 Ga0157374_10375990
515 Ga0157374_10519650
516 Ga0157372_10068244
517 Ga0157372_10107603
518 Ga0157372_10386003
519 Ga0157375_10376093
520 Ga0206356_10182918
521 Ga0206353_11006773
522 Ga0206353_11365894
523 Ga0206353_11829314
524 Ga0213876_10091223
525 Ga0207707_10044933
526 Ga0207707_10091998
527 Ga0207707_10108692
528 Ga0207707_10176744
529 Ga0207707_10212623
530 Ga0207707_10314117
531 Ga0207695_10088669
532 Ga0207695_10104997
533 Ga0207695_10113059
534 Ga0207693_10020553
535 Ga0207693_10085445
536 Ga0207663_10032052
537 Ga0207660_10022896
538 Ga0207660_10181804
539 Ga0207657_10000954
540 Ga0207657_10004419
541 Ga0207657_10022658
542 Ga0207657_10037322
543 Ga0207657_10061689
544 Ga0207657_10083624
545 Ga0207649_10021177
546 Ga0207649_10124694
547 Ga0207649_10193838
548 Ga0207652_10013259
549 Ga0207652_10066069
550 Ga0207652_10133860
551 Ga0207652_10379107
552 Ga0207646_10009165
553 Ga0207694_10085562
554 Ga0207687_10348172
555 Ga0207700_10010084
556 Ga0207700_10074115
557 Ga0207700_10108392
558 Ga0207700_10389536
559 Ga0207664_10396965
560 Ga0207644_10096230
561 Ga0207690_10040023
562 Ga0207690_10070108
563 Ga0207690_10311731
564 Ga0207669_10294327
565 Ga0207661_10032436
566 Ga0207661_10067484
567 Ga0207667_10044843
568 Ga0207667_10121875
569 Ga0207667_10185786
570 Ga0207658_10067864
571 Ga0207677_10403616
572 Ga0207639_10225090
573 Ga0207702_10199550
574 Ga0207674_10053008
575 Ga0207674_10083566
576 Ga0207674_10370667
577 Ga0207683_10636348
578 Ga0207698_10037756
579 Ga0207698_10274990
580 Ga0265318_10033204
581 Ga0265338_10020475
582 Ga0265338_10023589
583 Ga0265327_10024589
584 Ga0307412_10039923
585 Ga0307416_100093477
586 Ga0307415_100041904
587 Ga0373936_0125819
588 Ga0373945_0016543
589 Ga0373945_0035482
590 Ga0373943_0000814
591 Ga0373943_0003226
592 Ga0373946_0122616
593 Ga0373924_0061535
594 Ga0373935_0146185
595 Ga0373927_0041138
596 Ga0373927_0155827
597 Ga0373933_0048001
598 Ga0373947_0007484
599 Ga0373937_0147054
600 Ga0373925_0003734
601 Ga0395899_0098460
602 Ga0395899_0121895
603 Ga0395899_0140505
604 Ga0395900_0037516
605 Ga0395900_0118759
606 Ga0395900_0294943
607 Ga0395900_0313801
608 Ga0395900_0458968
609 Ga0395898_0004479
610 Ga0395898_0009918
611 Ga0395898_0094833
612 Ga0395905_0069036
613 Ga0395905_0237402
614 Ga0395905_0257323
615 Ga0395905_0302902
616 Ga0436364_1486331
617 Ga0395901_0055201
618 Ga0395901_0063609
619 Ga0395901_0205630
620 Ga0395901_0243405
621 Ga0395901_0245736
622 Ga0395901_0381429
623 Ga0395901_0493888
624 Ga0395901_0753172
625 Ga0436365_0437067
626 Ga0436365_0747109
627 Ga0436360_1255887
628 Ga0436363_0390910
629 Ga0436362_0722336
630 Ga0466969_0038038
631 Ga0466972_0057180
632 Ga0466966_0016931
633 Ga0466966_0023625
634 Ga0466961_0015130
635 Ga0466961_0069456
636 Ga0466961_0231133
637 Ga0466963_0001075
638 Ga0466963_0002437
639 Ga0466963_0019435
640 Ga0466963_0058068
641 Ga0466963_0101171
642 Ga0466963_0179897
643 Ga0466963_0251598
644 Ga0466964_0000875
645 Ga0466971_0000066
646 Ga0466971_0026128
647 Ga0466968_0002530
648 Ga0466970_0023359
649 Ga0466970_0109212
650 Ga0466957_0000016
651 Ga0466957_0067961
652 Ga0466960_0046469
653 Ga0466959_0005909
654 Ga0466959_0020088
655 Ga0466959_0058957
656 Ga0466958_0000822
657 Ga0466958_0036695
658 Ga0466958_0040664
659 Ga0466958_0120521
660 Ga0466967_0001616
661 Ga0466967_0013952
662 Ga0466967_0040303
663 Ga0466967_0062718
664 Ga0466967_0087783
665 Ga0466967_0089555
666 Ga0466967_0108501
667 Ga0466967_0138342
668 Ga0466967_0191334
669 Ga0466967_0258244
670 Ga0466967_0429766
671 Ga0466967_0519203
672 Ga0466967_0555883
673 Ga0495592_0033603
674 Ga0495603_0056173
675 Ga0495629_0019264
676 Ga0495629_0112370
677 Ga0495629_0151966
678 Ga0495629_0229554
679 Ga0495641_0002293
680 Ga0495641_0024112
681 Ga0495641_0051303
682 Ga0495651_0008052
683 Ga0495651_0058554
684 Ga0495651_0302399
685 Ga0495653_0030508
686 Ga0495582_0000466
687 Ga0495639_0011301
688 Ga0495662_0005245
689 Ga0495664_0029012
690 Ga0495608_0050628
691 Ga0495618_0337259
692 Ga0495630_0051198
693 Ga0495630_0063661
694 Ga0495630_0367509
695 Ga0495630_0470822
696 Ga0495666_0043525
697 Ga0495652_0011112
698 Ga0495652_0083702
699 Ga0495665_0003184
700 Ga0495586_0015269
701 Ga0495586_0209995
702 Ga0495587_0040798
703 Ga0495667_0005840
704 Ga0495667_0139712
705 Ga0495667_0147733
706 Ga0495667_0202689
707 Ga0495634_0017631
708 Ga0495634_0090757
709 Ga0495634_0254113
710 Ga0495635_0051387
711 Ga0495657_0018187
712 Ga0495657_0025293
713 Ga0495599_0019703
714 Ga0495599_0088785
715 Ga0495623_0010404
716 Ga0495646_0096292
717 Ga0495647_0002956
718 Ga0495647_0025800
719 Ga0495658_0001410
720 Ga0495613_0003414
721 Ga0495613_0028106
722 Ga0495613_0163688
723 Ga0495624_0005202
724 Ga0495600_0033004
725 Ga0495581_0002504
726 Ga0495604_0053296
727 Ga0495674_0008669
728 Ga0495674_0060739
729 Ga0495674_0092961
730 Ga0495674_0156415
731 Ga0495676_0000951
732 Ga0495676_0003369
733 Ga0495680_0020436
734 Ga0495680_0022295
735 Ga0495680_0025844
736 Ga0495680_0068628
737 Ga0495680_0108274
738 Ga0495680_0321091
739 Ga0495675_0106482
740 Ga0495684_0012774
741 Ga0495684_0027244
742 Ga0495593_0177837
743 Ga0495602_0097042
744 Ga0495614_0003440
745 Ga0495614_0044433
746 Ga0496100_0045013
747 Ga0496100_0064695
748 Ga0496100_0101959
749 Ga0496100_0121335
750 Ga0496101_0003229
751 Ga0496101_0031393
752 Ga0496101_0040709
753 Ga0496101_0233826
754 Ga0496102_0012810
755 Ga0496102_0254228
756 Ga0496103_0024627
757 Ga0496104_0002890
758 Ga0496104_0007147
759 Ga0496104_0227970
760 Ga0496104_0415070
761 Ga0496105_0011295
762 Ga0496105_0020604
763 Ga0496105_0170277
764 Ga0496105_0328917
765 Ga0496106_0020295
766 Ga0496106_0023748
767 Ga0496107_0007519
768 Ga0496108_0141493
769 Ga0496108_0270392
770 Ga0496108_0407667
771 Ga0496109_0003222
772 Ga0496109_0146962
773 Ga0496109_0486418
774 Ga0496110_0009157
775 Ga0496110_0298696
776 Ga0496111_0075990
777 Ga0496111_0076240
778 Ga0496112_0072491
779 Ga0496112_0092547
780 Ga0496112_0221254
781 Ga0496112_0339474
782 Ga0496113_0055424
783 Ga0496113_0214805
784 Ga0496114_0011805
785 Ga0496114_0029332
786 Ga0496114_0055077
787 Ga0496114_0150037
788 Ga0496115_0004556
789 Ga0496115_0007390
790 Ga0496115_0026201
791 Ga0496115_0215857
792 Ga0501034_0027510
793 Ga0501040_0191618
794 Ga0501046_0095493
795 Ga0501047_0142642
796 Ga0501047_0351337
797 Ga0501067_0002140
798 Ga0501067_0004316
799 Ga0501069_0114271
800 Ga0501070_0000124
801 Ga0501070_0079483
802 Ga0501070_0174704
803 Ga0501070_0363858
804 Ga0501072_0330695
805 Ga0501074_0127119
806 Ga0501077_0028856
807 Ga0501079_0033339
808 Ga0501079_0064576
809 Ga0501080_0097425
810 Ga0501080_0134372
811 Ga0501044_0274610
812 Ga0501045_0130903
813 nmdc:mga05p37_39036_c1
814 nmdc:mga08y16_521080_c1
815 nmdc:mga0n895_17475_c1
816 nmdc:mga0rr50_161433_c1
817 nmdc:mga0rr50_4298_c1
818 nmdc:mga0a205_207252_c1
819 nmdc:mga0a205_3107_c1
820 Ga0495601_0055451
821 Ga0495601_0063668
822 Ga0495595_0009371
823 Ga0495595_0026562
824 Ga0495619_0012964
825 Ga0495619_0033719
826 Ga0495619_0065564
827 Ga0495619_0066767
828 Ga0495619_0084608
829 Ga0495619_0185004
830 Ga0501082_0269022
831 Ga0466962_0000960
832 Ga0530510_0024225
833 Ga0530510_0076831
834 Ga0530510_0289626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

33

183

0.91

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

107

310

0.82

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

30

280

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7806 2 219
6p61-assembly2.cif.gz_B structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7768 2 219
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.7431 2 219
2z87-assembly3.cif.gz_B crystal structure of chondroitin polymerase from escherichia coli strain k4 (k4cp) complexed with udp-galnac and udp 0.7365 4 243
6p61-assembly3.cif.gz_C structure of a glycosyltransferase from leptospira borgpetersenii serovar hardjo-bovis (strain jb197) 0.736 2 219
ID Description Score Start End Superfamily
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9035 6 226 3.90.550.10
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8162 6 226 3.90.550.10
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7965 6 225 3.90.550.10
af_P9WMX1_74_289_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7915 4 224 3.90.550.10
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7586 6 225 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A2V2SRE3-F1-model_v4 deleted 0.9617 1 289
AF-A0A101GKH1-F1-model_v4 B-glycosyltransferase 0.958 5 208 GO:0016740
AF-A0A2V2SRE3-F1-model_v4 deleted 0.9521 1 289
AF-A0A4Q1CJ17-F1-model_v4 Glycosyltransferase 0.9498 5 267 GO:0016020
GO:0016740
AF-A0A5C8KBB9-F1-model_v4 Glycosyltransferase family 2 protein 0.9496 3 267 GO:0016740

Map