F438967

General Info

Members Datasets Scaffolds Average Seq Length
417 169 417 239

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10264455|Ga0070658_102644552
Length 241
Sequence MERVVYQQMAELDDRHWWYRARRRILADLIRREANLPRNARILEIGCGTGHNLPMLSGFGHVDGLELDDEAASLSEARLGRAILRSPLPELAGVADDYDLIGAFDVIEHIDDDHAALAAIATKLKPGGKFMMTVPAHPWMWTAHDVANHHKRRYSKHSLKALIQGSPMRLEKVGYFNSLLFPVAVAERAVSKLRGKDDGNVSLPPGPLNGALEAVFAAERYLIGRLPLPPGLSLFAVASAR

Samples

Sample ID Description Type Environment
1 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
135 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
136 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
167 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
168 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
169 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.76
Metatranscriptomes 0.24
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.72
Nodule 0
Rhizoplane 5.52
Rhizosphere 93.29
Stem 0
Stem Tuber 0
Unclassified 0.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002157 3300000549 Bacteria 2777
2 JGI24740J21852_10000892 3300001979 Bacteria 13217
3 JGI24740J21852_10007482 3300001979 Bacteria 4435
4 JGI24740J21852_10010884 3300001979 Bacteria 3481
5 JGI24740J21852_10026545 3300001979 Bacteria 1939
6 JGI24739J22299_10024527 3300001989 Bacteria 2126
7 JGI24737J22298_10004304 3300001990 Bacteria 4972
8 JGI24743J22301_10006343 3300001991 Bacteria 2012
9 JGI24738J21930_10000436 3300002075 Bacteria 11806
10 Ga0070658_10000013 3300005327 Bacteria 267776
11 Ga0070658_10000377 3300005327 Bacteria 38853
12 Ga0070658_10022380 3300005327 Bacteria 5071
13 Ga0070658_10053480 3300005327 Bacteria 3277
14 Ga0070658_10055811 3300005327 Bacteria 3210
15 Ga0070658_10264455 3300005327 Bacteria 1461
16 Ga0070683_100001819 3300005329 Bacteria 16631
17 Ga0070683_100029367 3300005329 Bacteria 4977
18 Ga0070683_100320412 3300005329 Bacteria 1475
19 Ga0070683_100596916 3300005329 Bacteria 1057
20 Ga0070690_100172028 3300005330 Bacteria 1491
21 Ga0070670_100034878 3300005331 Bacteria 4330
22 Ga0070670_100072720 3300005331 Bacteria 2953
23 Ga0070670_100110978 3300005331 Bacteria 2363
24 Ga0070666_10000779 3300005335 Bacteria 19305
25 Ga0070666_10018275 3300005335 Bacteria 4505
26 Ga0070680_100000683 3300005336 Bacteria 23493
27 Ga0070680_100243081 3300005336 Bacteria 1521
28 Ga0070682_100044278 3300005337 Bacteria 2755
29 Ga0068868_100001199 3300005338 Bacteria 17810
30 Ga0068868_100002196 3300005338 Bacteria 13465
31 Ga0068868_100014391 3300005338 Bacteria 5831
32 Ga0070660_100000986 3300005339 Bacteria 19065
33 Ga0070660_100010564 3300005339 Bacteria 6524
34 Ga0070660_100050030 3300005339 Bacteria 3215
35 Ga0070660_100066040 3300005339 Bacteria 2816
36 Ga0070660_100141429 3300005339 Bacteria 1931
37 Ga0070660_100281969 3300005339 Bacteria 1360
38 Ga0070660_100361823 3300005339 Bacteria 1196
39 Ga0070687_100065740 3300005343 Bacteria 1930
40 Ga0070661_100000187 3300005344 Bacteria 51095
41 Ga0070661_100002402 3300005344 Bacteria 12834
42 Ga0070661_100028793 3300005344 Bacteria 4008
43 Ga0070661_100063937 3300005344 Bacteria 2703
44 Ga0070661_100146267 3300005344 Bacteria 1784
45 Ga0070661_100259760 3300005344 Bacteria 1342
46 Ga0070692_10018163 3300005345 Bacteria 3376
47 Ga0070669_100155471 3300005353 Bacteria 1773
48 Ga0070675_100013554 3300005354 Bacteria 6410
49 Ga0070671_100114259 3300005355 Bacteria 2269
50 Ga0070671_100578795 3300005355 Bacteria 969
51 Ga0070674_100064458 3300005356 Bacteria 2568
52 Ga0070673_100013064 3300005364 Bacteria 5729
53 Ga0070673_100043024 3300005364 Bacteria 3487
54 Ga0070673_100136350 3300005364 Bacteria 2066
55 Ga0070659_100000191 3300005366 Bacteria 47035
56 Ga0070659_100019689 3300005366 Bacteria 5120
57 Ga0070659_100022501 3300005366 Bacteria 4813
58 Ga0070659_100031474 3300005366 Bacteria 4109
59 Ga0070659_100041187 3300005366 Bacteria 3609
60 Ga0070659_100055538 3300005366 Bacteria 3121
61 Ga0070659_100139562 3300005366 Bacteria 1973
62 Ga0070659_100169718 3300005366 Bacteria 1787
63 Ga0070659_100409325 3300005366 Bacteria 1146
64 Ga0070667_100001311 3300005367 Bacteria 22374
65 Ga0070667_100034211 3300005367 Bacteria 4250
66 Ga0070667_100039974 3300005367 Bacteria 3932
67 Ga0070667_100177796 3300005367 Bacteria 1881
68 Ga0070714_100011330 3300005435 Bacteria 7071
69 Ga0070714_100065447 3300005435 Bacteria 3130
70 Ga0070713_100185910 3300005436 Bacteria 1870
71 Ga0070694_100011806 3300005444 Bacteria 5415
72 Ga0070663_100008779 3300005455 Bacteria 6234
73 Ga0070678_100022790 3300005456 Bacteria 4159
74 Ga0070662_100000012 3300005457 Bacteria 129380
75 Ga0070662_100007787 3300005457 Bacteria 6960
76 Ga0070662_100014793 3300005457 Bacteria 5217
77 Ga0068867_100002136 3300005459 Bacteria 13892
78 Ga0068867_100075408 3300005459 Bacteria 2530
79 Ga0070685_10355482 3300005466 Bacteria 1003
80 Ga0070679_100219289 3300005530 Bacteria 1864
81 Ga0070684_100001770 3300005535 Bacteria 15761
82 Ga0070684_100014274 3300005535 Bacteria 6429
83 Ga0070684_100140127 3300005535 Bacteria 2186
84 Ga0070684_100891883 3300005535 Bacteria 833
85 Ga0068853_100000032 3300005539 Bacteria 114306
86 Ga0068853_101020797 3300005539 Bacteria 797
87 Ga0070672_100025804 3300005543 Bacteria 4365
88 Ga0070672_100046195 3300005543 Bacteria 3373
89 Ga0070672_100065378 3300005543 Bacteria 2877
90 Ga0070696_100019730 3300005546 Bacteria 4568
91 Ga0070693_100000332 3300005547 Bacteria 21624
92 Ga0070693_100043261 3300005547 Bacteria 2543
93 Ga0070693_100113428 3300005547 Bacteria 1671
94 Ga0070665_100012237 3300005548 Bacteria 8649
95 Ga0068855_100000591 3300005563 Bacteria 44412
96 Ga0068855_100225089 3300005563 Bacteria 2102
97 Ga0068855_100469244 3300005563 Bacteria 1371
98 Ga0070664_100000187 3300005564 Bacteria 43750
99 Ga0070664_100006340 3300005564 Bacteria 9544
100 Ga0070664_100363965 3300005564 Bacteria 1317
101 Ga0068857_100008946 3300005577 Bacteria 8676
102 Ga0068857_100025895 3300005577 Bacteria 5166
103 Ga0068857_100105412 3300005577 Bacteria 2531
104 Ga0068854_100012735 3300005578 Bacteria 5508
105 Ga0068854_100051468 3300005578 Bacteria 2951
106 Ga0068854_100387681 3300005578 Bacteria 1153
107 Ga0068856_100000291 3300005614 Bacteria 54890
108 Ga0068856_100038433 3300005614 Bacteria 4698
109 Ga0068856_100072026 3300005614 Bacteria 3422
110 Ga0068856_100589533 3300005614 Bacteria 1133
111 Ga0068856_100858988 3300005614 Bacteria 927
112 Ga0068852_100000906 3300005616 Bacteria 19629
113 Ga0068852_100005010 3300005616 Bacteria 9422
114 Ga0068852_100006826 3300005616 Bacteria 8292
115 Ga0068852_100017690 3300005616 Bacteria 5599
116 Ga0068852_100036120 3300005616 Bacteria 4131
117 Ga0068852_100327744 3300005616 Bacteria 1489
118 Ga0068852_100427676 3300005616 Bacteria 1307
119 Ga0068852_100436081 3300005616 Bacteria 1294
120 Ga0068852_100572595 3300005616 Bacteria 1131
121 Ga0068859_100027409 3300005617 Bacteria 5714
122 Ga0068859_100115050 3300005617 Bacteria 2754
123 Ga0068864_100043193 3300005618 Bacteria 3859
124 Ga0068866_10003404 3300005718 Bacteria 6519
125 Ga0068863_100034350 3300005841 Bacteria 4831
126 Ga0068858_100009881 3300005842 Bacteria 9065
127 Ga0068858_100014540 3300005842 Bacteria 7416
128 Ga0068858_100048438 3300005842 Bacteria 3938
129 Ga0068860_100998393 3300005843 Bacteria 855
130 Ga0081539_10030261 3300005985 Bacteria 3365
131 Ga0068871_100002654 3300006358 Bacteria 12217
132 Ga0068871_100196193 3300006358 Bacteria 1741
133 Ga0068865_100001550 3300006881 Bacteria 13415
134 Ga0097620_100027410 3300006931 Bacteria 5714
135 Ga0097620_100115059 3300006931 Bacteria 2754
136 Ga0105240_10046462 3300009093 Bacteria 5501
137 Ga0105240_10121253 3300009093 Bacteria 3148
138 Ga0105245_10006481 3300009098 Bacteria 10291
139 Ga0105245_10173741 3300009098 Bacteria 2053
140 Ga0105241_10008737 3300009174 Bacteria 7443
141 Ga0105241_10017822 3300009174 Bacteria 5223
142 Ga0105242_10013910 3300009176 Bacteria 6227
143 Ga0105248_10000083 3300009177 Bacteria 110619
144 Ga0105248_10001634 3300009177 Bacteria 24926
145 Ga0105248_10098985 3300009177 Bacteria 3285
146 Ga0105248_10135144 3300009177 Bacteria 2782
147 Ga0105248_11201724 3300009177 Bacteria 857
148 Ga0105248_11201851 3300009177 Bacteria 857
149 Ga0105237_10057388 3300009545 Bacteria 3897
150 Ga0105238_10024071 3300009551 Bacteria 6208
151 Ga0105238_10861457 3300009551 Bacteria 923
152 Ga0105239_10064163 3300010375 Bacteria 4032
153 Ga0157373_10054935 3300013100 Bacteria 2829
154 Ga0157373_10207500 3300013100 Bacteria 1381
155 Ga0157373_10264777 3300013100 Bacteria 1216
156 Ga0157373_10267393 3300013100 Bacteria 1210
157 Ga0157371_10006145 3300013102 Bacteria 9972
158 Ga0157370_10038383 3300013104 Bacteria 4632
159 Ga0157370_10119157 3300013104 Bacteria 2464
160 Ga0157370_10272787 3300013104 Bacteria 1563
161 Ga0157369_10001725 3300013105 Bacteria 26610
162 Ga0157369_10003749 3300013105 Bacteria 18058
163 Ga0157369_10246841 3300013105 Bacteria 1864
164 Ga0157374_10013104 3300013296 Bacteria 7232
165 Ga0157378_10011770 3300013297 Bacteria 7659
166 Ga0163162_11265476 3300013306 Bacteria 838
167 Ga0163162_11265477 3300013306 Bacteria 838
168 Ga0157372_10050356 3300013307 Bacteria 4633
169 Ga0157372_10275676 3300013307 Bacteria 1955
170 Ga0157372_10681344 3300013307 Bacteria 1197
171 Ga0157375_10048306 3300013308 Bacteria 4162
172 Ga0157375_10102083 3300013308 Bacteria 2952
173 Ga0157375_10467875 3300013308 Bacteria 1426
174 Ga0157375_11492946 3300013308 Bacteria 798
175 Ga0163163_10001064 3300014325 Bacteria 23319
176 Ga0163163_10076571 3300014325 Bacteria 3340
177 Ga0157379_10058776 3300014968 Bacteria 3438
178 Ga0157379_10185736 3300014968 Bacteria 1879
179 Ga0157379_10614806 3300014968 Bacteria 1015
180 Ga0157376_10013353 3300014969 Bacteria 6126
181 Ga0157376_10893382 3300014969 Unclassified 906
182 Ga0206353_11427135 3300020082 Bacteria 1271
183 Ga0213876_10000404 3300021384 Bacteria 36232
184 Ga0207656_10191811 3300025321 Bacteria 984
185 Ga0207642_10013757 3300025899 Bacteria 2962
186 Ga0207680_10002585 3300025903 Bacteria 8443
187 Ga0207680_10004399 3300025903 Bacteria 6681
188 Ga0207647_10001376 3300025904 Bacteria 18672
189 Ga0207647_10013301 3300025904 Bacteria 5710
190 Ga0207705_10000002 3300025909 Bacteria 2046852
191 Ga0207705_10000072 3300025909 Bacteria 126043
192 Ga0207705_10003045 3300025909 Bacteria 12785
193 Ga0207705_10011789 3300025909 Bacteria 6318
194 Ga0207705_10012016 3300025909 Bacteria 6255
195 Ga0207705_10026811 3300025909 Bacteria 4107
196 Ga0207705_10079772 3300025909 Bacteria 2384
197 Ga0207705_10100369 3300025909 Bacteria 2129
198 Ga0207705_10259600 3300025909 Bacteria 1326
199 Ga0207654_10113203 3300025911 Bacteria 1691
200 Ga0207660_10000522 3300025917 Bacteria 25663
201 Ga0207660_10162835 3300025917 Bacteria 1722
202 Ga0207657_10000176 3300025919 Bacteria 65856
203 Ga0207657_10007866 3300025919 Bacteria 10882
204 Ga0207657_10011747 3300025919 Bacteria 8674
205 Ga0207657_10016820 3300025919 Bacteria 7040
206 Ga0207657_10016910 3300025919 Bacteria 7018
207 Ga0207657_10018718 3300025919 Bacteria 6600
208 Ga0207657_10019167 3300025919 Bacteria 6506
209 Ga0207657_10067137 3300025919 Bacteria 3051
210 Ga0207657_10094442 3300025919 Bacteria 2490
211 Ga0207657_10118474 3300025919 Bacteria 2179
212 Ga0207657_10119465 3300025919 Bacteria 2169
213 Ga0207657_10126675 3300025919 Bacteria 2097
214 Ga0207649_10000810 3300025920 Bacteria 20093
215 Ga0207649_10021127 3300025920 Bacteria 3741
216 Ga0207649_10092749 3300025920 Bacteria 1980
217 Ga0207649_10107608 3300025920 Bacteria 1857
218 Ga0207694_10007666 3300025924 Bacteria 8175
219 Ga0207694_10048526 3300025924 Bacteria 3285
220 Ga0207650_10016610 3300025925 Bacteria 5146
221 Ga0207650_10050780 3300025925 Bacteria 3068
222 Ga0207650_10263513 3300025925 Bacteria 1398
223 Ga0207687_10005116 3300025927 Bacteria 8691
224 Ga0207687_10080044 3300025927 Bacteria 2357
225 Ga0207664_10121487 3300025929 Bacteria 2187
226 Ga0207644_10000243 3300025931 Bacteria 37412
227 Ga0207644_10009357 3300025931 Bacteria 6434
228 Ga0207644_10010524 3300025931 Bacteria 6098
229 Ga0207644_10032341 3300025931 Bacteria 3649
230 Ga0207690_10000245 3300025932 Bacteria 39464
231 Ga0207690_10002842 3300025932 Bacteria 10446
232 Ga0207690_10003756 3300025932 Bacteria 9003
233 Ga0207690_10022196 3300025932 Bacteria 3945
234 Ga0207690_10055627 3300025932 Bacteria 2666
235 Ga0207690_10065630 3300025932 Bacteria 2482
236 Ga0207690_10066840 3300025932 Bacteria 2464
237 Ga0207690_10140960 3300025932 Bacteria 1776
238 Ga0207690_10510460 3300025932 Bacteria 973
239 Ga0207706_10000041 3300025933 Bacteria 130090
240 Ga0207706_10003596 3300025933 Bacteria 14803
241 Ga0207706_10058262 3300025933 Bacteria 3402
242 Ga0207706_10080147 3300025933 Bacteria 2871
243 Ga0207706_10267005 3300025933 Bacteria 1494
244 Ga0207686_10022855 3300025934 Bacteria 3604
245 Ga0207669_10017591 3300025937 Bacteria 3672
246 Ga0207669_10448827 3300025937 Bacteria 1021
247 Ga0207691_10014069 3300025940 Bacteria 7635
248 Ga0207691_10130158 3300025940 Bacteria 2224
249 Ga0207711_10001311 3300025941 Bacteria 23539
250 Ga0207711_10002858 3300025941 Bacteria 15138
251 Ga0207711_10008855 3300025941 Bacteria 8415
252 Ga0207711_10087532 3300025941 Bacteria 2733
253 Ga0207711_10205186 3300025941 Bacteria 1799
254 Ga0207661_10000953 3300025944 Bacteria 19059
255 Ga0207661_10002015 3300025944 Bacteria 14002
256 Ga0207661_10431601 3300025944 Bacteria 1198
257 Ga0207679_10000243 3300025945 Bacteria 41706
258 Ga0207679_10136795 3300025945 Bacteria 1974
259 Ga0207667_10006092 3300025949 Bacteria 14659
260 Ga0207667_10095595 3300025949 Bacteria 3067
261 Ga0207667_10159787 3300025949 Bacteria 2318
262 Ga0207651_10000201 3300025960 Bacteria 26086
263 Ga0207651_10009030 3300025960 Bacteria 5423
264 Ga0207651_10087514 3300025960 Bacteria 2268
265 Ga0207640_10002232 3300025981 Bacteria 10426
266 Ga0207640_10035411 3300025981 Bacteria 3124
267 Ga0207658_10004807 3300025986 Bacteria 9347
268 Ga0207658_10013045 3300025986 Bacteria 5674
269 Ga0207658_10020869 3300025986 Bacteria 4539
270 Ga0207677_10000529 3300026023 Bacteria 24143
271 Ga0207677_10000617 3300026023 Bacteria 21764
272 Ga0207703_10002663 3300026035 Bacteria 15352
273 Ga0207703_10015223 3300026035 Bacteria 6001
274 Ga0207703_10026259 3300026035 Bacteria 4582
275 Ga0207639_10000074 3300026041 Bacteria 91671
276 Ga0207639_10000222 3300026041 Bacteria 42464
277 Ga0207639_10320420 3300026041 Bacteria 1376
278 Ga0207639_10824942 3300026041 Bacteria 865
279 Ga0207678_10009690 3300026067 Bacteria 8475
280 Ga0207678_10017442 3300026067 Bacteria 6307
281 Ga0207678_10074991 3300026067 Bacteria 2898
282 Ga0207702_10000074 3300026078 Bacteria 113070
283 Ga0207702_10041960 3300026078 Bacteria 3836
284 Ga0207702_10056807 3300026078 Bacteria 3324
285 Ga0207702_10246061 3300026078 Bacteria 1677
286 Ga0207702_10341569 3300026078 Bacteria 1430
287 Ga0207702_10441133 3300026078 Bacteria 1262
288 Ga0207641_10006115 3300026088 Bacteria 10188
289 Ga0207648_10002999 3300026089 Bacteria 17838
290 Ga0207648_10195054 3300026089 Bacteria 1795
291 Ga0207676_10007462 3300026095 Bacteria 7760
292 Ga0207676_10019629 3300026095 Bacteria 4934
293 Ga0207676_10091812 3300026095 Bacteria 2495
294 Ga0207674_10002528 3300026116 Bacteria 23055
295 Ga0207674_10017379 3300026116 Bacteria 7849
296 Ga0207674_10027686 3300026116 Bacteria 5991
297 Ga0207674_10400424 3300026116 Bacteria 1327
298 Ga0207683_10005838 3300026121 Bacteria 10554
299 Ga0207698_10000892 3300026142 Bacteria 17333
300 Ga0207698_10004817 3300026142 Bacteria 8264
301 Ga0207698_10004849 3300026142 Bacteria 8241
302 Ga0207698_10005240 3300026142 Bacteria 7975
303 Ga0207698_10011862 3300026142 Bacteria 5673
304 Ga0207698_10128024 3300026142 Bacteria 2164
305 Ga0268266_10002924 3300028379 Bacteria 17669
306 Ga0268266_10065182 3300028379 Bacteria 3149
307 Ga0268264_10026847 3300028381 Bacteria 4705
308 Ga0268264_10268442 3300028381 Bacteria 1593
309 Ga0307410_10002651 3300031852 Bacteria 8725
310 Ga0307409_100029388 3300031995 Bacteria 3933
311 Ga0307409_100173285 3300031995 Bacteria 1901
312 Ga0307411_10029702 3300032005 Bacteria 3342
313 Ga0307415_100163172 3300032126 Bacteria 1729
314 Ga0373923_0004223 3300035111 Bacteria 4744
315 Ga0373957_0006106 3300035120 Bacteria 3777
316 Ga0373960_0047571 3300035121 Bacteria 1262
317 Ga0373955_0066472 3300035172 Bacteria 2004
318 Ga0373931_0004800 3300035691 Bacteria 6205
319 Ga0373937_0045789 3300036401 Bacteria 3998
320 Ga0395899_0030769 3300037312 Bacteria 4036
321 Ga0395899_0076545 3300037312 Bacteria 2442
322 Ga0395899_0211495 3300037312 Bacteria 1347
323 Ga0395900_0027407 3300037418 Bacteria 5835
324 Ga0395900_0073776 3300037418 Bacteria 3508
325 Ga0395900_0144836 3300037418 Bacteria 2430
326 Ga0395900_0246420 3300037418 Bacteria 1790
327 Ga0395900_0320235 3300037418 Bacteria 1531
328 Ga0395900_0708655 3300037418 Bacteria 939
329 Ga0395898_0073747 3300037466 Bacteria 3297
330 Ga0395898_0268989 3300037466 Bacteria 1625
331 Ga0395898_0283275 3300037466 Bacteria 1581
332 Ga0395898_0349860 3300037466 Bacteria 1409
333 Ga0395898_0440137 3300037466 Bacteria 1242
334 Ga0395898_0555722 3300037466 Bacteria 1090
335 Ga0395905_0007087 3300037471 Bacteria 11206
336 Ga0395905_0008691 3300037471 Bacteria 9997
337 Ga0395905_0044424 3300037471 Bacteria 4170
338 Ga0395905_0059911 3300037471 Bacteria 3559
339 Ga0395905_0081300 3300037471 Bacteria 3036
340 Ga0395905_0095028 3300037471 Bacteria 2797
341 Ga0395905_0141424 3300037471 Bacteria 2263
342 Ga0395905_0310825 3300037471 Bacteria 1464
343 Ga0395905_0339276 3300037471 Bacteria 1394
344 Ga0395905_0568062 3300037471 Bacteria 1035
345 Ga0395905_0727682 3300037471 Bacteria 894
346 Ga0395901_0162753 3300038443 Bacteria 2343
347 Ga0395901_0263011 3300038443 Bacteria 1795
348 Ga0395901_0291176 3300038443 Bacteria 1694
349 Ga0395901_0557166 3300038443 Bacteria 1161
350 Ga0395901_0691555 3300038443 Bacteria 1018
351 Ga0436365_1302039 3300039437 Bacteria 91581
352 Ga0439432_058536 3300042006 Bacteria 1191
353 Ga0450905_000185 3300042142 Bacteria 6981
354 Ga0450889_000159 3300042144 Bacteria 7021
355 Ga0466969_0015184 3300044656 Bacteria 4037
356 Ga0466969_0131020 3300044656 Bacteria 1163
357 Ga0466966_0003709 3300044684 Bacteria 10071
358 Ga0466966_0035800 3300044684 Bacteria 3206
359 Ga0466966_0052441 3300044684 Bacteria 2591
360 Ga0466961_0412641 3300044693 Bacteria 819
361 Ga0466963_0007743 3300044694 Bacteria 6419
362 Ga0466963_0022782 3300044694 Bacteria 3970
363 Ga0466971_0019401 3300044719 Bacteria 3019
364 Ga0466971_0114848 3300044719 Bacteria 1244
365 Ga0466970_0001142 3300044765 Bacteria 12860
366 Ga0466970_0187312 3300044765 Bacteria 1149
367 Ga0466957_0004800 3300044842 Bacteria 7566
368 Ga0466957_0008294 3300044842 Bacteria 5904
369 Ga0466957_0057056 3300044842 Bacteria 2389
370 Ga0466957_0124691 3300044842 Bacteria 1645
371 Ga0466959_0084190 3300045049 Bacteria 2289
372 Ga0466959_0370748 3300045049 Bacteria 975
373 Ga0466958_0000291 3300045836 Bacteria 19576
374 Ga0466958_0002446 3300045836 Bacteria 9318
375 Ga0466958_0044503 3300045836 Bacteria 2676
376 Ga0466958_0269324 3300045836 Bacteria 1091
377 Ga0466967_0002800 3300045976 Bacteria 11059
378 Ga0466967_0007507 3300045976 Bacteria 7874
379 Ga0466967_0083253 3300045976 Bacteria 2893
380 Ga0466967_0175379 3300045976 Bacteria 2019
381 Ga0466967_0291936 3300045976 Bacteria 1567
382 Ga0466967_0759927 3300045976 Bacteria 961
383 Ga0495629_0394554 3300046459 Bacteria 941
384 Ga0495623_0025780 3300046679 Bacteria 3786
385 Ga0495602_0025182 3300048088 Bacteria 5761
386 Ga0496100_0001319 3300048903 Bacteria 12124
387 Ga0496101_0000256 3300048904 Bacteria 37912
388 Ga0496101_0313145 3300048904 Bacteria 1231
389 Ga0496102_0006759 3300048905 Bacteria 9793
390 Ga0496104_0010537 3300048907 Bacteria 8257
391 Ga0496104_0079794 3300048907 Bacteria 3120
392 Ga0496105_0017748 3300048908 Bacteria 5709
393 Ga0496105_0085248 3300048908 Bacteria 2610
394 Ga0496106_0009410 3300048909 Bacteria 7223
395 Ga0496107_0000623 3300048910 Bacteria 19871
396 Ga0496107_0103889 3300048910 Bacteria 2085
397 Ga0496107_0106107 3300048910 Bacteria 2063
398 Ga0496108_0000673 3300048911 Bacteria 26408
399 Ga0496108_0051415 3300048911 Bacteria 3452
400 Ga0496109_0006446 3300048912 Bacteria 9884
401 Ga0496109_0017340 3300048912 Bacteria 6310
402 Ga0496110_0001190 3300048913 Bacteria 18527
403 Ga0496110_0155357 3300048913 Bacteria 2072
404 Ga0496111_0000247 3300048914 Bacteria 25998
405 Ga0496112_0000369 3300048915 Bacteria 29388
406 Ga0496112_0014147 3300048915 Bacteria 7391
407 Ga0496113_0000242 3300048916 Bacteria 25756
408 Ga0496113_0156794 3300048916 Bacteria 1798
409 Ga0501067_0028907 3300049583 Bacteria 3073
410 Ga0501069_0119096 3300049585 Bacteria 1507
411 Ga0501070_0062447 3300049586 Bacteria 3086
412 Ga0500597_003636 3300053120 Bacteria 4602
413 Ga0500624_000004 3300053157 Bacteria 196921
414 Ga0500637_0000006 3300053178 Bacteria 99157
415 Ga0466962_0020467 3300061719 Bacteria 3179
416 Ga0466962_0053971 3300061719 Bacteria 1920
417 Ga0466962_0196791 3300061719 Bacteria 984

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025945 Ga0207679_10136795 Ga0207679_101367951 209
2 3300005530 Ga0070679_100219289 Ga0070679_1002192892 218
3 3300005614 Ga0068856_100589533 Ga0068856_1005895332 218
4 3300025909 Ga0207705_10100369 Ga0207705_101003692 218
5 3300025919 Ga0207657_10118474 Ga0207657_101184742 218
6 3300025932 Ga0207690_10140960 Ga0207690_101409602 218
7 3300026067 Ga0207678_10074991 Ga0207678_100749912 218
8 3300031995 Ga0307409_100173285 Ga0307409_1001732852 218
9 3300032126 Ga0307415_100163172 Ga0307415_1001631721 218
10 3300037471 Ga0395905_0141424 Ga0395905_0141424_1494_2234 220
11 3300042006 Ga0439432_058536 Ga0439432_058536_131_859 220
12 3300005331 Ga0070670_100034878 Ga0070670_1000348783 221
13 3300025925 Ga0207650_10050780 Ga0207650_100507803 221
14 3300005985 Ga0081539_10030261 Ga0081539_100302613 222
15 3300005327 Ga0070658_10022380 Ga0070658_100223801 224
16 3300009177 Ga0105248_11201851 Ga0105248_112018511 224
17 3300037418 Ga0395900_0320235 Ga0395900_0320235_26_754 225
18 3300037471 Ga0395905_0008691 Ga0395905_0008691_1757_2485 225
19 3300001991 JGI24743J22301_10006343 JGI24743J22301_100063432 228
20 3300005335 Ga0070666_10018275 Ga0070666_100182751 228
21 3300005338 Ga0068868_100014391 Ga0068868_1000143915 228
22 3300005355 Ga0070671_100578795 Ga0070671_1005787952 228
23 3300005356 Ga0070674_100064458 Ga0070674_1000644583 228
24 3300005364 Ga0070673_100013064 Ga0070673_1000130645 228
25 3300005366 Ga0070659_100041187 Ga0070659_1000411874 228
26 3300005456 Ga0070678_100022790 Ga0070678_1000227901 228
27 3300005459 Ga0068867_100002136 Ga0068867_1000021368 228
28 3300005543 Ga0070672_100025804 Ga0070672_1000258042 228
29 3300005614 Ga0068856_100038433 Ga0068856_1000384334 228
30 3300005616 Ga0068852_100006826 Ga0068852_1000068264 228
31 3300005718 Ga0068866_10003404 Ga0068866_100034044 228
32 3300005841 Ga0068863_100034350 Ga0068863_1000343503 228
33 3300005842 Ga0068858_100048438 Ga0068858_1000484381 228
34 3300005843 Ga0068860_100998393 Ga0068860_1009983932 228
35 3300006358 Ga0068871_100002654 Ga0068871_1000026544 228
36 3300006881 Ga0068865_100001550 Ga0068865_10000155013 228
37 3300009098 Ga0105245_10006481 Ga0105245_100064814 228
38 3300009176 Ga0105242_10013910 Ga0105242_100139103 228
39 3300009177 Ga0105248_11201724 Ga0105248_112017241 228
40 3300009551 Ga0105238_10861457 Ga0105238_108614571 228
41 3300010375 Ga0105239_10064163 Ga0105239_100641634 228
42 3300013297 Ga0157378_10011770 Ga0157378_100117704 228
43 3300013306 Ga0163162_11265476 Ga0163162_112654761 228
44 3300013308 Ga0157375_10048306 Ga0157375_100483061 228
45 3300014325 Ga0163163_10076571 Ga0163163_100765713 228
46 3300014968 Ga0157379_10058776 Ga0157379_100587761 228
47 3300014969 Ga0157376_10013353 Ga0157376_100133534 228
48 3300025899 Ga0207642_10013757 Ga0207642_100137573 228
49 3300025927 Ga0207687_10005116 Ga0207687_100051164 228
50 3300025931 Ga0207644_10000243 Ga0207644_1000024313 228
51 3300025932 Ga0207690_10055627 Ga0207690_100556273 228
52 3300025934 Ga0207686_10022855 Ga0207686_100228554 228
53 3300025937 Ga0207669_10448827 Ga0207669_104488271 228
54 3300025940 Ga0207691_10014069 Ga0207691_100140694 228
55 3300025960 Ga0207651_10000201 Ga0207651_1000020113 228
56 3300026023 Ga0207677_10000529 Ga0207677_1000052926 228
57 3300026035 Ga0207703_10026259 Ga0207703_100262591 228
58 3300026078 Ga0207702_10246061 Ga0207702_102460612 228
59 3300026088 Ga0207641_10006115 Ga0207641_100061155 228
60 3300026089 Ga0207648_10002999 Ga0207648_1000299915 228
61 3300026095 Ga0207676_10091812 Ga0207676_100918122 228
62 3300026121 Ga0207683_10005838 Ga0207683_100058384 228
63 3300026142 Ga0207698_10004817 Ga0207698_100048176 228
64 3300028381 Ga0268264_10026847 Ga0268264_100268473 228
65 3300048903 Ga0496100_0001319 Ga0496100_0001319_6380_7108 228
66 3300048904 Ga0496101_0000256 Ga0496101_0000256_20847_21575 228
67 3300048905 Ga0496102_0006759 Ga0496102_0006759_5054_5782 228
68 3300048907 Ga0496104_0010537 Ga0496104_0010537_3765_4493 228
69 3300048908 Ga0496105_0017748 Ga0496105_0017748_3731_4459 228
70 3300048909 Ga0496106_0009410 Ga0496106_0009410_1857_2585 228
71 3300048910 Ga0496107_0000623 Ga0496107_0000623_13338_14066 228
72 3300048911 Ga0496108_0000673 Ga0496108_0000673_7631_8359 228
73 3300048912 Ga0496109_0006446 Ga0496109_0006446_4970_5698 228
74 3300048913 Ga0496110_0001190 Ga0496110_0001190_4634_5362 228
75 3300048914 Ga0496111_0000247 Ga0496111_0000247_15789_16517 228
76 3300048915 Ga0496112_0000369 Ga0496112_0000369_12681_13409 228
77 3300048916 Ga0496113_0000242 Ga0496113_0000242_2989_3717 228
78 3300005367 Ga0070667_100039974 Ga0070667_1000399744 232
79 3300013306 Ga0163162_11265477 Ga0163162_112654771 232
80 3300013308 Ga0157375_11492946 Ga0157375_114929461 232
81 3300014968 Ga0157379_10614806 Ga0157379_106148061 232
82 3300025924 Ga0207694_10007666 Ga0207694_100076666 232
83 3300025941 Ga0207711_10008855 Ga0207711_100088551 232
84 3300025986 Ga0207658_10013045 Ga0207658_100130454 232
85 3300028379 Ga0268266_10065182 Ga0268266_100651822 232
86 3300044765 Ga0466970_0187312 Ga0466970_0187312_428_1132 234
87 3300005327 Ga0070658_10264455 Ga0070658_102644552 241
88 3300038443 Ga0395901_0557166 Ga0395901_0557166_301_1026 241
89 3300000549 LJQas_1002157 LJQas_10021573 242
90 3300001979 JGI24740J21852_10000892 JGI24740J21852_1000089210 242
91 3300001979 JGI24740J21852_10007482 JGI24740J21852_100074821 242
92 3300001979 JGI24740J21852_10010884 JGI24740J21852_100108843 242
93 3300001979 JGI24740J21852_10026545 JGI24740J21852_100265452 242
94 3300001989 JGI24739J22299_10024527 JGI24739J22299_100245273 242
95 3300001990 JGI24737J22298_10004304 JGI24737J22298_100043044 242
96 3300002075 JGI24738J21930_10000436 JGI24738J21930_100004366 242
97 3300005327 Ga0070658_10000013 Ga0070658_10000013277 242
98 3300005327 Ga0070658_10000377 Ga0070658_1000037730 242
99 3300005327 Ga0070658_10053480 Ga0070658_100534803 242
100 3300005327 Ga0070658_10055811 Ga0070658_100558113 242
101 3300005329 Ga0070683_100001819 Ga0070683_1000018199 242
102 3300005329 Ga0070683_100029367 Ga0070683_1000293672 242
103 3300005329 Ga0070683_100320412 Ga0070683_1003204122 242
104 3300005329 Ga0070683_100596916 Ga0070683_1005969162 242
105 3300005330 Ga0070690_100172028 Ga0070690_1001720283 242
106 3300005331 Ga0070670_100072720 Ga0070670_1000727203 242
107 3300005331 Ga0070670_100110978 Ga0070670_1001109782 242
108 3300005335 Ga0070666_10000779 Ga0070666_1000077920 242
109 3300005336 Ga0070680_100000683 Ga0070680_1000006836 242
110 3300005336 Ga0070680_100243081 Ga0070680_1002430812 242
111 3300005337 Ga0070682_100044278 Ga0070682_1000442783 242
112 3300005338 Ga0068868_100001199 Ga0068868_10000119915 242
113 3300005338 Ga0068868_100002196 Ga0068868_1000021963 242
114 3300005339 Ga0070660_100000986 Ga0070660_1000009869 242
115 3300005339 Ga0070660_100010564 Ga0070660_1000105643 242
116 3300005339 Ga0070660_100050030 Ga0070660_1000500303 242
117 3300005339 Ga0070660_100066040 Ga0070660_1000660403 242
118 3300005339 Ga0070660_100141429 Ga0070660_1001414292 242
119 3300005339 Ga0070660_100281969 Ga0070660_1002819691 242
120 3300005339 Ga0070660_100361823 Ga0070660_1003618232 242
121 3300005343 Ga0070687_100065740 Ga0070687_1000657403 242
122 3300005344 Ga0070661_100000187 Ga0070661_10000018730 242
123 3300005344 Ga0070661_100002402 Ga0070661_10000240211 242
124 3300005344 Ga0070661_100028793 Ga0070661_1000287934 242
125 3300005344 Ga0070661_100063937 Ga0070661_1000639373 242
126 3300005344 Ga0070661_100146267 Ga0070661_1001462672 242
127 3300005344 Ga0070661_100259760 Ga0070661_1002597602 242
128 3300005345 Ga0070692_10018163 Ga0070692_100181632 242
129 3300005353 Ga0070669_100155471 Ga0070669_1001554713 242
130 3300005354 Ga0070675_100013554 Ga0070675_1000135543 242
131 3300005355 Ga0070671_100114259 Ga0070671_1001142592 242
132 3300005364 Ga0070673_100043024 Ga0070673_1000430242 242
133 3300005364 Ga0070673_100136350 Ga0070673_1001363503 242
134 3300005366 Ga0070659_100000191 Ga0070659_10000019120 242
135 3300005366 Ga0070659_100019689 Ga0070659_1000196895 242
136 3300005366 Ga0070659_100022501 Ga0070659_1000225013 242
137 3300005366 Ga0070659_100031474 Ga0070659_1000314743 242
138 3300005366 Ga0070659_100055538 Ga0070659_1000555382 242
139 3300005366 Ga0070659_100139562 Ga0070659_1001395622 242
140 3300005366 Ga0070659_100169718 Ga0070659_1001697183 242
141 3300005366 Ga0070659_100409325 Ga0070659_1004093252 242
142 3300005367 Ga0070667_100001311 Ga0070667_1000013118 242
143 3300005367 Ga0070667_100034211 Ga0070667_1000342115 242
144 3300005367 Ga0070667_100177796 Ga0070667_1001777963 242
145 3300005435 Ga0070714_100011330 Ga0070714_1000113309 242
146 3300005435 Ga0070714_100065447 Ga0070714_1000654473 242
147 3300005436 Ga0070713_100185910 Ga0070713_1001859103 242
148 3300005444 Ga0070694_100011806 Ga0070694_1000118063 242
149 3300005455 Ga0070663_100008779 Ga0070663_1000087793 242
150 3300005457 Ga0070662_100000012 Ga0070662_10000001233 242
151 3300005457 Ga0070662_100007787 Ga0070662_1000077873 242
152 3300005457 Ga0070662_100014793 Ga0070662_1000147934 242
153 3300005459 Ga0068867_100075408 Ga0068867_1000754083 242
154 3300005466 Ga0070685_10355482 Ga0070685_103554822 242
155 3300005535 Ga0070684_100001770 Ga0070684_10000177010 242
156 3300005535 Ga0070684_100014274 Ga0070684_1000142743 242
157 3300005535 Ga0070684_100140127 Ga0070684_1001401272 242
158 3300005535 Ga0070684_100891883 Ga0070684_1008918831 242
159 3300005539 Ga0068853_100000032 Ga0068853_10000003292 242
160 3300005539 Ga0068853_101020797 Ga0068853_1010207971 242
161 3300005543 Ga0070672_100046195 Ga0070672_1000461952 242
162 3300005543 Ga0070672_100065378 Ga0070672_1000653783 242
163 3300005546 Ga0070696_100019730 Ga0070696_1000197303 242
164 3300005547 Ga0070693_100000332 Ga0070693_10000033215 242
165 3300005547 Ga0070693_100043261 Ga0070693_1000432613 242
166 3300005547 Ga0070693_100113428 Ga0070693_1001134283 242
167 3300005548 Ga0070665_100012237 Ga0070665_1000122375 242
168 3300005563 Ga0068855_100000591 Ga0068855_1000005916 242
169 3300005563 Ga0068855_100225089 Ga0068855_1002250892 242
170 3300005563 Ga0068855_100469244 Ga0068855_1004692443 242
171 3300005564 Ga0070664_100000187 Ga0070664_10000018721 242
172 3300005564 Ga0070664_100006340 Ga0070664_1000063403 242
173 3300005564 Ga0070664_100363965 Ga0070664_1003639652 242
174 3300005577 Ga0068857_100008946 Ga0068857_1000089468 242
175 3300005577 Ga0068857_100025895 Ga0068857_1000258954 242
176 3300005577 Ga0068857_100105412 Ga0068857_1001054123 242
177 3300005578 Ga0068854_100012735 Ga0068854_1000127354 242
178 3300005578 Ga0068854_100051468 Ga0068854_1000514683 242
179 3300005578 Ga0068854_100387681 Ga0068854_1003876812 242
180 3300005614 Ga0068856_100000291 Ga0068856_10000029130 242
181 3300005614 Ga0068856_100072026 Ga0068856_1000720263 242
182 3300005614 Ga0068856_100858988 Ga0068856_1008589881 242
183 3300005616 Ga0068852_100000906 Ga0068852_1000009066 242
184 3300005616 Ga0068852_100005010 Ga0068852_1000050107 242
185 3300005616 Ga0068852_100017690 Ga0068852_1000176902 242
186 3300005616 Ga0068852_100036120 Ga0068852_1000361203 242
187 3300005616 Ga0068852_100327744 Ga0068852_1003277443 242
188 3300005616 Ga0068852_100427676 Ga0068852_1004276762 242
189 3300005616 Ga0068852_100436081 Ga0068852_1004360812 242
190 3300005616 Ga0068852_100572595 Ga0068852_1005725952 242
191 3300005617 Ga0068859_100027409 Ga0068859_1000274094 242
192 3300005617 Ga0068859_100115050 Ga0068859_1001150503 242
193 3300005618 Ga0068864_100043193 Ga0068864_1000431933 242
194 3300005842 Ga0068858_100009881 Ga0068858_1000098814 242
195 3300005842 Ga0068858_100014540 Ga0068858_1000145403 242
196 3300006358 Ga0068871_100196193 Ga0068871_1001961932 242
197 3300006931 Ga0097620_100027410 Ga0097620_1000274103 242
198 3300006931 Ga0097620_100115059 Ga0097620_1001150593 242
199 3300009093 Ga0105240_10046462 Ga0105240_100464625 242
200 3300009093 Ga0105240_10121253 Ga0105240_101212533 242
201 3300009098 Ga0105245_10173741 Ga0105245_101737413 242
202 3300009174 Ga0105241_10008737 Ga0105241_100087374 242
203 3300009174 Ga0105241_10017822 Ga0105241_100178224 242
204 3300009177 Ga0105248_10000083 Ga0105248_1000008387 242
205 3300009177 Ga0105248_10001634 Ga0105248_100016348 242
206 3300009177 Ga0105248_10098985 Ga0105248_100989852 242
207 3300009177 Ga0105248_10135144 Ga0105248_101351443 242
208 3300009545 Ga0105237_10057388 Ga0105237_100573884 242
209 3300009551 Ga0105238_10024071 Ga0105238_100240715 242
210 3300013100 Ga0157373_10054935 Ga0157373_100549352 242
211 3300013100 Ga0157373_10207500 Ga0157373_102075002 242
212 3300013100 Ga0157373_10264777 Ga0157373_102647771 242
213 3300013100 Ga0157373_10267393 Ga0157373_102673932 242
214 3300013102 Ga0157371_10006145 Ga0157371_100061456 242
215 3300013104 Ga0157370_10038383 Ga0157370_100383833 242
216 3300013104 Ga0157370_10119157 Ga0157370_101191572 242
217 3300013104 Ga0157370_10272787 Ga0157370_102727872 242
218 3300013105 Ga0157369_10001725 Ga0157369_1000172518 242
219 3300013105 Ga0157369_10003749 Ga0157369_100037498 242
220 3300013105 Ga0157369_10246841 Ga0157369_102468412 242
221 3300013296 Ga0157374_10013104 Ga0157374_100131044 242
222 3300013307 Ga0157372_10050356 Ga0157372_100503562 242
223 3300013307 Ga0157372_10275676 Ga0157372_102756763 242
224 3300013307 Ga0157372_10681344 Ga0157372_106813441 242
225 3300013308 Ga0157375_10102083 Ga0157375_101020833 242
226 3300013308 Ga0157375_10467875 Ga0157375_104678752 242
227 3300014325 Ga0163163_10001064 Ga0163163_100010643 242
228 3300014968 Ga0157379_10185736 Ga0157379_101857362 242
229 3300014969 Ga0157376_10893382 Ga0157376_108933821 242
230 3300020082 Ga0206353_11427135 Ga0206353_114271352 242
231 3300021384 Ga0213876_10000404 Ga0213876_1000040412 242
232 3300025321 Ga0207656_10191811 Ga0207656_101918112 242
233 3300025903 Ga0207680_10002585 Ga0207680_100025853 242
234 3300025903 Ga0207680_10004399 Ga0207680_100043994 242
235 3300025904 Ga0207647_10001376 Ga0207647_100013764 242
236 3300025904 Ga0207647_10013301 Ga0207647_100133015 242
237 3300025909 Ga0207705_10000002 Ga0207705_10000002306 242
238 3300025909 Ga0207705_10000072 Ga0207705_1000007292 242
239 3300025909 Ga0207705_10003045 Ga0207705_100030455 242
240 3300025909 Ga0207705_10011789 Ga0207705_100117893 242
241 3300025909 Ga0207705_10012016 Ga0207705_100120162 242
242 3300025909 Ga0207705_10026811 Ga0207705_100268113 242
243 3300025909 Ga0207705_10079772 Ga0207705_100797723 242
244 3300025909 Ga0207705_10259600 Ga0207705_102596002 242
245 3300025911 Ga0207654_10113203 Ga0207654_101132032 242
246 3300025917 Ga0207660_10000522 Ga0207660_100005226 242
247 3300025917 Ga0207660_10162835 Ga0207660_101628352 242
248 3300025919 Ga0207657_10000176 Ga0207657_1000017633 242
249 3300025919 Ga0207657_10007866 Ga0207657_100078662 242
250 3300025919 Ga0207657_10011747 Ga0207657_100117471 242
251 3300025919 Ga0207657_10016820 Ga0207657_100168206 242
252 3300025919 Ga0207657_10016910 Ga0207657_100169106 242
253 3300025919 Ga0207657_10018718 Ga0207657_100187184 242
254 3300025919 Ga0207657_10019167 Ga0207657_100191673 242
255 3300025919 Ga0207657_10067137 Ga0207657_100671373 242
256 3300025919 Ga0207657_10094442 Ga0207657_100944423 242
257 3300025919 Ga0207657_10119465 Ga0207657_101194653 242
258 3300025919 Ga0207657_10126675 Ga0207657_101266753 242
259 3300025920 Ga0207649_10000810 Ga0207649_1000081012 242
260 3300025920 Ga0207649_10021127 Ga0207649_100211274 242
261 3300025920 Ga0207649_10092749 Ga0207649_100927493 242
262 3300025920 Ga0207649_10107608 Ga0207649_101076083 242
263 3300025924 Ga0207694_10048526 Ga0207694_100485263 242
264 3300025925 Ga0207650_10016610 Ga0207650_100166103 242
265 3300025925 Ga0207650_10263513 Ga0207650_102635132 242
266 3300025927 Ga0207687_10080044 Ga0207687_100800442 242
267 3300025929 Ga0207664_10121487 Ga0207664_101214873 242
268 3300025931 Ga0207644_10009357 Ga0207644_100093575 242
269 3300025931 Ga0207644_10010524 Ga0207644_100105246 242
270 3300025931 Ga0207644_10032341 Ga0207644_100323413 242
271 3300025932 Ga0207690_10000245 Ga0207690_1000024514 242
272 3300025932 Ga0207690_10002842 Ga0207690_1000284212 242
273 3300025932 Ga0207690_10003756 Ga0207690_100037568 242
274 3300025932 Ga0207690_10022196 Ga0207690_100221964 242
275 3300025932 Ga0207690_10065630 Ga0207690_100656303 242
276 3300025932 Ga0207690_10066840 Ga0207690_100668402 242
277 3300025932 Ga0207690_10510460 Ga0207690_105104602 242
278 3300025933 Ga0207706_10000041 Ga0207706_1000004193 242
279 3300025933 Ga0207706_10003596 Ga0207706_100035966 242
280 3300025933 Ga0207706_10058262 Ga0207706_100582622 242
281 3300025933 Ga0207706_10080147 Ga0207706_100801472 242
282 3300025933 Ga0207706_10267005 Ga0207706_102670052 242
283 3300025937 Ga0207669_10017591 Ga0207669_100175913 242
284 3300025940 Ga0207691_10130158 Ga0207691_101301582 242
285 3300025941 Ga0207711_10001311 Ga0207711_100013119 242
286 3300025941 Ga0207711_10002858 Ga0207711_100028582 242
287 3300025941 Ga0207711_10087532 Ga0207711_100875323 242
288 3300025941 Ga0207711_10205186 Ga0207711_102051862 242
289 3300025944 Ga0207661_10000953 Ga0207661_100009539 242
290 3300025944 Ga0207661_10002015 Ga0207661_100020153 242
291 3300025944 Ga0207661_10431601 Ga0207661_104316012 242
292 3300025945 Ga0207679_10000243 Ga0207679_1000024335 242
293 3300025949 Ga0207667_10006092 Ga0207667_100060926 242
294 3300025949 Ga0207667_10095595 Ga0207667_100955953 242
295 3300025949 Ga0207667_10159787 Ga0207667_101597873 242
296 3300025960 Ga0207651_10009030 Ga0207651_100090304 242
297 3300025960 Ga0207651_10087514 Ga0207651_100875142 242
298 3300025981 Ga0207640_10002232 Ga0207640_100022327 242
299 3300025981 Ga0207640_10035411 Ga0207640_100354112 242
300 3300025986 Ga0207658_10004807 Ga0207658_100048079 242
301 3300025986 Ga0207658_10020869 Ga0207658_100208693 242
302 3300026023 Ga0207677_10000617 Ga0207677_1000061719 242
303 3300026035 Ga0207703_10002663 Ga0207703_100026638 242
304 3300026035 Ga0207703_10015223 Ga0207703_100152236 242
305 3300026041 Ga0207639_10000074 Ga0207639_1000007482 242
306 3300026041 Ga0207639_10000222 Ga0207639_1000022213 242
307 3300026041 Ga0207639_10320420 Ga0207639_103204202 242
308 3300026041 Ga0207639_10824942 Ga0207639_108249421 242
309 3300026067 Ga0207678_10009690 Ga0207678_100096903 242
310 3300026067 Ga0207678_10017442 Ga0207678_100174425 242
311 3300026078 Ga0207702_10000074 Ga0207702_1000007429 242
312 3300026078 Ga0207702_10041960 Ga0207702_100419603 242
313 3300026078 Ga0207702_10056807 Ga0207702_100568073 242
314 3300026078 Ga0207702_10341569 Ga0207702_103415692 242
315 3300026078 Ga0207702_10441133 Ga0207702_104411332 242
316 3300026089 Ga0207648_10195054 Ga0207648_101950541 242
317 3300026095 Ga0207676_10007462 Ga0207676_100074629 242
318 3300026095 Ga0207676_10019629 Ga0207676_100196295 242
319 3300026116 Ga0207674_10002528 Ga0207674_1000252811 242
320 3300026116 Ga0207674_10017379 Ga0207674_100173795 242
321 3300026116 Ga0207674_10027686 Ga0207674_100276862 242
322 3300026116 Ga0207674_10400424 Ga0207674_104004242 242
323 3300026142 Ga0207698_10000892 Ga0207698_1000089218 242
324 3300026142 Ga0207698_10004849 Ga0207698_100048498 242
325 3300026142 Ga0207698_10005240 Ga0207698_100052406 242
326 3300026142 Ga0207698_10011862 Ga0207698_100118623 242
327 3300026142 Ga0207698_10128024 Ga0207698_101280242 242
328 3300028379 Ga0268266_10002924 Ga0268266_100029244 242
329 3300028381 Ga0268264_10268442 Ga0268264_102684422 242
330 3300031852 Ga0307410_10002651 Ga0307410_100026512 242
331 3300031995 Ga0307409_100029388 Ga0307409_1000293883 242
332 3300032005 Ga0307411_10029702 Ga0307411_100297023 242
333 3300035111 Ga0373923_0004223 Ga0373923_0004223_3064_3792 242
334 3300035120 Ga0373957_0006106 Ga0373957_0006106_343_1071 242
335 3300035121 Ga0373960_0047571 Ga0373960_0047571_427_1155 242
336 3300035172 Ga0373955_0066472 Ga0373955_0066472_368_1096 242
337 3300035691 Ga0373931_0004800 Ga0373931_0004800_3376_4104 242
338 3300036401 Ga0373937_0045789 Ga0373937_0045789_273_1001 242
339 3300037312 Ga0395899_0030769 Ga0395899_0030769_1689_2432 242
340 3300037312 Ga0395899_0076545 Ga0395899_0076545_1483_2211 242
341 3300037312 Ga0395899_0211495 Ga0395899_0211495_404_1132 242
342 3300037418 Ga0395900_0027407 Ga0395900_0027407_3465_4193 242
343 3300037418 Ga0395900_0073776 Ga0395900_0073776_2598_3341 242
344 3300037418 Ga0395900_0144836 Ga0395900_0144836_950_1678 242
345 3300037418 Ga0395900_0246420 Ga0395900_0246420_479_1207 242
346 3300037418 Ga0395900_0708655 Ga0395900_0708655_150_878 242
347 3300037466 Ga0395898_0073747 Ga0395898_0073747_328_1056 242
348 3300037466 Ga0395898_0268989 Ga0395898_0268989_168_911 242
349 3300037466 Ga0395898_0283275 Ga0395898_0283275_144_872 242
350 3300037466 Ga0395898_0349860 Ga0395898_0349860_96_824 242
351 3300037466 Ga0395898_0440137 Ga0395898_0440137_166_894 242
352 3300037466 Ga0395898_0555722 Ga0395898_0555722_117_845 242
353 3300037471 Ga0395905_0007087 Ga0395905_0007087_8924_9652 242
354 3300037471 Ga0395905_0044424 Ga0395905_0044424_796_1524 242
355 3300037471 Ga0395905_0059911 Ga0395905_0059911_132_860 242
356 3300037471 Ga0395905_0081300 Ga0395905_0081300_1793_2536 242
357 3300037471 Ga0395905_0095028 Ga0395905_0095028_488_1216 242
358 3300037471 Ga0395905_0310825 Ga0395905_0310825_404_1132 242
359 3300037471 Ga0395905_0339276 Ga0395905_0339276_268_996 242
360 3300037471 Ga0395905_0568062 Ga0395905_0568062_30_758 242
361 3300037471 Ga0395905_0727682 Ga0395905_0727682_153_881 242
362 3300038443 Ga0395901_0162753 Ga0395901_0162753_743_1471 242
363 3300038443 Ga0395901_0263011 Ga0395901_0263011_743_1471 242
364 3300038443 Ga0395901_0291176 Ga0395901_0291176_695_1423 242
365 3300038443 Ga0395901_0691555 Ga0395901_0691555_42_770 242
366 3300039437 Ga0436365_1302039 Ga0436365_1302039_66697_67425 242
367 3300042142 Ga0450905_000185 Ga0450905_000185_1060_1788 242
368 3300042144 Ga0450889_000159 Ga0450889_000159_5369_6097 242
369 3300044656 Ga0466969_0015184 Ga0466969_0015184_2842_3570 242
370 3300044656 Ga0466969_0131020 Ga0466969_0131020_231_974 242
371 3300044684 Ga0466966_0003709 Ga0466966_0003709_4679_5407 242
372 3300044684 Ga0466966_0035800 Ga0466966_0035800_784_1527 242
373 3300044684 Ga0466966_0052441 Ga0466966_0052441_1326_2054 242
374 3300044693 Ga0466961_0412641 Ga0466961_0412641_52_780 242
375 3300044694 Ga0466963_0007743 Ga0466963_0007743_5357_6085 242
376 3300044694 Ga0466963_0022782 Ga0466963_0022782_502_1230 242
377 3300044719 Ga0466971_0019401 Ga0466971_0019401_791_1519 242
378 3300044719 Ga0466971_0114848 Ga0466971_0114848_98_838 242
379 3300044765 Ga0466970_0001142 Ga0466970_0001142_8846_9574 242
380 3300044842 Ga0466957_0004800 Ga0466957_0004800_4986_5714 242
381 3300044842 Ga0466957_0008294 Ga0466957_0008294_1310_2053 242
382 3300044842 Ga0466957_0057056 Ga0466957_0057056_1015_1755 242
383 3300044842 Ga0466957_0124691 Ga0466957_0124691_443_1171 242
384 3300045049 Ga0466959_0084190 Ga0466959_0084190_1257_2000 242
385 3300045049 Ga0466959_0370748 Ga0466959_0370748_52_780 242
386 3300045836 Ga0466958_0000291 Ga0466958_0000291_11665_12393 242
387 3300045836 Ga0466958_0002446 Ga0466958_0002446_8334_9077 242
388 3300045836 Ga0466958_0044503 Ga0466958_0044503_928_1731 242
389 3300045836 Ga0466958_0269324 Ga0466958_0269324_17_757 242
390 3300045976 Ga0466967_0002800 Ga0466967_0002800_6323_7051 242
391 3300045976 Ga0466967_0007507 Ga0466967_0007507_5260_5988 242
392 3300045976 Ga0466967_0083253 Ga0466967_0083253_1803_2531 242
393 3300045976 Ga0466967_0175379 Ga0466967_0175379_552_1280 242
394 3300045976 Ga0466967_0291936 Ga0466967_0291936_527_1255 242
395 3300045976 Ga0466967_0759927 Ga0466967_0759927_80_820 242
396 3300046459 Ga0495629_0394554 Ga0495629_0394554_69_812 242
397 3300046679 Ga0495623_0025780 Ga0495623_0025780_1663_2391 242
398 3300048088 Ga0495602_0025182 Ga0495602_0025182_1885_2613 242
399 3300048904 Ga0496101_0313145 Ga0496101_0313145_457_1197 242
400 3300048907 Ga0496104_0079794 Ga0496104_0079794_262_1002 242
401 3300048908 Ga0496105_0085248 Ga0496105_0085248_825_1565 242
402 3300048910 Ga0496107_0103889 Ga0496107_0103889_679_1419 242
403 3300048910 Ga0496107_0106107 Ga0496107_0106107_1325_2053 242
404 3300048911 Ga0496108_0051415 Ga0496108_0051415_1780_2520 242
405 3300048912 Ga0496109_0017340 Ga0496109_0017340_1158_1898 242
406 3300048913 Ga0496110_0155357 Ga0496110_0155357_539_1279 242
407 3300048915 Ga0496112_0014147 Ga0496112_0014147_3994_4734 242
408 3300048916 Ga0496113_0156794 Ga0496113_0156794_497_1237 242
409 3300049583 Ga0501067_0028907 Ga0501067_0028907_880_1620 242
410 3300049585 Ga0501069_0119096 Ga0501069_0119096_371_1111 242
411 3300049586 Ga0501070_0062447 Ga0501070_0062447_1935_2678 242
412 3300053120 Ga0500597_003636 Ga0500597_003636_1813_2541 242
413 3300053157 Ga0500624_000004 Ga0500624_000004_151966_152694 242
414 3300053178 Ga0500637_0000006 Ga0500637_0000006_57673_58401 242
415 3300061719 Ga0466962_0020467 Ga0466962_0020467_269_1009 242
416 3300061719 Ga0466962_0053971 Ga0466962_0053971_983_1711 242
417 3300061719 Ga0466962_0196791 Ga0466962_0196791_121_849 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

43

132

0.93

PF13649

Methyltransf_25

Methyltransferase domain

42

128

0.91

PF08242

Methyltransf_12

Methyltransferase domain

43

130

0.86

PF13489

Methyltransf_23

Methyltransferase domain

17

170

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i9f-assembly1.cif.gz_B crystal structure of a putative type 11 methyltransferase from sulfolobus solfataricus 0.811 39 242
7cpx-assembly1.cif.gz_A lovastatin nonaketide synthase 0.7804 38 176
5bsz-assembly1.cif.gz_A x-ray structure of the sugar n-methyltransferase keds8 from streptoalloteichus sp atcc 53650 0.7794 18 139
3px3-assembly1.cif.gz_D structure of tylm1 from streptomyces fradiae h123a mutant in complex with sah and dtdp-quip3n 0.7764 3 139
7ndm-assembly1.cif.gz_A crystal structure of the heterocyclic toxin methyltransferase from mycobacterium tuberculosis with bound substrate 4-hydroxyisoquinolin-1(2h)-one 0.7713 26 175
ID Description Score Start End Superfamily
af_A0A1D6HKL4_97_377_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8389 26 137 3.40.50.150
af_P9WK01_14_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8361 36 133 3.40.50.150
af_Q9SZ14_73_204_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8168 48 178 3.40.50.150
af_P9WJZ1_37_202_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8113 17 168 3.40.50.150
3i9fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7979 38 242 3.40.50.150
ID Description Score Start End GO Terms
AF-Q9A4E3-F1-model_v4 Class I SAM-dependent methyltransferase 0.8734 1 242 GO:0008168
AF-Q9A4E3-F1-model_v4 Class I SAM-dependent methyltransferase 0.8701 1 242 GO:0008168
AF-A0A2K8L3V0-F1-model_v4 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1, 4-benzoquinol methylase 0.8652 1 239 GO:0008168
GO:0032259
AF-A0A440CX53-F1-model_v4 deleted 0.8616 6 242
AF-A0A3D2R5Z9-F1-model_v4 Class I SAM-dependent methyltransferase 0.8593 1 240 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
82.9 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map